(data stored in ACNUC10821 zone)

EMBL: CP000800

ID   CP000800; SV 1; circular; genomic DNA; STD; PRO; 4979619 BP.
AC   CP000800; AAJZ01000000-AAJZ01000001;
PR   Project:PRJNA13960;
DT   12-SEP-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
DE   Escherichia coli E24377A, complete genome.
KW   .
OS   Escherichia coli O139:H28 str. E24377A
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
RN   [1]
RP   1-4979619
RA   Rasko D.A., Rosovitz M.J., Brinkley C., Myers G.S.A., Seshadri R.,
RA   Cer R.Z., Jiang L., Ravel J.;
RT   ;
RL   Submitted (13-AUG-2007) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr., Rockville, MD
RL   20850, USA
DR   MD5; c5e8e599e56b8bb74fcc4cb4ac3dde2b.
DR   BioSample; SAMN02604038.
DR   EnsemblGenomes-Gn; EBG00001245453.
DR   EnsemblGenomes-Gn; EBG00001245454.
DR   EnsemblGenomes-Gn; EBG00001245455.
DR   EnsemblGenomes-Gn; EBG00001245456.
DR   EnsemblGenomes-Gn; EBG00001245457.
DR   EnsemblGenomes-Gn; EBG00001245458.
DR   EnsemblGenomes-Gn; EBG00001245459.
DR   EnsemblGenomes-Gn; EBG00001245460.
DR   EnsemblGenomes-Gn; EBG00001245461.
DR   EnsemblGenomes-Gn; EBG00001245462.
DR   EnsemblGenomes-Gn; EBG00001245463.
DR   EnsemblGenomes-Gn; EBG00001245464.
DR   EnsemblGenomes-Gn; EBG00001245465.
DR   EnsemblGenomes-Gn; EBG00001245466.
DR   EnsemblGenomes-Gn; EBG00001245467.
DR   EnsemblGenomes-Gn; EBG00001245468.
DR   EnsemblGenomes-Gn; EBG00001245469.
DR   EnsemblGenomes-Gn; EBG00001245470.
DR   EnsemblGenomes-Gn; EBG00001245471.
DR   EnsemblGenomes-Gn; EBG00001245472.
DR   EnsemblGenomes-Gn; EBG00001245473.
DR   EnsemblGenomes-Gn; EBG00001245474.
DR   EnsemblGenomes-Gn; EBG00001245475.
DR   EnsemblGenomes-Gn; EBG00001245476.
DR   EnsemblGenomes-Gn; EBG00001245477.
DR   EnsemblGenomes-Gn; EBG00001245478.
DR   EnsemblGenomes-Gn; EBG00001245479.
DR   EnsemblGenomes-Gn; EBG00001245480.
DR   EnsemblGenomes-Gn; EBG00001245481.
DR   EnsemblGenomes-Gn; EBG00001245482.
DR   EnsemblGenomes-Gn; EBG00001245483.
DR   EnsemblGenomes-Gn; EBG00001245484.
DR   EnsemblGenomes-Gn; EBG00001245485.
DR   EnsemblGenomes-Gn; EBG00001245486.
DR   EnsemblGenomes-Gn; EBG00001245487.
DR   EnsemblGenomes-Gn; EBG00001245488.
DR   EnsemblGenomes-Gn; EBG00001245489.
DR   EnsemblGenomes-Gn; EBG00001245490.
DR   EnsemblGenomes-Gn; EBG00001245491.
DR   EnsemblGenomes-Gn; EBG00001245492.
DR   EnsemblGenomes-Gn; EBG00001245493.
DR   EnsemblGenomes-Gn; EBG00001245494.
DR   EnsemblGenomes-Gn; EBG00001245495.
DR   EnsemblGenomes-Gn; EBG00001245496.
DR   EnsemblGenomes-Gn; EBG00001245497.
DR   EnsemblGenomes-Gn; EBG00001245498.
DR   EnsemblGenomes-Gn; EBG00001245499.
DR   EnsemblGenomes-Gn; EBG00001245500.
DR   EnsemblGenomes-Gn; EBG00001245501.
DR   EnsemblGenomes-Gn; EBG00001245502.
DR   EnsemblGenomes-Gn; EBG00001245503.
DR   EnsemblGenomes-Gn; EBG00001245504.
DR   EnsemblGenomes-Gn; EBG00001245505.
DR   EnsemblGenomes-Gn; EBG00001245506.
DR   EnsemblGenomes-Gn; EBG00001245507.
DR   EnsemblGenomes-Gn; EBG00001245508.
DR   EnsemblGenomes-Gn; EBG00001245509.
DR   EnsemblGenomes-Gn; EBG00001245510.
DR   EnsemblGenomes-Gn; EBG00001245511.
DR   EnsemblGenomes-Gn; EBG00001245512.
DR   EnsemblGenomes-Gn; EBG00001245513.
DR   EnsemblGenomes-Gn; EBG00001245514.
DR   EnsemblGenomes-Gn; EBG00001245515.
DR   EnsemblGenomes-Gn; EBG00001245516.
DR   EnsemblGenomes-Gn; EBG00001245517.
DR   EnsemblGenomes-Gn; EBG00001245518.
DR   EnsemblGenomes-Gn; EBG00001245519.
DR   EnsemblGenomes-Gn; EBG00001245520.
DR   EnsemblGenomes-Gn; EBG00001245521.
DR   EnsemblGenomes-Gn; EBG00001245522.
DR   EnsemblGenomes-Gn; EBG00001245523.
DR   EnsemblGenomes-Gn; EBG00001245524.
DR   EnsemblGenomes-Gn; EBG00001245525.
DR   EnsemblGenomes-Gn; EBG00001245526.
DR   EnsemblGenomes-Gn; EBG00001245527.
DR   EnsemblGenomes-Gn; EBG00001245528.
DR   EnsemblGenomes-Gn; EBG00001245529.
DR   EnsemblGenomes-Gn; EBG00001245530.
DR   EnsemblGenomes-Gn; EBG00001245531.
DR   EnsemblGenomes-Gn; EBG00001245532.
DR   EnsemblGenomes-Gn; EBG00001245533.
DR   EnsemblGenomes-Gn; EBG00001245534.
DR   EnsemblGenomes-Gn; EBG00001245535.
DR   EnsemblGenomes-Gn; EBG00001245536.
DR   EnsemblGenomes-Gn; EBG00001245537.
DR   EnsemblGenomes-Gn; EBG00001245538.
DR   EnsemblGenomes-Gn; EBG00001245539.
DR   EnsemblGenomes-Gn; EBG00001245540.
DR   EnsemblGenomes-Gn; EBG00001245541.
DR   EnsemblGenomes-Gn; EBG00001245542.
DR   EnsemblGenomes-Gn; EBG00001245543.
DR   EnsemblGenomes-Gn; EBG00001245544.
DR   EnsemblGenomes-Gn; EBG00001245545.
DR   EnsemblGenomes-Gn; EBG00001245546.
DR   EnsemblGenomes-Gn; EBG00001245547.
DR   EnsemblGenomes-Gn; EBG00001245548.
DR   EnsemblGenomes-Gn; EBG00001245549.
DR   EnsemblGenomes-Gn; EBG00001245550.
DR   EnsemblGenomes-Gn; EBG00001245551.
DR   EnsemblGenomes-Gn; EBG00001245552.
DR   EnsemblGenomes-Gn; EBG00001245553.
DR   EnsemblGenomes-Gn; EBG00001245554.
DR   EnsemblGenomes-Gn; EBG00001245555.
DR   EnsemblGenomes-Gn; EBG00001245556.
DR   EnsemblGenomes-Gn; EBG00001245557.
DR   EnsemblGenomes-Gn; EBG00001245558.
DR   EnsemblGenomes-Gn; EBG00001245559.
DR   EnsemblGenomes-Gn; EBG00001245560.
DR   EnsemblGenomes-Gn; EBG00001245561.
DR   EnsemblGenomes-Gn; EBG00001245562.
DR   EnsemblGenomes-Gn; EBG00001245563.
DR   EnsemblGenomes-Gn; EBG00001245564.
DR   EnsemblGenomes-Gn; EBG00001245565.
DR   EnsemblGenomes-Gn; EBG00001245566.
DR   EnsemblGenomes-Gn; EBG00001245567.
DR   EnsemblGenomes-Gn; EBG00001245568.
DR   EnsemblGenomes-Gn; EBG00001245569.
DR   EnsemblGenomes-Gn; EBG00001245570.
DR   EnsemblGenomes-Gn; EBG00001245571.
DR   EnsemblGenomes-Gn; EBG00001245572.
DR   EnsemblGenomes-Gn; EBG00001245573.
DR   EnsemblGenomes-Gn; EBG00001245574.
DR   EnsemblGenomes-Gn; EBG00001245575.
DR   EnsemblGenomes-Gn; EBG00001245576.
DR   EnsemblGenomes-Gn; EBG00001245577.
DR   EnsemblGenomes-Gn; EBG00001245578.
DR   EnsemblGenomes-Gn; EBG00001245579.
DR   EnsemblGenomes-Gn; EBG00001245580.
DR   EnsemblGenomes-Gn; EBG00001245581.
DR   EnsemblGenomes-Gn; EBG00001245582.
DR   EnsemblGenomes-Gn; EBG00001245583.
DR   EnsemblGenomes-Gn; EBG00001245584.
DR   EnsemblGenomes-Gn; EBG00001245585.
DR   EnsemblGenomes-Gn; EBG00001245586.
DR   EnsemblGenomes-Gn; EBG00001245587.
DR   EnsemblGenomes-Gn; EBG00001245588.
DR   EnsemblGenomes-Gn; EBG00001245589.
DR   EnsemblGenomes-Gn; EBG00001245590.
DR   EnsemblGenomes-Gn; EBG00001245591.
DR   EnsemblGenomes-Gn; EBG00001245592.
DR   EnsemblGenomes-Gn; EBG00001245593.
DR   EnsemblGenomes-Gn; EBG00001245594.
DR   EnsemblGenomes-Gn; EBG00001245595.
DR   EnsemblGenomes-Gn; EBG00001245596.
DR   EnsemblGenomes-Gn; EBG00001245597.
DR   EnsemblGenomes-Gn; EBG00001245598.
DR   EnsemblGenomes-Gn; EBG00001245599.
DR   EnsemblGenomes-Gn; EBG00001245600.
DR   EnsemblGenomes-Gn; EBG00001245601.
DR   EnsemblGenomes-Gn; EBG00001245602.
DR   EnsemblGenomes-Gn; EBG00001245603.
DR   EnsemblGenomes-Gn; EBG00001245604.
DR   EnsemblGenomes-Gn; EBG00001245605.
DR   EnsemblGenomes-Gn; EBG00001245606.
DR   EnsemblGenomes-Gn; EBG00001245607.
DR   EnsemblGenomes-Gn; EBG00001245608.
DR   EnsemblGenomes-Gn; EBG00001245609.
DR   EnsemblGenomes-Gn; EBG00001245610.
DR   EnsemblGenomes-Gn; EBG00001245611.
DR   EnsemblGenomes-Gn; EBG00001245612.
DR   EnsemblGenomes-Gn; EBG00001245613.
DR   EnsemblGenomes-Gn; EBG00001245614.
DR   EnsemblGenomes-Gn; EBG00001245615.
DR   EnsemblGenomes-Gn; EBG00001245616.
DR   EnsemblGenomes-Gn; EBG00001245617.
DR   EnsemblGenomes-Gn; EBG00001245618.
DR   EnsemblGenomes-Gn; EBG00001245619.
DR   EnsemblGenomes-Gn; EBG00001245620.
DR   EnsemblGenomes-Gn; EBG00001245621.
DR   EnsemblGenomes-Gn; EBG00001245622.
DR   EnsemblGenomes-Gn; EBG00001245623.
DR   EnsemblGenomes-Gn; EBG00001245624.
DR   EnsemblGenomes-Gn; EBG00001245625.
DR   EnsemblGenomes-Gn; EBG00001245626.
DR   EnsemblGenomes-Gn; EBG00001245627.
DR   EnsemblGenomes-Gn; EBG00001245628.
DR   EnsemblGenomes-Gn; EBG00001245629.
DR   EnsemblGenomes-Gn; EBG00001245630.
DR   EnsemblGenomes-Gn; EBG00001245631.
DR   EnsemblGenomes-Gn; EBG00001245632.
DR   EnsemblGenomes-Gn; EBG00001245633.
DR   EnsemblGenomes-Gn; EBG00001245634.
DR   EnsemblGenomes-Gn; EBG00001245635.
DR   EnsemblGenomes-Gn; EBG00001245636.
DR   EnsemblGenomes-Gn; EBG00001245637.
DR   EnsemblGenomes-Gn; EBG00001245638.
DR   EnsemblGenomes-Gn; EBG00001245639.
DR   EnsemblGenomes-Gn; EBG00001245640.
DR   EnsemblGenomes-Gn; EBG00001245641.
DR   EnsemblGenomes-Gn; EBG00001245642.
DR   EnsemblGenomes-Gn; EBG00001245643.
DR   EnsemblGenomes-Gn; EBG00001245644.
DR   EnsemblGenomes-Gn; EBG00001245645.
DR   EnsemblGenomes-Gn; EBG00001245646.
DR   EnsemblGenomes-Gn; EBG00001245647.
DR   EnsemblGenomes-Gn; EBG00001245648.
DR   EnsemblGenomes-Gn; EBG00001245649.
DR   EnsemblGenomes-Gn; EBG00001245650.
DR   EnsemblGenomes-Gn; EBG00001245651.
DR   EnsemblGenomes-Gn; EBG00001245652.
DR   EnsemblGenomes-Gn; EBG00001245653.
DR   EnsemblGenomes-Gn; EBG00001245654.
DR   EnsemblGenomes-Gn; EBG00001245655.
DR   EnsemblGenomes-Gn; EBG00001245656.
DR   EnsemblGenomes-Gn; EBG00001245657.
DR   EnsemblGenomes-Gn; EBG00001245658.
DR   EnsemblGenomes-Gn; EBG00001245659.
DR   EnsemblGenomes-Gn; EBG00001245660.
DR   EnsemblGenomes-Gn; EBG00001245661.
DR   EnsemblGenomes-Gn; EBG00001245662.
DR   EnsemblGenomes-Gn; EBG00001245663.
DR   EnsemblGenomes-Gn; EBG00001245664.
DR   EnsemblGenomes-Gn; EBG00001245665.
DR   EnsemblGenomes-Gn; EBG00001245666.
DR   EnsemblGenomes-Gn; EBG00001245667.
DR   EnsemblGenomes-Gn; EBG00001245668.
DR   EnsemblGenomes-Gn; EBG00001245669.
DR   EnsemblGenomes-Gn; EBG00001245670.
DR   EnsemblGenomes-Gn; EBG00001245671.
DR   EnsemblGenomes-Gn; EBG00001245672.
DR   EnsemblGenomes-Gn; EBG00001245673.
DR   EnsemblGenomes-Gn; EBG00001245674.
DR   EnsemblGenomes-Gn; EBG00001245675.
DR   EnsemblGenomes-Gn; EBG00001245676.
DR   EnsemblGenomes-Gn; EBG00001245677.
DR   EnsemblGenomes-Gn; EBG00001245678.
DR   EnsemblGenomes-Gn; EBG00001245679.
DR   EnsemblGenomes-Gn; EBG00001245680.
DR   EnsemblGenomes-Gn; EBG00001245681.
DR   EnsemblGenomes-Gn; EBG00001245682.
DR   EnsemblGenomes-Gn; EBG00001245683.
DR   EnsemblGenomes-Gn; EBG00001245684.
DR   EnsemblGenomes-Gn; EBG00001245685.
DR   EnsemblGenomes-Gn; EBG00001245686.
DR   EnsemblGenomes-Gn; EBG00001245687.
DR   EnsemblGenomes-Gn; EBG00001245688.
DR   EnsemblGenomes-Gn; EBG00001245689.
DR   EnsemblGenomes-Gn; EBG00001245690.
DR   EnsemblGenomes-Gn; EBG00001245691.
DR   EnsemblGenomes-Gn; EcE24377A_5003.
DR   EnsemblGenomes-Gn; EcE24377A_5004.
DR   EnsemblGenomes-Gn; EcE24377A_5005.
DR   EnsemblGenomes-Gn; EcE24377A_5006.
DR   EnsemblGenomes-Gn; EcE24377A_5007.
DR   EnsemblGenomes-Gn; EcE24377A_5008.
DR   EnsemblGenomes-Gn; EcE24377A_5009.
DR   EnsemblGenomes-Gn; EcE24377A_5010.
DR   EnsemblGenomes-Gn; EcE24377A_5011.
DR   EnsemblGenomes-Gn; EcE24377A_5012.
DR   EnsemblGenomes-Gn; EcE24377A_5013.
DR   EnsemblGenomes-Gn; EcE24377A_5014.
DR   EnsemblGenomes-Gn; EcE24377A_5015.
DR   EnsemblGenomes-Gn; EcE24377A_5016.
DR   EnsemblGenomes-Gn; EcE24377A_5017.
DR   EnsemblGenomes-Gn; EcE24377A_5018.
DR   EnsemblGenomes-Gn; EcE24377A_5019.
DR   EnsemblGenomes-Gn; EcE24377A_5020.
DR   EnsemblGenomes-Gn; EcE24377A_5021.
DR   EnsemblGenomes-Gn; EcE24377A_5022.
DR   EnsemblGenomes-Gn; EcE24377A_5023.
DR   EnsemblGenomes-Gn; EcE24377A_5024.
DR   EnsemblGenomes-Gn; EcE24377A_5025.
DR   EnsemblGenomes-Gn; EcE24377A_5026.
DR   EnsemblGenomes-Gn; EcE24377A_5027.
DR   EnsemblGenomes-Gn; EcE24377A_5028.
DR   EnsemblGenomes-Gn; EcE24377A_5029.
DR   EnsemblGenomes-Gn; EcE24377A_5030.
DR   EnsemblGenomes-Gn; EcE24377A_5031.
DR   EnsemblGenomes-Gn; EcE24377A_5032.
DR   EnsemblGenomes-Gn; EcE24377A_5033.
DR   EnsemblGenomes-Gn; EcE24377A_5034.
DR   EnsemblGenomes-Gn; EcE24377A_5035.
DR   EnsemblGenomes-Gn; EcE24377A_5036.
DR   EnsemblGenomes-Gn; EcE24377A_5037.
DR   EnsemblGenomes-Gn; EcE24377A_5038.
DR   EnsemblGenomes-Gn; EcE24377A_5039.
DR   EnsemblGenomes-Gn; EcE24377A_5040.
DR   EnsemblGenomes-Gn; EcE24377A_5041.
DR   EnsemblGenomes-Gn; EcE24377A_5042.
DR   EnsemblGenomes-Gn; EcE24377A_5043.
DR   EnsemblGenomes-Gn; EcE24377A_5044.
DR   EnsemblGenomes-Gn; EcE24377A_5045.
DR   EnsemblGenomes-Gn; EcE24377A_5046.
DR   EnsemblGenomes-Gn; EcE24377A_5047.
DR   EnsemblGenomes-Gn; EcE24377A_5048.
DR   EnsemblGenomes-Gn; EcE24377A_5049.
DR   EnsemblGenomes-Gn; EcE24377A_5050.
DR   EnsemblGenomes-Gn; EcE24377A_5051.
DR   EnsemblGenomes-Gn; EcE24377A_5052.
DR   EnsemblGenomes-Gn; EcE24377A_5053.
DR   EnsemblGenomes-Gn; EcE24377A_5054.
DR   EnsemblGenomes-Gn; EcE24377A_5055.
DR   EnsemblGenomes-Gn; EcE24377A_5056.
DR   EnsemblGenomes-Gn; EcE24377A_5058.
DR   EnsemblGenomes-Gn; EcE24377A_5059.
DR   EnsemblGenomes-Gn; EcE24377A_5060.
DR   EnsemblGenomes-Gn; EcE24377A_5061.
DR   EnsemblGenomes-Gn; EcE24377A_5062.
DR   EnsemblGenomes-Gn; EcE24377A_5063.
DR   EnsemblGenomes-Gn; EcE24377A_5064.
DR   EnsemblGenomes-Gn; EcE24377A_5065.
DR   EnsemblGenomes-Gn; EcE24377A_5066.
DR   EnsemblGenomes-Gn; EcE24377A_5067.
DR   EnsemblGenomes-Gn; EcE24377A_5068.
DR   EnsemblGenomes-Gn; EcE24377A_5069.
DR   EnsemblGenomes-Gn; EcE24377A_5070.
DR   EnsemblGenomes-Gn; EcE24377A_5071.
DR   EnsemblGenomes-Gn; EcE24377A_5072.
DR   EnsemblGenomes-Gn; EcE24377A_5073.
DR   EnsemblGenomes-Gn; EcE24377A_5074.
DR   EnsemblGenomes-Gn; EcE24377A_5075.
DR   EnsemblGenomes-Gn; EcE24377A_5076.
DR   EnsemblGenomes-Gn; EcE24377A_5077.
DR   EnsemblGenomes-Gn; EcE24377A_5078.
DR   EnsemblGenomes-Gn; EcE24377A_5079.
DR   EnsemblGenomes-Gn; EcE24377A_5080.
DR   EnsemblGenomes-Gn; EcE24377A_5081.
DR   EnsemblGenomes-Gn; EcE24377A_5082.
DR   EnsemblGenomes-Gn; EcE24377A_5083.
DR   EnsemblGenomes-Gn; EcE24377A_5084.
DR   EnsemblGenomes-Gn; EcE24377A_5085.
DR   EnsemblGenomes-Gn; EcE24377A_5086.
DR   EnsemblGenomes-Gn; EcE24377A_5087.
DR   EnsemblGenomes-Gn; EcE24377A_5088.
DR   EnsemblGenomes-Gn; EcE24377A_5089.
DR   EnsemblGenomes-Gn; EcE24377A_5090.
DR   EnsemblGenomes-Gn; EcE24377A_5091.
DR   EnsemblGenomes-Gn; EcE24377A_5092.
DR   EnsemblGenomes-Gn; EcE24377A_5093.
DR   EnsemblGenomes-Gn; EcE24377A_5094.
DR   EnsemblGenomes-Gn; EcE24377A_5095.
DR   EnsemblGenomes-Gn; EcE24377A_5096.
DR   EnsemblGenomes-Gn; EcE24377A_5097.
DR   EnsemblGenomes-Gn; EcE24377A_5098.
DR   EnsemblGenomes-Gn; EcE24377A_5099.
DR   EnsemblGenomes-Gn; EcE24377A_5100.
DR   EnsemblGenomes-Gn; EcE24377A_5101.
DR   EnsemblGenomes-Gn; EcE24377A_5102.
DR   EnsemblGenomes-Gn; EcE24377A_5103.
DR   EnsemblGenomes-Gn; EcE24377A_5104.
DR   EnsemblGenomes-Gn; EcE24377A_5105.
DR   EnsemblGenomes-Gn; EcE24377A_5106.
DR   EnsemblGenomes-Gn; EcE24377A_5107.
DR   EnsemblGenomes-Gn; EcE24377A_5108.
DR   EnsemblGenomes-Gn; EcE24377A_5109.
DR   EnsemblGenomes-Gn; EcE24377A_5110.
DR   EnsemblGenomes-Gn; EcE24377A_5111.
DR   EnsemblGenomes-Gn; EcE24377A_5112.
DR   EnsemblGenomes-Gn; EcE24377A_5113.
DR   EnsemblGenomes-Gn; EcE24377A_5114.
DR   EnsemblGenomes-Gn; EcE24377A_5115.
DR   EnsemblGenomes-Tr; EBT00001590775.
DR   EnsemblGenomes-Tr; EBT00001590776.
DR   EnsemblGenomes-Tr; EBT00001590777.
DR   EnsemblGenomes-Tr; EBT00001590778.
DR   EnsemblGenomes-Tr; EBT00001590779.
DR   EnsemblGenomes-Tr; EBT00001590780.
DR   EnsemblGenomes-Tr; EBT00001590781.
DR   EnsemblGenomes-Tr; EBT00001590782.
DR   EnsemblGenomes-Tr; EBT00001590783.
DR   EnsemblGenomes-Tr; EBT00001590784.
DR   EnsemblGenomes-Tr; EBT00001590785.
DR   EnsemblGenomes-Tr; EBT00001590786.
DR   EnsemblGenomes-Tr; EBT00001590787.
DR   EnsemblGenomes-Tr; EBT00001590788.
DR   EnsemblGenomes-Tr; EBT00001590789.
DR   EnsemblGenomes-Tr; EBT00001590790.
DR   EnsemblGenomes-Tr; EBT00001590791.
DR   EnsemblGenomes-Tr; EBT00001590792.
DR   EnsemblGenomes-Tr; EBT00001590793.
DR   EnsemblGenomes-Tr; EBT00001590794.
DR   EnsemblGenomes-Tr; EBT00001590795.
DR   EnsemblGenomes-Tr; EBT00001590796.
DR   EnsemblGenomes-Tr; EBT00001590797.
DR   EnsemblGenomes-Tr; EBT00001590798.
DR   EnsemblGenomes-Tr; EBT00001590799.
DR   EnsemblGenomes-Tr; EBT00001590800.
DR   EnsemblGenomes-Tr; EBT00001590801.
DR   EnsemblGenomes-Tr; EBT00001590802.
DR   EnsemblGenomes-Tr; EBT00001590803.
DR   EnsemblGenomes-Tr; EBT00001590804.
DR   EnsemblGenomes-Tr; EBT00001590805.
DR   EnsemblGenomes-Tr; EBT00001590806.
DR   EnsemblGenomes-Tr; EBT00001590807.
DR   EnsemblGenomes-Tr; EBT00001590808.
DR   EnsemblGenomes-Tr; EBT00001590809.
DR   EnsemblGenomes-Tr; EBT00001590810.
DR   EnsemblGenomes-Tr; EBT00001590811.
DR   EnsemblGenomes-Tr; EBT00001590812.
DR   EnsemblGenomes-Tr; EBT00001590813.
DR   EnsemblGenomes-Tr; EBT00001590814.
DR   EnsemblGenomes-Tr; EBT00001590815.
DR   EnsemblGenomes-Tr; EBT00001590816.
DR   EnsemblGenomes-Tr; EBT00001590817.
DR   EnsemblGenomes-Tr; EBT00001590818.
DR   EnsemblGenomes-Tr; EBT00001590819.
DR   EnsemblGenomes-Tr; EBT00001590820.
DR   EnsemblGenomes-Tr; EBT00001590821.
DR   EnsemblGenomes-Tr; EBT00001590822.
DR   EnsemblGenomes-Tr; EBT00001590823.
DR   EnsemblGenomes-Tr; EBT00001590824.
DR   EnsemblGenomes-Tr; EBT00001590825.
DR   EnsemblGenomes-Tr; EBT00001590826.
DR   EnsemblGenomes-Tr; EBT00001590827.
DR   EnsemblGenomes-Tr; EBT00001590828.
DR   EnsemblGenomes-Tr; EBT00001590829.
DR   EnsemblGenomes-Tr; EBT00001590830.
DR   EnsemblGenomes-Tr; EBT00001590831.
DR   EnsemblGenomes-Tr; EBT00001590832.
DR   EnsemblGenomes-Tr; EBT00001590833.
DR   EnsemblGenomes-Tr; EBT00001590834.
DR   EnsemblGenomes-Tr; EBT00001590835.
DR   EnsemblGenomes-Tr; EBT00001590836.
DR   EnsemblGenomes-Tr; EBT00001590837.
DR   EnsemblGenomes-Tr; EBT00001590838.
DR   EnsemblGenomes-Tr; EBT00001590839.
DR   EnsemblGenomes-Tr; EBT00001590840.
DR   EnsemblGenomes-Tr; EBT00001590841.
DR   EnsemblGenomes-Tr; EBT00001590842.
DR   EnsemblGenomes-Tr; EBT00001590843.
DR   EnsemblGenomes-Tr; EBT00001590844.
DR   EnsemblGenomes-Tr; EBT00001590845.
DR   EnsemblGenomes-Tr; EBT00001590846.
DR   EnsemblGenomes-Tr; EBT00001590847.
DR   EnsemblGenomes-Tr; EBT00001590848.
DR   EnsemblGenomes-Tr; EBT00001590849.
DR   EnsemblGenomes-Tr; EBT00001590850.
DR   EnsemblGenomes-Tr; EBT00001590851.
DR   EnsemblGenomes-Tr; EBT00001590852.
DR   EnsemblGenomes-Tr; EBT00001590853.
DR   EnsemblGenomes-Tr; EBT00001590854.
DR   EnsemblGenomes-Tr; EBT00001590855.
DR   EnsemblGenomes-Tr; EBT00001590856.
DR   EnsemblGenomes-Tr; EBT00001590857.
DR   EnsemblGenomes-Tr; EBT00001590858.
DR   EnsemblGenomes-Tr; EBT00001590859.
DR   EnsemblGenomes-Tr; EBT00001590860.
DR   EnsemblGenomes-Tr; EBT00001590861.
DR   EnsemblGenomes-Tr; EBT00001590862.
DR   EnsemblGenomes-Tr; EBT00001590863.
DR   EnsemblGenomes-Tr; EBT00001590864.
DR   EnsemblGenomes-Tr; EBT00001590865.
DR   EnsemblGenomes-Tr; EBT00001590866.
DR   EnsemblGenomes-Tr; EBT00001590867.
DR   EnsemblGenomes-Tr; EBT00001590868.
DR   EnsemblGenomes-Tr; EBT00001590869.
DR   EnsemblGenomes-Tr; EBT00001590870.
DR   EnsemblGenomes-Tr; EBT00001590871.
DR   EnsemblGenomes-Tr; EBT00001590872.
DR   EnsemblGenomes-Tr; EBT00001590873.
DR   EnsemblGenomes-Tr; EBT00001590874.
DR   EnsemblGenomes-Tr; EBT00001590875.
DR   EnsemblGenomes-Tr; EBT00001590876.
DR   EnsemblGenomes-Tr; EBT00001590877.
DR   EnsemblGenomes-Tr; EBT00001590878.
DR   EnsemblGenomes-Tr; EBT00001590879.
DR   EnsemblGenomes-Tr; EBT00001590880.
DR   EnsemblGenomes-Tr; EBT00001590881.
DR   EnsemblGenomes-Tr; EBT00001590882.
DR   EnsemblGenomes-Tr; EBT00001590883.
DR   EnsemblGenomes-Tr; EBT00001590884.
DR   EnsemblGenomes-Tr; EBT00001590885.
DR   EnsemblGenomes-Tr; EBT00001590886.
DR   EnsemblGenomes-Tr; EBT00001590887.
DR   EnsemblGenomes-Tr; EBT00001590888.
DR   EnsemblGenomes-Tr; EBT00001590889.
DR   EnsemblGenomes-Tr; EBT00001590890.
DR   EnsemblGenomes-Tr; EBT00001590891.
DR   EnsemblGenomes-Tr; EBT00001590892.
DR   EnsemblGenomes-Tr; EBT00001590893.
DR   EnsemblGenomes-Tr; EBT00001590894.
DR   EnsemblGenomes-Tr; EBT00001590895.
DR   EnsemblGenomes-Tr; EBT00001590896.
DR   EnsemblGenomes-Tr; EBT00001590897.
DR   EnsemblGenomes-Tr; EBT00001590898.
DR   EnsemblGenomes-Tr; EBT00001590899.
DR   EnsemblGenomes-Tr; EBT00001590900.
DR   EnsemblGenomes-Tr; EBT00001590901.
DR   EnsemblGenomes-Tr; EBT00001590902.
DR   EnsemblGenomes-Tr; EBT00001590903.
DR   EnsemblGenomes-Tr; EBT00001590904.
DR   EnsemblGenomes-Tr; EBT00001590905.
DR   EnsemblGenomes-Tr; EBT00001590906.
DR   EnsemblGenomes-Tr; EBT00001590907.
DR   EnsemblGenomes-Tr; EBT00001590908.
DR   EnsemblGenomes-Tr; EBT00001590909.
DR   EnsemblGenomes-Tr; EBT00001590910.
DR   EnsemblGenomes-Tr; EBT00001590911.
DR   EnsemblGenomes-Tr; EBT00001590912.
DR   EnsemblGenomes-Tr; EBT00001590913.
DR   EnsemblGenomes-Tr; EBT00001590914.
DR   EnsemblGenomes-Tr; EBT00001590915.
DR   EnsemblGenomes-Tr; EBT00001590916.
DR   EnsemblGenomes-Tr; EBT00001590917.
DR   EnsemblGenomes-Tr; EBT00001590918.
DR   EnsemblGenomes-Tr; EBT00001590919.
DR   EnsemblGenomes-Tr; EBT00001590920.
DR   EnsemblGenomes-Tr; EBT00001590921.
DR   EnsemblGenomes-Tr; EBT00001590922.
DR   EnsemblGenomes-Tr; EBT00001590923.
DR   EnsemblGenomes-Tr; EBT00001590924.
DR   EnsemblGenomes-Tr; EBT00001590925.
DR   EnsemblGenomes-Tr; EBT00001590926.
DR   EnsemblGenomes-Tr; EBT00001590927.
DR   EnsemblGenomes-Tr; EBT00001590928.
DR   EnsemblGenomes-Tr; EBT00001590929.
DR   EnsemblGenomes-Tr; EBT00001590930.
DR   EnsemblGenomes-Tr; EBT00001590931.
DR   EnsemblGenomes-Tr; EBT00001590932.
DR   EnsemblGenomes-Tr; EBT00001590933.
DR   EnsemblGenomes-Tr; EBT00001590934.
DR   EnsemblGenomes-Tr; EBT00001590935.
DR   EnsemblGenomes-Tr; EBT00001590936.
DR   EnsemblGenomes-Tr; EBT00001590937.
DR   EnsemblGenomes-Tr; EBT00001590938.
DR   EnsemblGenomes-Tr; EBT00001590939.
DR   EnsemblGenomes-Tr; EBT00001590940.
DR   EnsemblGenomes-Tr; EBT00001590941.
DR   EnsemblGenomes-Tr; EBT00001590942.
DR   EnsemblGenomes-Tr; EBT00001590943.
DR   EnsemblGenomes-Tr; EBT00001590944.
DR   EnsemblGenomes-Tr; EBT00001590945.
DR   EnsemblGenomes-Tr; EBT00001590946.
DR   EnsemblGenomes-Tr; EBT00001590947.
DR   EnsemblGenomes-Tr; EBT00001590948.
DR   EnsemblGenomes-Tr; EBT00001590949.
DR   EnsemblGenomes-Tr; EBT00001590950.
DR   EnsemblGenomes-Tr; EBT00001590951.
DR   EnsemblGenomes-Tr; EBT00001590952.
DR   EnsemblGenomes-Tr; EBT00001590953.
DR   EnsemblGenomes-Tr; EBT00001590954.
DR   EnsemblGenomes-Tr; EBT00001590955.
DR   EnsemblGenomes-Tr; EBT00001590956.
DR   EnsemblGenomes-Tr; EBT00001590957.
DR   EnsemblGenomes-Tr; EBT00001590958.
DR   EnsemblGenomes-Tr; EBT00001590959.
DR   EnsemblGenomes-Tr; EBT00001590960.
DR   EnsemblGenomes-Tr; EBT00001590961.
DR   EnsemblGenomes-Tr; EBT00001590962.
DR   EnsemblGenomes-Tr; EBT00001590963.
DR   EnsemblGenomes-Tr; EBT00001590964.
DR   EnsemblGenomes-Tr; EBT00001590965.
DR   EnsemblGenomes-Tr; EBT00001590966.
DR   EnsemblGenomes-Tr; EBT00001590967.
DR   EnsemblGenomes-Tr; EBT00001590968.
DR   EnsemblGenomes-Tr; EBT00001590969.
DR   EnsemblGenomes-Tr; EBT00001590970.
DR   EnsemblGenomes-Tr; EBT00001590971.
DR   EnsemblGenomes-Tr; EBT00001590972.
DR   EnsemblGenomes-Tr; EBT00001590973.
DR   EnsemblGenomes-Tr; EBT00001590974.
DR   EnsemblGenomes-Tr; EBT00001590975.
DR   EnsemblGenomes-Tr; EBT00001590976.
DR   EnsemblGenomes-Tr; EBT00001590977.
DR   EnsemblGenomes-Tr; EBT00001590978.
DR   EnsemblGenomes-Tr; EBT00001590979.
DR   EnsemblGenomes-Tr; EBT00001590980.
DR   EnsemblGenomes-Tr; EBT00001590981.
DR   EnsemblGenomes-Tr; EBT00001590982.
DR   EnsemblGenomes-Tr; EBT00001590983.
DR   EnsemblGenomes-Tr; EBT00001590984.
DR   EnsemblGenomes-Tr; EBT00001590985.
DR   EnsemblGenomes-Tr; EBT00001590986.
DR   EnsemblGenomes-Tr; EBT00001590987.
DR   EnsemblGenomes-Tr; EBT00001590988.
DR   EnsemblGenomes-Tr; EBT00001590989.
DR   EnsemblGenomes-Tr; EBT00001590990.
DR   EnsemblGenomes-Tr; EBT00001590991.
DR   EnsemblGenomes-Tr; EBT00001590992.
DR   EnsemblGenomes-Tr; EBT00001590993.
DR   EnsemblGenomes-Tr; EBT00001590994.
DR   EnsemblGenomes-Tr; EBT00001590995.
DR   EnsemblGenomes-Tr; EBT00001590996.
DR   EnsemblGenomes-Tr; EBT00001590997.
DR   EnsemblGenomes-Tr; EBT00001590998.
DR   EnsemblGenomes-Tr; EBT00001590999.
DR   EnsemblGenomes-Tr; EBT00001591000.
DR   EnsemblGenomes-Tr; EBT00001591001.
DR   EnsemblGenomes-Tr; EBT00001591002.
DR   EnsemblGenomes-Tr; EBT00001591003.
DR   EnsemblGenomes-Tr; EBT00001591004.
DR   EnsemblGenomes-Tr; EBT00001591005.
DR   EnsemblGenomes-Tr; EBT00001591006.
DR   EnsemblGenomes-Tr; EBT00001591007.
DR   EnsemblGenomes-Tr; EBT00001591008.
DR   EnsemblGenomes-Tr; EBT00001591009.
DR   EnsemblGenomes-Tr; EBT00001591010.
DR   EnsemblGenomes-Tr; EBT00001591011.
DR   EnsemblGenomes-Tr; EBT00001591012.
DR   EnsemblGenomes-Tr; EBT00001591013.
DR   EnsemblGenomes-Tr; EcE24377A_5003-1.
DR   EnsemblGenomes-Tr; EcE24377A_5004-1.
DR   EnsemblGenomes-Tr; EcE24377A_5005-1.
DR   EnsemblGenomes-Tr; EcE24377A_5006-1.
DR   EnsemblGenomes-Tr; EcE24377A_5007-1.
DR   EnsemblGenomes-Tr; EcE24377A_5008-1.
DR   EnsemblGenomes-Tr; EcE24377A_5009-1.
DR   EnsemblGenomes-Tr; EcE24377A_5010-1.
DR   EnsemblGenomes-Tr; EcE24377A_5011-1.
DR   EnsemblGenomes-Tr; EcE24377A_5012-1.
DR   EnsemblGenomes-Tr; EcE24377A_5013-1.
DR   EnsemblGenomes-Tr; EcE24377A_5014-1.
DR   EnsemblGenomes-Tr; EcE24377A_5015-1.
DR   EnsemblGenomes-Tr; EcE24377A_5016-1.
DR   EnsemblGenomes-Tr; EcE24377A_5017-1.
DR   EnsemblGenomes-Tr; EcE24377A_5018-1.
DR   EnsemblGenomes-Tr; EcE24377A_5019-1.
DR   EnsemblGenomes-Tr; EcE24377A_5020-1.
DR   EnsemblGenomes-Tr; EcE24377A_5021-1.
DR   EnsemblGenomes-Tr; EcE24377A_5022-1.
DR   EnsemblGenomes-Tr; EcE24377A_5023-1.
DR   EnsemblGenomes-Tr; EcE24377A_5024-1.
DR   EnsemblGenomes-Tr; EcE24377A_5025-1.
DR   EnsemblGenomes-Tr; EcE24377A_5026-1.
DR   EnsemblGenomes-Tr; EcE24377A_5027-1.
DR   EnsemblGenomes-Tr; EcE24377A_5028-1.
DR   EnsemblGenomes-Tr; EcE24377A_5029-1.
DR   EnsemblGenomes-Tr; EcE24377A_5030-1.
DR   EnsemblGenomes-Tr; EcE24377A_5031-1.
DR   EnsemblGenomes-Tr; EcE24377A_5032-1.
DR   EnsemblGenomes-Tr; EcE24377A_5033-1.
DR   EnsemblGenomes-Tr; EcE24377A_5034-1.
DR   EnsemblGenomes-Tr; EcE24377A_5035-1.
DR   EnsemblGenomes-Tr; EcE24377A_5036-1.
DR   EnsemblGenomes-Tr; EcE24377A_5037-1.
DR   EnsemblGenomes-Tr; EcE24377A_5038-1.
DR   EnsemblGenomes-Tr; EcE24377A_5039-1.
DR   EnsemblGenomes-Tr; EcE24377A_5040-1.
DR   EnsemblGenomes-Tr; EcE24377A_5041-1.
DR   EnsemblGenomes-Tr; EcE24377A_5042-1.
DR   EnsemblGenomes-Tr; EcE24377A_5043-1.
DR   EnsemblGenomes-Tr; EcE24377A_5044-1.
DR   EnsemblGenomes-Tr; EcE24377A_5045-1.
DR   EnsemblGenomes-Tr; EcE24377A_5046-1.
DR   EnsemblGenomes-Tr; EcE24377A_5047-1.
DR   EnsemblGenomes-Tr; EcE24377A_5048-1.
DR   EnsemblGenomes-Tr; EcE24377A_5049-1.
DR   EnsemblGenomes-Tr; EcE24377A_5050-1.
DR   EnsemblGenomes-Tr; EcE24377A_5051-1.
DR   EnsemblGenomes-Tr; EcE24377A_5052-1.
DR   EnsemblGenomes-Tr; EcE24377A_5053-1.
DR   EnsemblGenomes-Tr; EcE24377A_5054-1.
DR   EnsemblGenomes-Tr; EcE24377A_5055-1.
DR   EnsemblGenomes-Tr; EcE24377A_5056-1.
DR   EnsemblGenomes-Tr; EcE24377A_5058-1.
DR   EnsemblGenomes-Tr; EcE24377A_5059-1.
DR   EnsemblGenomes-Tr; EcE24377A_5060-1.
DR   EnsemblGenomes-Tr; EcE24377A_5061-1.
DR   EnsemblGenomes-Tr; EcE24377A_5062-1.
DR   EnsemblGenomes-Tr; EcE24377A_5063-1.
DR   EnsemblGenomes-Tr; EcE24377A_5064-1.
DR   EnsemblGenomes-Tr; EcE24377A_5065-1.
DR   EnsemblGenomes-Tr; EcE24377A_5066-1.
DR   EnsemblGenomes-Tr; EcE24377A_5067-1.
DR   EnsemblGenomes-Tr; EcE24377A_5068-1.
DR   EnsemblGenomes-Tr; EcE24377A_5069-1.
DR   EnsemblGenomes-Tr; EcE24377A_5070-1.
DR   EnsemblGenomes-Tr; EcE24377A_5071-1.
DR   EnsemblGenomes-Tr; EcE24377A_5072-1.
DR   EnsemblGenomes-Tr; EcE24377A_5073-1.
DR   EnsemblGenomes-Tr; EcE24377A_5074-1.
DR   EnsemblGenomes-Tr; EcE24377A_5075-1.
DR   EnsemblGenomes-Tr; EcE24377A_5076-1.
DR   EnsemblGenomes-Tr; EcE24377A_5077-1.
DR   EnsemblGenomes-Tr; EcE24377A_5078-1.
DR   EnsemblGenomes-Tr; EcE24377A_5079-1.
DR   EnsemblGenomes-Tr; EcE24377A_5080-1.
DR   EnsemblGenomes-Tr; EcE24377A_5081-1.
DR   EnsemblGenomes-Tr; EcE24377A_5082-1.
DR   EnsemblGenomes-Tr; EcE24377A_5083-1.
DR   EnsemblGenomes-Tr; EcE24377A_5084-1.
DR   EnsemblGenomes-Tr; EcE24377A_5085-1.
DR   EnsemblGenomes-Tr; EcE24377A_5086-1.
DR   EnsemblGenomes-Tr; EcE24377A_5087-1.
DR   EnsemblGenomes-Tr; EcE24377A_5088-1.
DR   EnsemblGenomes-Tr; EcE24377A_5089-1.
DR   EnsemblGenomes-Tr; EcE24377A_5090-1.
DR   EnsemblGenomes-Tr; EcE24377A_5091-1.
DR   EnsemblGenomes-Tr; EcE24377A_5092-1.
DR   EnsemblGenomes-Tr; EcE24377A_5093-1.
DR   EnsemblGenomes-Tr; EcE24377A_5094-1.
DR   EnsemblGenomes-Tr; EcE24377A_5095-1.
DR   EnsemblGenomes-Tr; EcE24377A_5096-1.
DR   EnsemblGenomes-Tr; EcE24377A_5097-1.
DR   EnsemblGenomes-Tr; EcE24377A_5098-1.
DR   EnsemblGenomes-Tr; EcE24377A_5099-1.
DR   EnsemblGenomes-Tr; EcE24377A_5100-1.
DR   EnsemblGenomes-Tr; EcE24377A_5101-1.
DR   EnsemblGenomes-Tr; EcE24377A_5102-1.
DR   EnsemblGenomes-Tr; EcE24377A_5103-1.
DR   EnsemblGenomes-Tr; EcE24377A_5104-1.
DR   EnsemblGenomes-Tr; EcE24377A_5105-1.
DR   EnsemblGenomes-Tr; EcE24377A_5106-1.
DR   EnsemblGenomes-Tr; EcE24377A_5107-1.
DR   EnsemblGenomes-Tr; EcE24377A_5108-1.
DR   EnsemblGenomes-Tr; EcE24377A_5109-1.
DR   EnsemblGenomes-Tr; EcE24377A_5110-1.
DR   EnsemblGenomes-Tr; EcE24377A_5111-1.
DR   EnsemblGenomes-Tr; EcE24377A_5112-1.
DR   EnsemblGenomes-Tr; EcE24377A_5113-1.
DR   EnsemblGenomes-Tr; EcE24377A_5114-1.
DR   EnsemblGenomes-Tr; EcE24377A_5115-1.
DR   EuropePMC; PMC2519331; 18539803.
DR   EuropePMC; PMC2566221; 18676672.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC2974192; 20623278.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3068680; 20378655.
DR   EuropePMC; PMC3209187; 21908635.
DR   EuropePMC; PMC3584874; 23275093.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3900561; 24466152.
DR   EuropePMC; PMC4001111; 24742173.
DR   EuropePMC; PMC4249051; 25128344.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4495197; 26002893.
DR   EuropePMC; PMC4959244; 27037122.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC5443543; 28542514.
DR   EuropePMC; PMC5784243; 29404412.
DR   EuropePMC; PMC6301781; 30571788.
DR   EuropePMC; PMC6331111; 30640938.
DR   EuropePMC; PMC6501397; 31060512.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00106; RNAI.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00117; C0719.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00372; sroH.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01401; rseX.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000800.
DR   SILVA-SSU; CP000800.
CC   Source DNA and bacteria available from Jacques Ravel
CC   (jravel@tigr.org).
FH   Key             Location/Qualifiers
FT   source          1..4979619
FT                   /organism="Escherichia coli O139:H28 str. E24377A"
FT                   /strain="E24377A"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:331111"
FT   gene            336..2798
FT                   /gene="thrA"
FT                   /locus_tag="EcE24377A_0001"
FT   CDS_pept        336..2798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="EcE24377A_0001"
FT                   /product="aspartokinase/homoserine dehydrogenase I"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00561; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   PF00742; match to protein family HMM PF01842; match to
FT                   protein family HMM PF03447; match to protein family HMM
FT                   TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20485"
FT                   /db_xref="GOA:A7ZH91"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH91"
FT                   /protein_id="ABV20485.1"
FT                   TLSWKLGV"
FT   gene            2800..3732
FT                   /gene="thrB"
FT                   /locus_tag="EcE24377A_0002"
FT   CDS_pept        2800..3732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="EcE24377A_0002"
FT                   /product="homoserine kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00547; match to
FT                   protein family HMM PF00288; match to protein family HMM
FT                   PF08544; match to protein family HMM TIGR00191"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19834"
FT                   /db_xref="GOA:A7ZH92"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZH92"
FT                   /protein_id="ABV19834.1"
FT   gene            3733..5019
FT                   /gene="thrC"
FT                   /locus_tag="EcE24377A_0003"
FT   CDS_pept        3733..5019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="EcE24377A_0003"
FT                   /product="threonine synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00934; match to
FT                   protein family HMM PF00291; match to protein family HMM
FT                   TIGR00260"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19189"
FT                   /db_xref="GOA:A7ZH93"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH93"
FT                   /protein_id="ABV19189.1"
FT   gene            complement(5309..5806)
FT                   /locus_tag="EcE24377A_0004"
FT   CDS_pept        complement(5309..5806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18296"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH94"
FT                   /protein_id="ABV18296.1"
FT                   LT"
FT   gene            5789..6769
FT                   /locus_tag="EcE24377A_0005"
FT   CDS_pept        5789..6769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0005"
FT                   /product="IS621, transposase"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17921"
FT                   /db_xref="GOA:A7ZH95"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH95"
FT                   /protein_id="ABV17921.1"
FT   gene            complement(6961..7737)
FT                   /locus_tag="EcE24377A_0006"
FT   CDS_pept        complement(6961..7737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8ZS17; match to
FT                   protein family HMM PF03883"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16967"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZH96"
FT                   /protein_id="ABV16967.1"
FT   gene            complement(7807..9237)
FT                   /gene="agcS"
FT                   /locus_tag="EcE24377A_0007"
FT   CDS_pept        complement(7807..9237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agcS"
FT                   /locus_tag="EcE24377A_0007"
FT                   /product="amino acid carrier protein"
FT                   /note="identified by match to protein family HMM PF01235;
FT                   match to protein family HMM TIGR00835"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16593"
FT                   /db_xref="GOA:A7ZH97"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH97"
FT                   /protein_id="ABV16593.1"
FT                   PDIGRQLSPDAWDDVSQE"
FT   gene            9516..10469
FT                   /gene="tal2"
FT                   /locus_tag="EcE24377A_0008"
FT   CDS_pept        9516..10469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal2"
FT                   /locus_tag="EcE24377A_0008"
FT                   /product="transaldolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00874"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20435"
FT                   /db_xref="GOA:A7ZH98"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH98"
FT                   /protein_id="ABV20435.1"
FT   gene            10584..11171
FT                   /gene="mog"
FT                   /locus_tag="EcE24377A_0009"
FT   CDS_pept        10584..11171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="EcE24377A_0009"
FT                   /product="molybdopterin biosynthesis protein Mog"
FT                   /note="identified by similarity to SP:P0AF03; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19776"
FT                   /db_xref="GOA:A7ZH99"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZH99"
FT                   /protein_id="ABV19776.1"
FT   gene            complement(11206..11772)
FT                   /locus_tag="EcE24377A_0010"
FT   CDS_pept        complement(11206..11772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0010"
FT                   /product="membrane protein, GPR1/FUN34/yaaH family"
FT                   /note="identified by match to protein family HMM PF01184"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19244"
FT                   /db_xref="GOA:A7ZHA0"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHA0"
FT                   /protein_id="ABV19244.1"
FT   gene            complement(11921..12634)
FT                   /locus_tag="EcE24377A_0011"
FT   CDS_pept        complement(11921..12634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03667"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18591"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHA1"
FT                   /protein_id="ABV18591.1"
FT                   LQIACLRRMVSATQV"
FT   gene            complement(12660..13064)
FT                   /locus_tag="EcE24377A_0012"
FT   CDS_pept        complement(12660..13064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19681"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHA2"
FT                   /protein_id="ABV19681.1"
FT   gene            complement(13199..13348)
FT                   /locus_tag="EcE24377A_0013"
FT   CDS_pept        complement(13199..13348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19021"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHA3"
FT                   /protein_id="ABV19021.1"
FT                   ILFI"
FT   gene            13441..15357
FT                   /gene="dnaK"
FT                   /locus_tag="EcE24377A_0014"
FT   CDS_pept        13441..15357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="EcE24377A_0014"
FT                   /product="chaperone protein DnaK"
FT                   /note="identified by match to protein family HMM PF00012;
FT                   match to protein family HMM TIGR02350"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20836"
FT                   /db_xref="GOA:A7ZHA4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHA4"
FT                   /protein_id="ABV20836.1"
FT                   DKK"
FT   gene            15446..16576
FT                   /gene="dnaJ"
FT                   /locus_tag="EcE24377A_0015"
FT   CDS_pept        15446..16576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="EcE24377A_0015"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF00684; match to protein
FT                   family HMM PF01556; match to protein family HMM TIGR02349"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18170"
FT                   /db_xref="GOA:A7ZHA5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHA5"
FT                   /protein_id="ABV18170.1"
FT   gene            17418..18584
FT                   /gene="nhaA"
FT                   /locus_tag="EcE24377A_0016"
FT   CDS_pept        17418..18584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="EcE24377A_0016"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by match to protein family HMM PF06965;
FT                   match to protein family HMM TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17136"
FT                   /db_xref="GOA:A7ZHA6"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHA6"
FT                   /protein_id="ABV17136.1"
FT   gene            18650..19549
FT                   /gene="nhaR"
FT                   /locus_tag="EcE24377A_0017"
FT   CDS_pept        18650..19549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="EcE24377A_0017"
FT                   /product="transcriptional activator protein NhaR"
FT                   /note="identified by similarity to SP:P0A9G2; match to
FT                   protein family HMM PF00126"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19756"
FT                   /db_xref="GOA:A7ZHA7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHA7"
FT                   /protein_id="ABV19756.1"
FT                   VQRICNTDYSALFSPAAR"
FT   gene            complement(19588..20547)
FT                   /locus_tag="EcE24377A_0018"
FT   CDS_pept        complement(19588..20547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ86820.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19246"
FT                   /db_xref="GOA:A7ZHA8"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHA8"
FT                   /protein_id="ABV19246.1"
FT   gene            complement(20560..21567)
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0019"
FT                   /note="fimbrial usher protein, authentic point mutation;
FT                   this gene contains a premature stop which is not the result
FT                   of sequencing error; identified by match to protein family
FT                   HMM PF00577"
FT   gene            complement(22138..23460)
FT                   /locus_tag="EcE24377A_0020"
FT   CDS_pept        complement(22138..23460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0020"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20829"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHA9"
FT                   /protein_id="ABV20829.1"
FT   gene            23481..23585
FT                   /locus_tag="EcE24377A_0021"
FT   CDS_pept        23481..23585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0021"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19233"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHB0"
FT                   /protein_id="ABV19233.1"
FT   gene            complement(23844..24008)
FT                   /locus_tag="EcE24377A_0022"
FT   CDS_pept        complement(23844..24008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0022"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19785"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHB1"
FT                   /protein_id="ABV19785.1"
FT                   WLKNRRTIG"
FT   gene            complement(24030..24293)
FT                   /gene="rpsT"
FT                   /locus_tag="EcE24377A_0023"
FT   CDS_pept        complement(24030..24293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="EcE24377A_0023"
FT                   /product="ribosomal protein S20"
FT                   /note="identified by match to protein family HMM PF01649;
FT                   match to protein family HMM TIGR00029"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18228"
FT                   /db_xref="GOA:A7ZHB2"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHB2"
FT                   /protein_id="ABV18228.1"
FT   gene            24396..24614
FT                   /locus_tag="EcE24377A_0024"
FT   CDS_pept        24396..24614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ86826.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17762"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHB3"
FT                   /protein_id="ABV17762.1"
FT   gene            24622..25563
FT                   /gene="ribF"
FT                   /locus_tag="EcE24377A_0025"
FT   CDS_pept        24622..25563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="EcE24377A_0025"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574; match to protein
FT                   family HMM TIGR00083"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18266"
FT                   /db_xref="GOA:A7ZHB4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHB4"
FT                   /protein_id="ABV18266.1"
FT   gene            25606..28422
FT                   /gene="ileS"
FT                   /locus_tag="EcE24377A_0026"
FT   CDS_pept        25606..28422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="EcE24377A_0026"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF06827; match to protein
FT                   family HMM PF08264; match to protein family HMM PF09334;
FT                   match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16737"
FT                   /db_xref="GOA:A7ZHB5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHB5"
FT                   /protein_id="ABV16737.1"
FT                   DGEKRKFA"
FT   gene            28422..28916
FT                   /gene="lspA"
FT                   /locus_tag="EcE24377A_0027"
FT   CDS_pept        28422..28916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="EcE24377A_0027"
FT                   /product="signal peptidase II"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01252;
FT                   match to protein family HMM TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17261"
FT                   /db_xref="GOA:A7ZHB6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHB6"
FT                   /protein_id="ABV17261.1"
FT                   Q"
FT   gene            29021..29470
FT                   /gene="fkpB"
FT                   /locus_tag="EcE24377A_0028"
FT   CDS_pept        29021..29470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="EcE24377A_0028"
FT                   /product="FKBP-type 16 kDa peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00254"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20437"
FT                   /db_xref="GOA:A7ZHB7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHB7"
FT                   /protein_id="ABV20437.1"
FT   gene            29472..30422
FT                   /gene="ispH"
FT                   /locus_tag="EcE24377A_0029"
FT   CDS_pept        29472..30422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="EcE24377A_0029"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P62623; match to
FT                   protein family HMM PF02401; match to protein family HMM
FT                   TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17375"
FT                   /db_xref="GOA:A7ZHB8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHB8"
FT                   /protein_id="ABV17375.1"
FT   gene            30488..31402
FT                   /gene="rihC"
FT                   /locus_tag="EcE24377A_0030"
FT   CDS_pept        30488..31402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="EcE24377A_0030"
FT                   /product="nonspecific ribonucleoside hydrolase RihC"
FT                   /EC_number="3.2.-.-"
FT                   /note="identified by similarity to SP:P0C0W2; match to
FT                   protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18200"
FT                   /db_xref="GOA:A7ZHB9"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR022976"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHB9"
FT                   /protein_id="ABV18200.1"
FT   gene            31569..32390
FT                   /gene="dapB"
FT                   /locus_tag="EcE24377A_0031"
FT   CDS_pept        31569..32390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="EcE24377A_0031"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P04036; match to
FT                   protein family HMM PF01113; match to protein family HMM
FT                   PF05173; match to protein family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18714"
FT                   /db_xref="GOA:A7ZHC0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHC0"
FT                   /protein_id="ABV18714.1"
FT   gene            complement(32633..32728)
FT                   /locus_tag="EcE24377A_0032"
FT   CDS_pept        complement(32633..32728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0032"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19660"
FT                   /db_xref="GOA:A7ZHC1"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHC1"
FT                   /protein_id="ABV19660.1"
FT                   /translation="MGAKSQLNGGIFYIILWLMHVLQSLSDKKII"
FT   gene            32846..33994
FT                   /gene="carA"
FT                   /locus_tag="EcE24377A_0033"
FT   CDS_pept        32846..33994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="EcE24377A_0033"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0A6F1; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF00988; match to protein family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20022"
FT                   /db_xref="GOA:A7ZHC2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHC2"
FT                   /protein_id="ABV20022.1"
FT   gene            34012..37233
FT                   /gene="carB"
FT                   /locus_tag="EcE24377A_0034"
FT   CDS_pept        34012..37233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="EcE24377A_0034"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00968; match to
FT                   protein family HMM PF00289; match to protein family HMM
FT                   PF02142; match to protein family HMM PF02786; match to
FT                   protein family HMM PF02787; match to protein family HMM
FT                   TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20750"
FT                   /db_xref="GOA:A7ZHC3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHC3"
FT                   /protein_id="ABV20750.1"
FT   gene            complement(37241..37459)
FT                   /locus_tag="EcE24377A_0035"
FT   CDS_pept        complement(37241..37459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0035"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16954"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHC4"
FT                   /protein_id="ABV16954.1"
FT   gene            37494..37889
FT                   /gene="caiF"
FT                   /locus_tag="EcE24377A_0036"
FT   CDS_pept        37494..37889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="EcE24377A_0036"
FT                   /product="transcriptional activatory protein CaiF"
FT                   /note="identified by similarity to SP:P0AE58"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17633"
FT                   /db_xref="GOA:A7ZHC5"
FT                   /db_xref="InterPro:IPR020357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHC5"
FT                   /protein_id="ABV17633.1"
FT   gene            complement(37975..38565)
FT                   /gene="caiE"
FT                   /locus_tag="EcE24377A_0037"
FT   CDS_pept        complement(37975..38565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="EcE24377A_0037"
FT                   /product="carnitine operon protein caiE"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18044"
FT                   /db_xref="GOA:A7ZHC6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023446"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHC6"
FT                   /protein_id="ABV18044.1"
FT   gene            complement(38571..39464)
FT                   /gene="caiD"
FT                   /locus_tag="EcE24377A_0038"
FT   CDS_pept        complement(38571..39464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="EcE24377A_0038"
FT                   /product="carnitinyl-CoA dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19036"
FT                   /db_xref="GOA:A7ZHC7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR022852"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHC7"
FT                   /protein_id="ABV19036.1"
FT                   GPLAFAEKRDPVWKGR"
FT   gene            complement(39465..41033)
FT                   /locus_tag="EcE24377A_0039"
FT   CDS_pept        complement(39465..41033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0039"
FT                   /product="putative crotonobetaine/carnitine-CoA ligase"
FT                   /note="identified by match to protein family HMM PF00501"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16905"
FT                   /db_xref="GOA:A7ZHC8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023456"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHC8"
FT                   /protein_id="ABV16905.1"
FT                   RKNLK"
FT   gene            complement(41092..42309)
FT                   /gene="caiB"
FT                   /locus_tag="EcE24377A_0040"
FT   CDS_pept        complement(41092..42309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="EcE24377A_0040"
FT                   /product="crotonobetainyl-CoA:carnitine CoA-transferase"
FT                   /EC_number="2.8.3.-"
FT                   /note="identified by similarity to SP:P31572; match to
FT                   protein family HMM PF02515"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18658"
FT                   /db_xref="GOA:A7ZHC9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023452"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHC9"
FT                   /protein_id="ABV18658.1"
FT                   LAKVED"
FT   gene            complement(42438..43580)
FT                   /gene="caiA"
FT                   /locus_tag="EcE24377A_0041"
FT   CDS_pept        complement(42438..43580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="EcE24377A_0041"
FT                   /product="crotonobetainyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by similarity to SP:P60587; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF02770; match to protein family HMM PF02771; match to
FT                   protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17974"
FT                   /db_xref="GOA:A7ZHD0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023450"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHD0"
FT                   /protein_id="ABV17974.1"
FT   gene            complement(43611..45125)
FT                   /gene="caiT"
FT                   /locus_tag="EcE24377A_0042"
FT   CDS_pept        complement(43611..45125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="EcE24377A_0042"
FT                   /product="L-carnitine/gamma-butyrobetaine antiporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19566"
FT                   /db_xref="GOA:A7ZHD1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="InterPro:IPR023449"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHD1"
FT                   /protein_id="ABV19566.1"
FT   gene            45140..45241
FT                   /locus_tag="EcE24377A_0043"
FT   CDS_pept        45140..45241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0043"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21009"
FT                   /db_xref="GOA:A7ZHD2"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHD2"
FT                   /protein_id="ABV21009.1"
FT   gene            45420..45530
FT                   /locus_tag="EcE24377A_0044"
FT   CDS_pept        45420..45530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAX63975.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20758"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHD3"
FT                   /protein_id="ABV20758.1"
FT   gene            45599..46369
FT                   /gene="etfB"
FT                   /locus_tag="EcE24377A_0045"
FT   CDS_pept        45599..46369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB"
FT                   /locus_tag="EcE24377A_0045"
FT                   /product="electron transfer flavoprotein domain protein"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20271"
FT                   /db_xref="GOA:A7ZHD4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHD4"
FT                   /protein_id="ABV20271.1"
FT   gene            46384..47325
FT                   /gene="fixB"
FT                   /locus_tag="EcE24377A_0046"
FT   CDS_pept        46384..47325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="EcE24377A_0046"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16982"
FT                   /db_xref="GOA:A7ZHD5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR023461"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHD5"
FT                   /protein_id="ABV16982.1"
FT   gene            47376..48662
FT                   /gene="fixC"
FT                   /locus_tag="EcE24377A_0047"
FT   CDS_pept        47376..48662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="EcE24377A_0047"
FT                   /product="protein FixC"
FT                   /note="identified by similarity to SP:P68644; match to
FT                   protein family HMM PF01134; match to protein family HMM
FT                   PF01266; match to protein family HMM PF01494; match to
FT                   protein family HMM PF03486"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18405"
FT                   /db_xref="GOA:A7ZHD6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHD6"
FT                   /protein_id="ABV18405.1"
FT   gene            48659..48946
FT                   /gene="fixX"
FT                   /locus_tag="EcE24377A_0048"
FT   CDS_pept        48659..48946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="EcE24377A_0048"
FT                   /product="ferredoxin homolog FixX"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18067"
FT                   /db_xref="GOA:A7ZHD7"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHD7"
FT                   /protein_id="ABV18067.1"
FT   gene            49004..50335
FT                   /locus_tag="EcE24377A_0049"
FT   CDS_pept        49004..50335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0049"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16711"
FT                   /db_xref="GOA:A7ZHD8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHD8"
FT                   /protein_id="ABV16711.1"
FT   gene            50443..50973
FT                   /gene="kefF"
FT                   /locus_tag="EcE24377A_0050"
FT   CDS_pept        50443..50973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="EcE24377A_0050"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   ancillary protein kefF"
FT                   /note="identified by match to protein family HMM PF02525"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16747"
FT                   /db_xref="GOA:A7ZHD9"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023948"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHD9"
FT                   /protein_id="ABV16747.1"
FT                   KQRLLEWQEAHHG"
FT   gene            50966..52828
FT                   /gene="kefC"
FT                   /locus_tag="EcE24377A_0051"
FT   CDS_pept        50966..52828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="EcE24377A_0051"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein KefC"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21001"
FT                   /db_xref="GOA:A7ZHE0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR023941"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHE0"
FT                   /protein_id="ABV21001.1"
FT   gene            53020..53499
FT                   /gene="folA"
FT                   /locus_tag="EcE24377A_0052"
FT   CDS_pept        53020..53499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="EcE24377A_0052"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0ABQ4; match to
FT                   protein family HMM PF00186"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20494"
FT                   /db_xref="GOA:A7ZHE1"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHE1"
FT                   /protein_id="ABV20494.1"
FT   gene            complement(53577..54419)
FT                   /gene="apaH"
FT                   /locus_tag="EcE24377A_0053"
FT   CDS_pept        complement(53577..54419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="EcE24377A_0053"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00668"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19966"
FT                   /db_xref="GOA:A7ZHE2"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHE2"
FT                   /protein_id="ABV19966.1"
FT   gene            complement(54426..54803)
FT                   /gene="apaG"
FT                   /locus_tag="EcE24377A_0054"
FT   CDS_pept        complement(54426..54803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="EcE24377A_0054"
FT                   /product="protein ApaG"
FT                   /note="identified by similarity to SP:P62675; match to
FT                   protein family HMM PF04379"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19136"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHE3"
FT                   /protein_id="ABV19136.1"
FT   gene            complement(54806..55627)
FT                   /gene="ksgA"
FT                   /locus_tag="EcE24377A_0055"
FT   CDS_pept        complement(54806..55627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="EcE24377A_0055"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18336"
FT                   /db_xref="GOA:A7ZHE4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHE4"
FT                   /protein_id="ABV18336.1"
FT   gene            complement(55624..56613)
FT                   /gene="pdxA"
FT                   /locus_tag="EcE24377A_0056"
FT   CDS_pept        complement(55624..56613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="EcE24377A_0056"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P19624; match to
FT                   protein family HMM PF04166; match to protein family HMM
FT                   TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18686"
FT                   /db_xref="GOA:A7ZHE5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHE5"
FT                   /protein_id="ABV18686.1"
FT   gene            complement(56613..57899)
FT                   /gene="surA"
FT                   /locus_tag="EcE24377A_0057"
FT   CDS_pept        complement(56613..57899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="EcE24377A_0057"
FT                   /product="chaperone/peptidyl-prolyl cis-trans isomerase
FT                   SurA"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q3Z5V6; match to
FT                   protein family HMM PF00639; match to protein family HMM
FT                   PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17268"
FT                   /db_xref="GOA:A7ZHE6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHE6"
FT                   /protein_id="ABV17268.1"
FT   gene            complement(57952..60306)
FT                   /gene="imp"
FT                   /locus_tag="EcE24377A_0058"
FT   CDS_pept        complement(57952..60306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="EcE24377A_0058"
FT                   /product="LPS-assembly protein"
FT                   /note="identified by similarity to SP:P31554; match to
FT                   protein family HMM PF03968; match to protein family HMM
FT                   PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17531"
FT                   /db_xref="GOA:A7ZHE7"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHE7"
FT                   /protein_id="ABV17531.1"
FT   gene            60561..61376
FT                   /gene="djlA"
FT                   /locus_tag="EcE24377A_0059"
FT   CDS_pept        60561..61376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="EcE24377A_0059"
FT                   /product="protein DjlA, DnaJ family"
FT                   /note="identified by similarity to SP:P31680; match to
FT                   protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20418"
FT                   /db_xref="GOA:A7ZHE8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHE8"
FT                   /protein_id="ABV20418.1"
FT   gene            complement(61493..62152)
FT                   /locus_tag="EcE24377A_0060"
FT   CDS_pept        complement(61493..62152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0060"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21199"
FT                   /db_xref="GOA:A7ZHE9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHE9"
FT                   /protein_id="ABV21199.1"
FT   gene            complement(62164..65070)
FT                   /gene="rapA"
FT                   /locus_tag="EcE24377A_0061"
FT   CDS_pept        complement(62164..65070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="EcE24377A_0061"
FT                   /product="RNA polymerase associated protein RapA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P60240; match to
FT                   protein family HMM PF00176; match to protein family HMM
FT                   PF00271; match to protein family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19351"
FT                   /db_xref="GOA:A7ZHF0"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHF0"
FT                   /protein_id="ABV19351.1"
FT   gene            complement(65235..67586)
FT                   /gene="polB"
FT                   /locus_tag="EcE24377A_0062"
FT   CDS_pept        complement(65235..67586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="EcE24377A_0062"
FT                   /product="DNA polymerase II"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P21189; match to
FT                   protein family HMM PF00136; match to protein family HMM
FT                   PF03104"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17846"
FT                   /db_xref="GOA:A7ZHF1"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF1"
FT                   /protein_id="ABV17846.1"
FT   gene            complement(67661..68356)
FT                   /gene="araD"
FT                   /locus_tag="EcE24377A_0063"
FT   CDS_pept        complement(67661..68356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="EcE24377A_0063"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P08203; match to
FT                   protein family HMM PF00596; match to protein family HMM
FT                   TIGR00760"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16460"
FT                   /db_xref="GOA:A7ZHF2"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR033748"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF2"
FT                   /protein_id="ABV16460.1"
FT                   HGAKAYYGQ"
FT   gene            complement(68525..70027)
FT                   /gene="araA"
FT                   /locus_tag="EcE24377A_0064"
FT   CDS_pept        complement(68525..70027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="EcE24377A_0064"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02610"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17108"
FT                   /db_xref="GOA:A7ZHF3"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHF3"
FT                   /protein_id="ABV17108.1"
FT   gene            complement(70038..71738)
FT                   /gene="araB"
FT                   /locus_tag="EcE24377A_0065"
FT   CDS_pept        complement(70038..71738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="EcE24377A_0065"
FT                   /product="L-ribulokinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P08204; match to
FT                   protein family HMM PF00370; match to protein family HMM
FT                   PF02782; match to protein family HMM TIGR01234"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20149"
FT                   /db_xref="GOA:A7ZHF4"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHF4"
FT                   /protein_id="ABV20149.1"
FT   gene            72077..72955
FT                   /gene="araC"
FT                   /locus_tag="EcE24377A_0066"
FT   CDS_pept        72077..72955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="EcE24377A_0066"
FT                   /product="arabinose operon regulatory protein"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21179"
FT                   /db_xref="GOA:A7ZHF5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF5"
FT                   /protein_id="ABV21179.1"
FT                   EKVNDVAVKLS"
FT   gene            73041..73805
FT                   /locus_tag="EcE24377A_0067"
FT   CDS_pept        73041..73805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0067"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P30149; match to
FT                   protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21148"
FT                   /db_xref="GOA:A7ZHF6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF6"
FT                   /protein_id="ABV21148.1"
FT   gene            complement(73919..74617)
FT                   /gene="thiQ"
FT                   /locus_tag="EcE24377A_0068"
FT   CDS_pept        complement(73919..74617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="EcE24377A_0068"
FT                   /product="thiamine ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01277"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19174"
FT                   /db_xref="GOA:A7ZHF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF7"
FT                   /protein_id="ABV19174.1"
FT                   SASALLGITG"
FT   gene            complement(74601..76211)
FT                   /gene="thiP"
FT                   /locus_tag="EcE24377A_0069"
FT   CDS_pept        complement(74601..76211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="EcE24377A_0069"
FT                   /product="thiamine/thiamine pyrophosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01253"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19228"
FT                   /db_xref="GOA:A7ZHF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF8"
FT                   /protein_id="ABV19228.1"
FT   gene            complement(76187..77170)
FT                   /gene="thiB"
FT                   /locus_tag="EcE24377A_0070"
FT   CDS_pept        complement(76187..77170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="EcE24377A_0070"
FT                   /product="thiamin/thiamin pyrophosphate ABC transporter,
FT                   periplasmic thiamin/thiamin pyrophospate-binding protein"
FT                   /note="identified by match to protein family HMM TIGR01254;
FT                   match to protein family HMM TIGR01276"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20789"
FT                   /db_xref="GOA:A7ZHF9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHF9"
FT                   /protein_id="ABV20789.1"
FT   gene            complement(77214..77333)
FT                   /locus_tag="EcE24377A_0071"
FT   CDS_pept        complement(77214..77333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0071"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20598"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG0"
FT                   /protein_id="ABV20598.1"
FT   gene            complement(77334..78989)
FT                   /gene="sgrR"
FT                   /locus_tag="EcE24377A_0072"
FT   CDS_pept        complement(77334..78989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="EcE24377A_0072"
FT                   /product="sugar transport-related sRNA regulator SgrR"
FT                   /note="identified by similarity to SP:P33595; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17364"
FT                   /db_xref="GOA:A7ZHG1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023767"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG1"
FT                   /protein_id="ABV17364.1"
FT   gene            79311..80489
FT                   /gene="setA"
FT                   /locus_tag="EcE24377A_0073"
FT   CDS_pept        79311..80489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="setA"
FT                   /locus_tag="EcE24377A_0073"
FT                   /product="sugar efflux transporter subfamily"
FT                   /note="identified by similarity to SP:P31675; match to
FT                   protein family HMM PF07690; match to protein family HMM
FT                   TIGR00899"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18002"
FT                   /db_xref="GOA:A7ZHG2"
FT                   /db_xref="InterPro:IPR004750"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG2"
FT                   /protein_id="ABV18002.1"
FT   gene            complement(80538..81143)
FT                   /gene="leuD"
FT                   /locus_tag="EcE24377A_0074"
FT   CDS_pept        complement(80538..81143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="EcE24377A_0074"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P30126; match to
FT                   protein family HMM PF00694; match to protein family HMM
FT                   TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19973"
FT                   /db_xref="GOA:A7ZHG3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHG3"
FT                   /protein_id="ABV19973.1"
FT   gene            complement(81154..82554)
FT                   /gene="leuC"
FT                   /locus_tag="EcE24377A_0075"
FT   CDS_pept        complement(81154..82554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="EcE24377A_0075"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM TIGR00170"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19321"
FT                   /db_xref="GOA:A7ZHG4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHG4"
FT                   /protein_id="ABV19321.1"
FT                   FADIRNIK"
FT   gene            complement(82557..83648)
FT                   /gene="leuB"
FT                   /locus_tag="EcE24377A_0076"
FT   CDS_pept        complement(82557..83648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="EcE24377A_0076"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P30125; match to
FT                   protein family HMM PF00180; match to protein family HMM
FT                   TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18933"
FT                   /db_xref="GOA:A7ZHG5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG5"
FT                   /protein_id="ABV18933.1"
FT   gene            complement(83648..85219)
FT                   /gene="leuA"
FT                   /locus_tag="EcE24377A_0077"
FT   CDS_pept        complement(83648..85219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="EcE24377A_0077"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF08502; match to protein
FT                   family HMM TIGR00973"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20892"
FT                   /db_xref="GOA:A7ZHG6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHG6"
FT                   /protein_id="ABV20892.1"
FT                   NNKETV"
FT   gene            86058..87002
FT                   /gene="leuO"
FT                   /locus_tag="EcE24377A_0078"
FT   CDS_pept        86058..87002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="EcE24377A_0078"
FT                   /product="transcriptional regulator LeuO"
FT                   /note="identified by similarity to SP:P10151; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20094"
FT                   /db_xref="GOA:A7ZHG7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG7"
FT                   /protein_id="ABV20094.1"
FT   gene            87320..89044
FT                   /gene="ilvI"
FT                   /locus_tag="EcE24377A_0079"
FT   CDS_pept        87320..89044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="EcE24377A_0079"
FT                   /product="acetolactate synthase, large subunit, isozyme
FT                   III"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00893; match to
FT                   protein family HMM PF00205; match to protein family HMM
FT                   PF02775; match to protein family HMM PF02776; match to
FT                   protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19613"
FT                   /db_xref="GOA:A7ZHG8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG8"
FT                   /protein_id="ABV19613.1"
FT   gene            89047..89538
FT                   /gene="ilvH"
FT                   /locus_tag="EcE24377A_0080"
FT   CDS_pept        89047..89538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="EcE24377A_0080"
FT                   /product="acetolactate synthase, small subunit, isozyme
FT                   III"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00894; match to
FT                   protein family HMM PF01842; match to protein family HMM
FT                   TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19115"
FT                   /db_xref="GOA:A7ZHG9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHG9"
FT                   /protein_id="ABV19115.1"
FT                   "
FT   gene            89590..89721
FT                   /locus_tag="EcE24377A_0081"
FT   CDS_pept        89590..89721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0081"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20669"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH0"
FT                   /protein_id="ABV20669.1"
FT   gene            89718..90722
FT                   /gene="fruR"
FT                   /locus_tag="EcE24377A_0082"
FT   CDS_pept        89718..90722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="EcE24377A_0082"
FT                   /product="fructose repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532; match to protein
FT                   family HMM TIGR02417"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17180"
FT                   /db_xref="GOA:A7ZHH1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH1"
FT                   /protein_id="ABV17180.1"
FT   gene            91324..91782
FT                   /gene="mraZ"
FT                   /locus_tag="EcE24377A_0083"
FT   CDS_pept        91324..91782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="EcE24377A_0083"
FT                   /product="MraZ protein"
FT                   /note="identified by similarity to GB:AAN78597.1; match to
FT                   protein family HMM PF02381; match to protein family HMM
FT                   TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17164"
FT                   /db_xref="GOA:A7ZHH2"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHH2"
FT                   /protein_id="ABV17164.1"
FT   gene            91784..92725
FT                   /gene="mraW"
FT                   /locus_tag="EcE24377A_0084"
FT   CDS_pept        91784..92725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="EcE24377A_0084"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16513"
FT                   /db_xref="GOA:A7ZHH3"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHH3"
FT                   /protein_id="ABV16513.1"
FT   gene            92722..93087
FT                   /gene="ftsL"
FT                   /locus_tag="EcE24377A_0085"
FT   CDS_pept        92722..93087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="EcE24377A_0085"
FT                   /product="cell division protein FtsL"
FT                   /note="identified by similarity to SP:P22187; match to
FT                   protein family HMM PF04999; match to protein family HMM
FT                   TIGR02209"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18551"
FT                   /db_xref="GOA:A7ZHH4"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH4"
FT                   /protein_id="ABV18551.1"
FT                   LQMQHVDPSQENIVVQK"
FT   gene            93103..94869
FT                   /gene="ftsI"
FT                   /locus_tag="EcE24377A_0086"
FT   CDS_pept        93103..94869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="EcE24377A_0086"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0AD68; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19825"
FT                   /db_xref="GOA:A7ZHH5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH5"
FT                   /protein_id="ABV19825.1"
FT                   VINQGEGTGGRS"
FT   gene            94856..96343
FT                   /gene="murE"
FT                   /locus_tag="EcE24377A_0087"
FT   CDS_pept        94856..96343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="EcE24377A_0087"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P22188; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM PF08245; match to
FT                   protein family HMM TIGR01085"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21155"
FT                   /db_xref="GOA:A7ZHH6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH6"
FT                   /protein_id="ABV21155.1"
FT   gene            96340..97698
FT                   /gene="murF"
FT                   /locus_tag="EcE24377A_0088"
FT   CDS_pept        96340..97698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="EcE24377A_0088"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P11880; match to
FT                   protein family HMM PF01225; match to protein family HMM
FT                   PF02875; match to protein family HMM PF08245; match to
FT                   protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20534"
FT                   /db_xref="GOA:A7ZHH7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH7"
FT                   /protein_id="ABV20534.1"
FT   gene            97692..98774
FT                   /gene="mraY"
FT                   /locus_tag="EcE24377A_0089"
FT   CDS_pept        97692..98774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="EcE24377A_0089"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19795"
FT                   /db_xref="GOA:A7ZHH8"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHH8"
FT                   /protein_id="ABV19795.1"
FT   gene            98777..100093
FT                   /gene="murD"
FT                   /locus_tag="EcE24377A_0090"
FT   CDS_pept        98777..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="EcE24377A_0090"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P14900; match to
FT                   protein family HMM PF02875; match to protein family HMM
FT                   PF08245; match to protein family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17824"
FT                   /db_xref="GOA:A7ZHH9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHH9"
FT                   /protein_id="ABV17824.1"
FT   gene            100093..101337
FT                   /gene="ftsW"
FT                   /locus_tag="EcE24377A_0091"
FT   CDS_pept        100093..101337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="EcE24377A_0091"
FT                   /product="cell division protein FtsW"
FT                   /note="identified by similarity to SP:P0ABG4; match to
FT                   protein family HMM PF01098; match to protein family HMM
FT                   TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18314"
FT                   /db_xref="GOA:A7ZHI0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHI0"
FT                   /protein_id="ABV18314.1"
FT                   ETRLEKAQAFVRGSR"
FT   gene            101334..102401
FT                   /gene="murG"
FT                   /locus_tag="EcE24377A_0092"
FT   CDS_pept        101334..102401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="EcE24377A_0092"
FT                   /product="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03033;
FT                   match to protein family HMM PF04101; match to protein
FT                   family HMM TIGR01133"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16706"
FT                   /db_xref="GOA:A7ZHI1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHI1"
FT                   /protein_id="ABV16706.1"
FT                   ATERVANEVSRAARA"
FT   gene            102455..103930
FT                   /gene="murC"
FT                   /locus_tag="EcE24377A_0093"
FT   CDS_pept        102455..103930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="EcE24377A_0093"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16600"
FT                   /db_xref="GOA:A7ZHI2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHI2"
FT                   /protein_id="ABV16600.1"
FT   gene            103923..104843
FT                   /gene="ddlB"
FT                   /locus_tag="EcE24377A_0094"
FT   CDS_pept        103923..104843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="EcE24377A_0094"
FT                   /product="D-alanine--D-alanine ligase B"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P07862; match to
FT                   protein family HMM PF01820; match to protein family HMM
FT                   PF07478; match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17302"
FT                   /db_xref="GOA:A7ZHI3"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHI3"
FT                   /protein_id="ABV17302.1"
FT   gene            104845..105675
FT                   /gene="ftsQ"
FT                   /locus_tag="EcE24377A_0095"
FT   CDS_pept        104845..105675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="EcE24377A_0095"
FT                   /product="cell division protein FtsQ"
FT                   /note="identified by similarity to SP:P06136; match to
FT                   protein family HMM PF03799; match to protein family HMM
FT                   PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21193"
FT                   /db_xref="GOA:A7ZHI4"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHI4"
FT                   /protein_id="ABV21193.1"
FT   gene            105672..106934
FT                   /gene="ftsA"
FT                   /locus_tag="EcE24377A_0096"
FT   CDS_pept        105672..106934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="EcE24377A_0096"
FT                   /product="cell division protein FtsA"
FT                   /note="identified by similarity to SP:P0ABH0; match to
FT                   protein family HMM PF02491; match to protein family HMM
FT                   TIGR01174"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19368"
FT                   /db_xref="GOA:A7ZHI5"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHI5"
FT                   /protein_id="ABV19368.1"
FT   gene            106995..108146
FT                   /gene="ftsZ"
FT                   /locus_tag="EcE24377A_0097"
FT   CDS_pept        106995..108146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="EcE24377A_0097"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by similarity to SP:P0A9A6; match to
FT                   protein family HMM PF00091; match to protein family HMM
FT                   PF03953; match to protein family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17965"
FT                   /db_xref="GOA:A7ZHI6"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHI6"
FT                   /protein_id="ABV17965.1"
FT   gene            108247..109164
FT                   /gene="lpxC"
FT                   /locus_tag="EcE24377A_0098"
FT   CDS_pept        108247..109164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="EcE24377A_0098"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by similarity to SP:P0A725; match to
FT                   protein family HMM PF03331; match to protein family HMM
FT                   TIGR00325"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18424"
FT                   /db_xref="GOA:A7ZHI7"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHI7"
FT                   /protein_id="ABV18424.1"
FT   gene            109320..109907
FT                   /gene="secM"
FT                   /locus_tag="EcE24377A_0099"
FT   CDS_pept        109320..109907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="EcE24377A_0099"
FT                   /product="secretion monitor protein"
FT                   /note="identified by match to protein family HMM PF06558"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16946"
FT                   /db_xref="GOA:A7ZHI8"
FT                   /db_xref="InterPro:IPR009502"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHI8"
FT                   /protein_id="ABV16946.1"
FT   gene            109969..112674
FT                   /gene="secA"
FT                   /locus_tag="EcE24377A_0100"
FT   CDS_pept        109969..112674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="EcE24377A_0100"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF01043;
FT                   match to protein family HMM PF02810; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18541"
FT                   /db_xref="GOA:A7ZHI9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHI9"
FT                   /protein_id="ABV18541.1"
FT   gene            112734..113123
FT                   /gene="mutT"
FT                   /locus_tag="EcE24377A_0101"
FT   CDS_pept        112734..113123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="EcE24377A_0101"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18006"
FT                   /db_xref="GOA:A7ZHJ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ0"
FT                   /protein_id="ABV18006.1"
FT   gene            complement(113138..113251)
FT                   /locus_tag="EcE24377A_0102"
FT   CDS_pept        complement(113138..113251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ86903.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17622"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ1"
FT                   /protein_id="ABV17622.1"
FT   gene            complement(113223..113420)
FT                   /locus_tag="EcE24377A_0103"
FT   CDS_pept        complement(113223..113420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0103"
FT                   /product="zinc-binding protein YacG"
FT                   /note="identified by similarity to SP:P0A8H8; match to
FT                   protein family HMM PF03884"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17095"
FT                   /db_xref="GOA:A7ZHJ2"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHJ2"
FT                   /protein_id="ABV17095.1"
FT   gene            complement(113430..114173)
FT                   /locus_tag="EcE24377A_0104"
FT   CDS_pept        complement(113430..114173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07072"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18705"
FT                   /db_xref="GOA:A7ZHJ3"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHJ3"
FT                   /protein_id="ABV18705.1"
FT   gene            complement(114173..114793)
FT                   /gene="coaE"
FT                   /locus_tag="EcE24377A_0105"
FT   CDS_pept        complement(114173..114793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="EcE24377A_0105"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01121;
FT                   match to protein family HMM TIGR00152"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18192"
FT                   /db_xref="GOA:A7ZHJ4"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ4"
FT                   /protein_id="ABV18192.1"
FT   gene            115018..116061
FT                   /gene="guaC"
FT                   /locus_tag="EcE24377A_0106"
FT   CDS_pept        115018..116061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="EcE24377A_0106"
FT                   /product="guanosine monophosphate reductase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM TIGR01305"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20259"
FT                   /db_xref="GOA:A7ZHJ5"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005993"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHJ5"
FT                   /protein_id="ABV20259.1"
FT                   NRIFNNL"
FT   gene            complement(116096..117298)
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0108"
FT                   /note="type IV pilus assembly protein PilC, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF00482"
FT   gene            complement(117288..118673)
FT                   /gene="hofB"
FT                   /locus_tag="EcE24377A_0109"
FT   CDS_pept        complement(117288..118673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB"
FT                   /locus_tag="EcE24377A_0109"
FT                   /product="GspE family protein HofB"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19862"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ6"
FT                   /protein_id="ABV19862.1"
FT                   HGE"
FT   gene            complement(118683..119123)
FT                   /gene="pilA"
FT                   /locus_tag="EcE24377A_0110"
FT   CDS_pept        complement(118683..119123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="EcE24377A_0110"
FT                   /product="type 4 pilus subunit PilA"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17773"
FT                   /db_xref="GOA:A7ZHJ7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ7"
FT                   /protein_id="ABV17773.1"
FT   gene            complement(119326..120219)
FT                   /gene="nadC"
FT                   /locus_tag="EcE24377A_0111"
FT   CDS_pept        complement(119326..120219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="EcE24377A_0111"
FT                   /product="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating)"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P30011; match to
FT                   protein family HMM PF01729; match to protein family HMM
FT                   PF02749; match to protein family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18295"
FT                   /db_xref="GOA:A7ZHJ8"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ8"
FT                   /protein_id="ABV18295.1"
FT                   ALTKHVQALDLSMRFR"
FT   gene            120307..120858
FT                   /gene="ampD"
FT                   /locus_tag="EcE24377A_0112"
FT   CDS_pept        120307..120858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="EcE24377A_0112"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P13016; match to
FT                   protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19572"
FT                   /db_xref="GOA:A7ZHJ9"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHJ9"
FT                   /protein_id="ABV19572.1"
FT   gene            120855..121709
FT                   /gene="ampE"
FT                   /locus_tag="EcE24377A_0113"
FT   CDS_pept        120855..121709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="EcE24377A_0113"
FT                   /product="protein AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19211"
FT                   /db_xref="GOA:A7ZHK0"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK0"
FT                   /protein_id="ABV19211.1"
FT                   ALV"
FT   gene            complement(121752..123122)
FT                   /gene="aroP"
FT                   /locus_tag="EcE24377A_0114"
FT   CDS_pept        complement(121752..123122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="EcE24377A_0114"
FT                   /product="aromatic amino acid transport protein AroP"
FT                   /note="identified by similarity to SP:P15993; match to
FT                   protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18284"
FT                   /db_xref="GOA:A7ZHK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK1"
FT                   /protein_id="ABV18284.1"
FT   gene            123666..124430
FT                   /locus_tag="EcE24377A_0115"
FT   CDS_pept        123666..124430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0115"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17914"
FT                   /db_xref="GOA:A7ZHK2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK2"
FT                   /protein_id="ABV17914.1"
FT   gene            124591..127254
FT                   /gene="aceE"
FT                   /locus_tag="EcE24377A_0116"
FT   CDS_pept        124591..127254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="EcE24377A_0116"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring),
FT                   homodimeric type"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR00759"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16926"
FT                   /db_xref="GOA:A7ZHK3"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK3"
FT                   /protein_id="ABV16926.1"
FT                   IAKFNIDADKVNPRLA"
FT   gene            127269..129161
FT                   /gene="aceF"
FT                   /locus_tag="EcE24377A_0117"
FT   CDS_pept        127269..129161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="EcE24377A_0117"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P06959; match to
FT                   protein family HMM PF00198; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02817; match to
FT                   protein family HMM TIGR01348"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16554"
FT                   /db_xref="GOA:A7ZHK4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK4"
FT                   /protein_id="ABV16554.1"
FT   gene            129486..130910
FT                   /gene="lpdA"
FT                   /locus_tag="EcE24377A_0118"
FT   CDS_pept        129486..130910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="EcE24377A_0118"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF02852; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20393"
FT                   /db_xref="GOA:A7ZHK5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK5"
FT                   /protein_id="ABV20393.1"
FT                   FEGSITDLPNPKAKKK"
FT   gene            complement(130981..132834)
FT                   /locus_tag="EcE24377A_0119"
FT   CDS_pept        complement(130981..132834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB33544.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18439"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK6"
FT                   /protein_id="ABV18439.1"
FT   gene            133189..135786
FT                   /gene="acnB"
FT                   /locus_tag="EcE24377A_0120"
FT   CDS_pept        133189..135786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="EcE24377A_0120"
FT                   /product="aconitate hydratase 2"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00330;
FT                   match to protein family HMM PF06434; match to protein
FT                   family HMM TIGR00117"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16532"
FT                   /db_xref="GOA:A7ZHK7"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHK7"
FT                   /protein_id="ABV16532.1"
FT   gene            135961..136323
FT                   /locus_tag="EcE24377A_0121"
FT   CDS_pept        135961..136323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P59396; match to
FT                   protein family HMM PF06062"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16974"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHK8"
FT                   /protein_id="ABV16974.1"
FT                   DFLQVVAAYRNFVQQK"
FT   gene            complement(136361..137155)
FT                   /gene="speD"
FT                   /locus_tag="EcE24377A_0122"
FT   CDS_pept        complement(136361..137155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="EcE24377A_0122"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02675"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20547"
FT                   /db_xref="GOA:A7ZHK9"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHK9"
FT                   /protein_id="ABV20547.1"
FT   gene            complement(137171..138037)
FT                   /gene="speE"
FT                   /locus_tag="EcE24377A_0123"
FT   CDS_pept        complement(137171..138037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="EcE24377A_0123"
FT                   /product="spermidine synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01564;
FT                   match to protein family HMM TIGR00417"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21061"
FT                   /db_xref="GOA:A7ZHL0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHL0"
FT                   /protein_id="ABV21061.1"
FT                   ALASQPS"
FT   gene            complement(138143..138490)
FT                   /locus_tag="EcE24377A_0124"
FT   CDS_pept        complement(138143..138490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19204"
FT                   /db_xref="InterPro:IPR019114"
FT                   /db_xref="InterPro:IPR038432"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL1"
FT                   /protein_id="ABV19204.1"
FT                   RDSLSLLAYVK"
FT   gene            138617..140206
FT                   /gene="cueO"
FT                   /locus_tag="EcE24377A_0125"
FT   CDS_pept        138617..140206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="EcE24377A_0125"
FT                   /product="copper oxidase CueO"
FT                   /note="identified by similarity to SP:P36649; match to
FT                   protein family HMM PF07731; match to protein family HMM
FT                   PF07732; match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19725"
FT                   /db_xref="GOA:A7ZHL2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL2"
FT                   /protein_id="ABV19725.1"
FT                   HEDTGMMLGFTV"
FT   gene            complement(140253..142643)
FT                   /gene="gcd"
FT                   /locus_tag="EcE24377A_0126"
FT   CDS_pept        complement(140253..142643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="EcE24377A_0126"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P15877; match to
FT                   protein family HMM PF01011; match to protein family HMM
FT                   TIGR03074"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17139"
FT                   /db_xref="GOA:A7ZHL3"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL3"
FT                   /protein_id="ABV17139.1"
FT   gene            142849..143385
FT                   /gene="hpt"
FT                   /locus_tag="EcE24377A_0127"
FT   CDS_pept        142849..143385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="EcE24377A_0127"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0A9M2; match to
FT                   protein family HMM PF00156; match to protein family HMM
FT                   TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17661"
FT                   /db_xref="GOA:A7ZHL4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL4"
FT                   /protein_id="ABV17661.1"
FT                   YRHLPYIGKVILLDE"
FT   gene            complement(143426..144088)
FT                   /gene="can"
FT                   /locus_tag="EcE24377A_0128"
FT   CDS_pept        complement(143426..144088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="EcE24377A_0128"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20544"
FT                   /db_xref="GOA:A7ZHL5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL5"
FT                   /protein_id="ABV20544.1"
FT   gene            144197..145123
FT                   /locus_tag="EcE24377A_0129"
FT   CDS_pept        144197..145123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0129"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16613"
FT                   /db_xref="GOA:A7ZHL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL6"
FT                   /protein_id="ABV16613.1"
FT   gene            145120..145890
FT                   /locus_tag="EcE24377A_0130"
FT   CDS_pept        145120..145890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0130"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19621"
FT                   /db_xref="GOA:A7ZHL7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL7"
FT                   /protein_id="ABV19621.1"
FT   gene            145995..146435
FT                   /locus_tag="EcE24377A_0131"
FT   CDS_pept        145995..146435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0131"
FT                   /product="PTS system, IIA component"
FT                   /note="identified by match to protein family HMM PF03610"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20938"
FT                   /db_xref="GOA:A7ZHL8"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL8"
FT                   /protein_id="ABV20938.1"
FT   gene            146499..147728
FT                   /locus_tag="EcE24377A_0132"
FT   CDS_pept        146499..147728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0132"
FT                   /product="polysaccharide deacetylase domain protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18581"
FT                   /db_xref="GOA:A7ZHL9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHL9"
FT                   /protein_id="ABV18581.1"
FT                   SRLVSNQPQG"
FT   gene            complement(147732..148112)
FT                   /gene="panD"
FT                   /locus_tag="EcE24377A_0133"
FT   CDS_pept        complement(147732..148112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="EcE24377A_0133"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19369"
FT                   /db_xref="GOA:A7ZHM0"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHM0"
FT                   /protein_id="ABV19369.1"
FT   gene            148080..148274
FT                   /locus_tag="EcE24377A_0134"
FT   CDS_pept        148080..148274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0134"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17542"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM1"
FT                   /protein_id="ABV17542.1"
FT   gene            148386..149288
FT                   /locus_tag="EcE24377A_0135"
FT   CDS_pept        148386..149288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04754;
FT                   match to protein family HMM TIGR01784"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17805"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM2"
FT                   /protein_id="ABV17805.1"
FT   gene            complement(149362..150213)
FT                   /gene="panC"
FT                   /locus_tag="EcE24377A_0136"
FT   CDS_pept        complement(149362..150213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="EcE24377A_0136"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018; match to protein
FT                   family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20126"
FT                   /db_xref="GOA:A7ZHM3"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHM3"
FT                   /protein_id="ABV20126.1"
FT                   LA"
FT   gene            complement(150225..151019)
FT                   /gene="panB"
FT                   /locus_tag="EcE24377A_0137"
FT   CDS_pept        complement(150225..151019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="EcE24377A_0137"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20645"
FT                   /db_xref="GOA:A7ZHM4"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHM4"
FT                   /protein_id="ABV20645.1"
FT   gene            complement(151132..152406)
FT                   /locus_tag="EcE24377A_0138"
FT   CDS_pept        complement(151132..152406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0138"
FT                   /product="fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19807"
FT                   /db_xref="GOA:A7ZHM5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR017014"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM5"
FT                   /protein_id="ABV19807.1"
FT   gene            complement(152459..153055)
FT                   /locus_tag="EcE24377A_0139"
FT   CDS_pept        complement(152459..153055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ86939.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18523"
FT                   /db_xref="GOA:A7ZHM6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM6"
FT                   /protein_id="ABV18523.1"
FT   gene            complement(153082..153684)
FT                   /locus_tag="EcE24377A_0140"
FT   CDS_pept        complement(153082..153684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0140"
FT                   /product="putative fimbrial protein"
FT                   /note="identified by match to protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16518"
FT                   /db_xref="GOA:A7ZHM7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM7"
FT                   /protein_id="ABV16518.1"
FT   gene            complement(153686..153781)
FT                   /locus_tag="EcE24377A_0141"
FT   CDS_pept        complement(153686..153781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0141"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17168"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM8"
FT                   /protein_id="ABV17168.1"
FT                   /translation="MRYVKQMQGKAYRGIFVHWQRLISSINKKDN"
FT   gene            complement(154285..156885)
FT                   /locus_tag="EcE24377A_0142"
FT   CDS_pept        complement(154285..156885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0142"
FT                   /product="outer membrane usher protein"
FT                   /note="identified by match to protein family HMM PF00577"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17684"
FT                   /db_xref="GOA:A7ZHM9"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHM9"
FT                   /protein_id="ABV17684.1"
FT   gene            complement(156920..157660)
FT                   /locus_tag="EcE24377A_0143"
FT   CDS_pept        complement(156920..157660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0143"
FT                   /product="gram-negative pili assembly chaperone"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18484"
FT                   /db_xref="GOA:A7ZHN0"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN0"
FT                   /protein_id="ABV18484.1"
FT   gene            157640..157753
FT                   /locus_tag="EcE24377A_0144"
FT   CDS_pept        157640..157753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0144"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16921"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN1"
FT                   /protein_id="ABV16921.1"
FT   gene            complement(157765..158349)
FT                   /locus_tag="EcE24377A_0145"
FT   CDS_pept        complement(157765..158349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0145"
FT                   /product="fimbrial protein"
FT                   /note="identified by similarity to SP:P08190; match to
FT                   protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17082"
FT                   /db_xref="GOA:A7ZHN2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN2"
FT                   /protein_id="ABV17082.1"
FT   gene            complement(158719..159198)
FT                   /gene="folK"
FT                   /locus_tag="EcE24377A_0146"
FT   CDS_pept        complement(158719..159198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="EcE24377A_0146"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P43777; match to
FT                   protein family HMM PF01288; match to protein family HMM
FT                   TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20345"
FT                   /db_xref="GOA:A7ZHN3"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN3"
FT                   /protein_id="ABV20345.1"
FT   gene            complement(159195..160559)
FT                   /gene="pcnB"
FT                   /locus_tag="EcE24377A_0147"
FT   CDS_pept        complement(159195..160559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="EcE24377A_0147"
FT                   /product="poly(A) polymerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM TIGR01942"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21113"
FT                   /db_xref="GOA:A7ZHN4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN4"
FT                   /protein_id="ABV21113.1"
FT   gene            complement(160652..161578)
FT                   /gene="gluQ"
FT                   /locus_tag="EcE24377A_0148"
FT   CDS_pept        complement(160652..161578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluQ"
FT                   /locus_tag="EcE24377A_0148"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /EC_number="6.1.1.-"
FT                   /note="identified by match to protein family HMM PF00749"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20791"
FT                   /db_xref="GOA:A7ZHN5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN5"
FT                   /protein_id="ABV20791.1"
FT   gene            complement(161615..162070)
FT                   /gene="dksA"
FT                   /locus_tag="EcE24377A_0149"
FT   CDS_pept        complement(161615..162070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="EcE24377A_0149"
FT                   /product="RNA polymerase-binding protein DksA"
FT                   /note="identified by match to protein family HMM PF01258;
FT                   match to protein family HMM TIGR02420"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19947"
FT                   /db_xref="GOA:A7ZHN6"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN6"
FT                   /protein_id="ABV19947.1"
FT   gene            complement(162248..162952)
FT                   /gene="sfsA"
FT                   /locus_tag="EcE24377A_0150"
FT   CDS_pept        complement(162248..162952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="EcE24377A_0150"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="identified by match to protein family HMM PF03749;
FT                   match to protein family HMM TIGR00230"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18365"
FT                   /db_xref="GOA:A7ZHN7"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHN7"
FT                   /protein_id="ABV18365.1"
FT                   GMALKKSLPVTL"
FT   gene            complement(162967..163497)
FT                   /gene="ligT"
FT                   /locus_tag="EcE24377A_0151"
FT   CDS_pept        complement(162967..163497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="EcE24377A_0151"
FT                   /product="2'-5' RNA ligase"
FT                   /note="identified by match to protein family HMM PF02834;
FT                   match to protein family HMM TIGR02258"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16502"
FT                   /db_xref="GOA:A7ZHN8"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN8"
FT                   /protein_id="ABV16502.1"
FT                   TRYTPLKRWALTQ"
FT   gene            163571..166000
FT                   /gene="hrpB"
FT                   /locus_tag="EcE24377A_0152"
FT   CDS_pept        163571..166000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="EcE24377A_0152"
FT                   /product="ATP-dependent helicase HrpB"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04408; match to protein family HMM PF08482;
FT                   match to protein family HMM TIGR01970"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17988"
FT                   /db_xref="GOA:A7ZHN9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHN9"
FT                   /protein_id="ABV17988.1"
FT   gene            166196..168730
FT                   /gene="mrcB"
FT                   /locus_tag="EcE24377A_0153"
FT   CDS_pept        166196..168730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="EcE24377A_0153"
FT                   /product="penicillin-binding protein 1B"
FT                   /EC_number=""
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by similarity to SP:P02919; match to
FT                   protein family HMM PF00905; match to protein family HMM
FT                   PF00912; match to protein family HMM TIGR02071"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19957"
FT                   /db_xref="GOA:A7ZHP0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR032730"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP0"
FT                   /protein_id="ABV19957.1"
FT   gene            complement(168795..168929)
FT                   /locus_tag="EcE24377A_0154"
FT   CDS_pept        complement(168795..168929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0154"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19707"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP1"
FT                   /protein_id="ABV19707.1"
FT   gene            168950..171193
FT                   /gene="fhuA"
FT                   /locus_tag="EcE24377A_0155"
FT   CDS_pept        168950..171193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="EcE24377A_0155"
FT                   /product="ferrichrome-iron receptor"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19063"
FT                   /db_xref="GOA:A7ZHP2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP2"
FT                   /protein_id="ABV19063.1"
FT   gene            171244..172041
FT                   /gene="fhuC"
FT                   /locus_tag="EcE24377A_0156"
FT   CDS_pept        171244..172041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="EcE24377A_0156"
FT                   /product="ferrichrome ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20024"
FT                   /db_xref="GOA:A7ZHP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP3"
FT                   /protein_id="ABV20024.1"
FT   gene            172041..172931
FT                   /gene="fhuD"
FT                   /locus_tag="EcE24377A_0157"
FT   CDS_pept        172041..172931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="EcE24377A_0157"
FT                   /product="ferrichrome ABC transporter, periplasmic
FT                   ferrichrome-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17287"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP4"
FT                   /protein_id="ABV17287.1"
FT                   MHFVRVLDNAIGGKA"
FT   gene            172928..174910
FT                   /gene="fhuB"
FT                   /locus_tag="EcE24377A_0158"
FT   CDS_pept        172928..174910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="EcE24377A_0158"
FT                   /product="ferrichrome ABC transporter, permease protein
FT                   FhuB"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17031"
FT                   /db_xref="GOA:A7ZHP5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP5"
FT                   /protein_id="ABV17031.1"
FT   gene            complement(174945..176225)
FT                   /gene="hemL"
FT                   /locus_tag="EcE24377A_0159"
FT   CDS_pept        complement(174945..176225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="EcE24377A_0159"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P23893; match to
FT                   protein family HMM PF00202; match to protein family HMM
FT                   TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16915"
FT                   /db_xref="GOA:A7ZHP6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHP6"
FT                   /protein_id="ABV16915.1"
FT   gene            176450..177871
FT                   /gene="clcA"
FT                   /locus_tag="EcE24377A_0160"
FT   CDS_pept        176450..177871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="EcE24377A_0160"
FT                   /product="H(+)/Cl(-) exchange transporter ClcA"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18648"
FT                   /db_xref="GOA:A7ZHP7"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHP7"
FT                   /protein_id="ABV18648.1"
FT                   EQLARSKAASASENT"
FT   gene            177953..178297
FT                   /locus_tag="EcE24377A_0161"
FT   CDS_pept        177953..178297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0161"
FT                   /product="iron-sulfur cluster assembly accessory protein
FT                   YadR"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18013"
FT                   /db_xref="GOA:A7ZHP8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHP8"
FT                   /protein_id="ABV18013.1"
FT                   TCGCGSSFSI"
FT   gene            complement(178344..178967)
FT                   /locus_tag="EcE24377A_0162"
FT   CDS_pept        complement(178344..178967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0162"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19692"
FT                   /db_xref="GOA:A7ZHP9"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHP9"
FT                   /protein_id="ABV19692.1"
FT   gene            complement(179005..179805)
FT                   /gene="btuF"
FT                   /locus_tag="EcE24377A_0163"
FT   CDS_pept        complement(179005..179805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="EcE24377A_0163"
FT                   /product="cobalamin ABC transporter, periplasmic
FT                   cobalamin-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19020"
FT                   /db_xref="GOA:A7ZHQ0"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR023544"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHQ0"
FT                   /protein_id="ABV19020.1"
FT   gene            complement(179798..180496)
FT                   /gene="mtnN"
FT                   /locus_tag="EcE24377A_0164"
FT   CDS_pept        complement(179798..180496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="EcE24377A_0164"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0AF15; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20698"
FT                   /db_xref="GOA:A7ZHQ1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHQ1"
FT                   /protein_id="ABV20698.1"
FT                   ESLVQKLAHG"
FT   gene            180580..182097
FT                   /gene="dgt"
FT                   /locus_tag="EcE24377A_0165"
FT   CDS_pept        180580..182097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="EcE24377A_0165"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P15723; match to
FT                   protein family HMM PF01966; match to protein family HMM
FT                   TIGR01353"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17589"
FT                   /db_xref="GOA:A7ZHQ2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR020779"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHQ2"
FT                   /protein_id="ABV17589.1"
FT   gene            182227..183651
FT                   /gene="degP"
FT                   /locus_tag="EcE24377A_0166"
FT   CDS_pept        182227..183651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="EcE24377A_0166"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by similarity to SP:P09376; match to
FT                   protein family HMM PF00089; match to protein family HMM
FT                   PF00595; match to protein family HMM TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16933"
FT                   /db_xref="GOA:A7ZHQ3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHQ3"
FT                   /protein_id="ABV16933.1"
FT                   ALNIQRGDSSIYLLMQ"
FT   gene            183833..184963
FT                   /gene="cdaR"
FT                   /locus_tag="EcE24377A_0167"
FT   CDS_pept        183833..184963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="EcE24377A_0167"
FT                   /product="carbohydrate diacid regulator"
FT                   /note="identified by similarity to SP:P37047; match to
FT                   protein family HMM PF05651"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18596"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHQ4"
FT                   /protein_id="ABV18596.1"
FT   gene            complement(185052..185438)
FT                   /locus_tag="EcE24377A_0168"
FT   CDS_pept        complement(185052..185438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17949"
FT                   /db_xref="InterPro:IPR020911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHQ5"
FT                   /protein_id="ABV17949.1"
FT   gene            complement(185753..186577)
FT                   /gene="dapD"
FT                   /locus_tag="EcE24377A_0169"
FT   CDS_pept        complement(185753..186577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="EcE24377A_0169"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P56220; match to
FT                   protein family HMM PF00132; match to protein family HMM
FT                   TIGR00965"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17775"
FT                   /db_xref="GOA:A7ZHQ6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHQ6"
FT                   /protein_id="ABV17775.1"
FT   gene            complement(186608..189280)
FT                   /gene="glnD"
FT                   /locus_tag="EcE24377A_0170"
FT   CDS_pept        complement(186608..189280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="EcE24377A_0170"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01909; match to protein
FT                   family HMM PF01966; match to protein family HMM PF08335;
FT                   match to protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19536"
FT                   /db_xref="GOA:A7ZHQ7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHQ7"
FT                   /protein_id="ABV19536.1"
FT   gene            complement(189342..190136)
FT                   /gene="map"
FT                   /locus_tag="EcE24377A_0171"
FT   CDS_pept        complement(189342..190136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="EcE24377A_0171"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19088"
FT                   /db_xref="GOA:A7ZHQ8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHQ8"
FT                   /protein_id="ABV19088.1"
FT   gene            190504..191229
FT                   /gene="rpsB"
FT                   /locus_tag="EcE24377A_0173"
FT   CDS_pept        190504..191229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="EcE24377A_0173"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21019"
FT                   /db_xref="GOA:A7ZHQ9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHQ9"
FT                   /protein_id="ABV21019.1"
FT   gene            191487..192338
FT                   /gene="tsf"
FT                   /locus_tag="EcE24377A_0174"
FT   CDS_pept        191487..192338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="EcE24377A_0174"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20338"
FT                   /db_xref="GOA:A7ZHR0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHR0"
FT                   /protein_id="ABV20338.1"
FT                   QS"
FT   gene            192485..193210
FT                   /gene="pyrH"
FT                   /locus_tag="EcE24377A_0175"
FT   CDS_pept        192485..193210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="EcE24377A_0175"
FT                   /product="UMP kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0A7E9; match to
FT                   protein family HMM PF00696; match to protein family HMM
FT                   TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17582"
FT                   /db_xref="GOA:A7ZHR1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHR1"
FT                   /protein_id="ABV17582.1"
FT   gene            193502..194059
FT                   /gene="frr"
FT                   /locus_tag="EcE24377A_0176"
FT   CDS_pept        193502..194059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="EcE24377A_0176"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16949"
FT                   /db_xref="GOA:A7ZHR2"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHR2"
FT                   /protein_id="ABV16949.1"
FT   gene            194151..195347
FT                   /gene="dxr"
FT                   /locus_tag="EcE24377A_0177"
FT   CDS_pept        194151..195347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="EcE24377A_0177"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P45568; match to
FT                   protein family HMM PF02670; match to protein family HMM
FT                   PF08436; match to protein family HMM TIGR00243"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18356"
FT                   /db_xref="GOA:A7ZHR3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHR3"
FT                   /protein_id="ABV18356.1"
FT   gene            195536..196294
FT                   /gene="uppS"
FT                   /locus_tag="EcE24377A_0178"
FT   CDS_pept        195536..196294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="EcE24377A_0178"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P60472; match to
FT                   protein family HMM PF01255; match to protein family HMM
FT                   TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17725"
FT                   /db_xref="GOA:A7ZHR4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHR4"
FT                   /protein_id="ABV17725.1"
FT   gene            196307..197164
FT                   /gene="cdsA1"
FT                   /locus_tag="EcE24377A_0179"
FT   CDS_pept        196307..197164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA1"
FT                   /locus_tag="EcE24377A_0179"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20668"
FT                   /db_xref="GOA:A7ZHR5"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHR5"
FT                   /protein_id="ABV20668.1"
FT                   FRTL"
FT   gene            197176..198528
FT                   /gene="rseP"
FT                   /locus_tag="EcE24377A_0180"
FT   CDS_pept        197176..198528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="EcE24377A_0180"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF02163; match to protein
FT                   family HMM TIGR00054"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17982"
FT                   /db_xref="GOA:A7ZHR6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHR6"
FT                   /protein_id="ABV17982.1"
FT   gene            198558..200990
FT                   /gene="yaeT"
FT                   /locus_tag="EcE24377A_0181"
FT   CDS_pept        198558..200990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="EcE24377A_0181"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244; match to protein
FT                   family HMM TIGR03303"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17301"
FT                   /db_xref="GOA:A7ZHR7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHR7"
FT                   /protein_id="ABV17301.1"
FT   gene            201112..201597
FT                   /gene="skp"
FT                   /locus_tag="EcE24377A_0182"
FT   CDS_pept        201112..201597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="EcE24377A_0182"
FT                   /product="chaperone protein Skp"
FT                   /note="identified by similarity to SP:P31519; match to
FT                   protein family HMM PF03938"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17189"
FT                   /db_xref="GOA:A7ZHR8"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHR8"
FT                   /protein_id="ABV17189.1"
FT   gene            201601..202626
FT                   /gene="lpxD"
FT                   /locus_tag="EcE24377A_0183"
FT   CDS_pept        201601..202626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="EcE24377A_0183"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF04613; match to protein
FT                   family HMM TIGR01853"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16580"
FT                   /db_xref="GOA:A7ZHR9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHR9"
FT                   /protein_id="ABV16580.1"
FT                   D"
FT   gene            202731..203186
FT                   /gene="fabZ"
FT                   /locus_tag="EcE24377A_0184"
FT   CDS_pept        202731..203186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="EcE24377A_0184"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18514"
FT                   /db_xref="GOA:A7ZHS0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHS0"
FT                   /protein_id="ABV18514.1"
FT   gene            203190..203978
FT                   /gene="lpxA"
FT                   /locus_tag="EcE24377A_0185"
FT   CDS_pept        203190..203978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="EcE24377A_0185"
FT                   /product="acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01852"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17840"
FT                   /db_xref="GOA:A7ZHS1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHS1"
FT                   /protein_id="ABV17840.1"
FT   gene            203978..205126
FT                   /gene="lpxB"
FT                   /locus_tag="EcE24377A_0186"
FT   CDS_pept        203978..205126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="EcE24377A_0186"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02684;
FT                   match to protein family HMM TIGR00215"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19797"
FT                   /db_xref="GOA:A7ZHS2"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHS2"
FT                   /protein_id="ABV19797.1"
FT   gene            205123..205719
FT                   /gene="rnhB"
FT                   /locus_tag="EcE24377A_0187"
FT   CDS_pept        205123..205719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="EcE24377A_0187"
FT                   /product="ribonuclease HII"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19192"
FT                   /db_xref="GOA:A7ZHS3"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHS3"
FT                   /protein_id="ABV19192.1"
FT   gene            205756..209238
FT                   /gene="dnaE"
FT                   /locus_tag="EcE24377A_0188"
FT   CDS_pept        205756..209238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="EcE24377A_0188"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P10443; match to
FT                   protein family HMM PF01336; match to protein family HMM
FT                   PF02811; match to protein family HMM PF07733; match to
FT                   protein family HMM TIGR00594"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20721"
FT                   /db_xref="GOA:A7ZHS4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHS4"
FT                   /protein_id="ABV20721.1"
FT   gene            209251..210210
FT                   /gene="accA"
FT                   /locus_tag="EcE24377A_0189"
FT   CDS_pept        209251..210210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="EcE24377A_0189"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17488"
FT                   /db_xref="GOA:A7ZHS5"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHS5"
FT                   /protein_id="ABV17488.1"
FT   gene            210309..212450
FT                   /gene="ldcC"
FT                   /locus_tag="EcE24377A_0190"
FT   CDS_pept        210309..212450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="EcE24377A_0190"
FT                   /product="lysine decarboxylase, constitutive"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P52095; match to
FT                   protein family HMM PF01276; match to protein family HMM
FT                   PF03709; match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17288"
FT                   /db_xref="GOA:A7ZHS6"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHS6"
FT                   /protein_id="ABV17288.1"
FT   gene            212507..212896
FT                   /locus_tag="EcE24377A_0191"
FT   CDS_pept        212507..212896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0191"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17324"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHS7"
FT                   /protein_id="ABV17324.1"
FT   gene            212961..214259
FT                   /gene="tilS"
FT                   /locus_tag="EcE24377A_0192"
FT   CDS_pept        212961..214259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="EcE24377A_0192"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by similarity to SP:P52097; match to
FT                   protein family HMM PF01171; match to protein family HMM
FT                   PF09179; match to protein family HMM TIGR02432; match to
FT                   protein family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20063"
FT                   /db_xref="GOA:A7ZHS8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHS8"
FT                   /protein_id="ABV20063.1"
FT   gene            complement(214308..214568)
FT                   /gene="rof"
FT                   /locus_tag="EcE24377A_0193"
FT   CDS_pept        complement(214308..214568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="EcE24377A_0193"
FT                   /product="rof protein"
FT                   /note="identified by similarity to SP:P0AFW8; match to
FT                   protein family HMM PF07073"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16755"
FT                   /db_xref="InterPro:IPR009778"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR038626"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHS9"
FT                   /protein_id="ABV16755.1"
FT   gene            complement(214555..214755)
FT                   /locus_tag="EcE24377A_0194"
FT   CDS_pept        complement(214555..214755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06786"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16652"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHT0"
FT                   /protein_id="ABV16652.1"
FT   gene            214921..215466
FT                   /locus_tag="EcE24377A_0195"
FT   CDS_pept        214921..215466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07152"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18162"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT1"
FT                   /protein_id="ABV18162.1"
FT                   SDDKNNLEVNLTAWQQPS"
FT   gene            215463..215885
FT                   /locus_tag="EcE24377A_0196"
FT   CDS_pept        215463..215885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0196"
FT                   /product="putative peptidyl-tRNA hydrolase"
FT                   /note="identified by match to protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18825"
FT                   /db_xref="GOA:A7ZHT2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT2"
FT                   /protein_id="ABV18825.1"
FT   gene            215899..216609
FT                   /gene="cutF"
FT                   /locus_tag="EcE24377A_0197"
FT   CDS_pept        215899..216609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutF"
FT                   /locus_tag="EcE24377A_0197"
FT                   /product="copper homeostasis protein CutF"
FT                   /note="identified by match to protein family HMM PF04170"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18911"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR033450"
FT                   /db_xref="InterPro:IPR038139"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT3"
FT                   /protein_id="ABV18911.1"
FT                   GKFYPNKDCSSLGQ"
FT   gene            216859..217839
FT                   /locus_tag="EcE24377A_0198"
FT   CDS_pept        216859..217839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0198"
FT                   /product="IS621, transposase"
FT                   /note="identified by match to protein family HMM PF01548;
FT                   match to protein family HMM PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19046"
FT                   /db_xref="GOA:A7ZHT4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT4"
FT                   /protein_id="ABV19046.1"
FT   gene            217966..218076
FT                   /locus_tag="EcE24377A_0200"
FT   CDS_pept        217966..218076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0200"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18010"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT5"
FT                   /protein_id="ABV18010.1"
FT   gene            complement(218042..218919)
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0199"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            complement(218919..220637)
FT                   /gene="proS"
FT                   /locus_tag="EcE24377A_0201"
FT   CDS_pept        complement(218919..220637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="EcE24377A_0201"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17746"
FT                   /db_xref="GOA:A7ZHT6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHT6"
FT                   /protein_id="ABV17746.1"
FT   gene            complement(220749..221456)
FT                   /locus_tag="EcE24377A_0202"
FT   CDS_pept        complement(220749..221456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0202"
FT                   /product="conserved hypothetical protein TIGR00104"
FT                   /note="identified by match to protein family HMM PF01980;
FT                   match to protein family HMM TIGR00104"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17056"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT7"
FT                   /protein_id="ABV17056.1"
FT                   TDAGFEVFALEPR"
FT   gene            complement(221453..221857)
FT                   /gene="rcsF"
FT                   /locus_tag="EcE24377A_0203"
FT   CDS_pept        complement(221453..221857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="EcE24377A_0203"
FT                   /product="exopolysaccharide synthesis regulator RcsF"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16694"
FT                   /db_xref="GOA:A7ZHT8"
FT                   /db_xref="InterPro:IPR030852"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT8"
FT                   /protein_id="ABV16694.1"
FT   gene            complement(221975..222790)
FT                   /gene="metQ"
FT                   /locus_tag="EcE24377A_0204"
FT   CDS_pept        complement(221975..222790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="EcE24377A_0204"
FT                   /product="D-methionine ABC transporter, periplasmic
FT                   D-methionine-binding lipoprotein"
FT                   /note="identified by match to protein family HMM PF03180;
FT                   match to protein family HMM TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21033"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHT9"
FT                   /protein_id="ABV21033.1"
FT   gene            complement(222830..223483)
FT                   /gene="metI"
FT                   /locus_tag="EcE24377A_0205"
FT   CDS_pept        complement(222830..223483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="EcE24377A_0205"
FT                   /product="D-methionine ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20374"
FT                   /db_xref="GOA:A7ZHU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU0"
FT                   /protein_id="ABV20374.1"
FT   gene            complement(223476..224507)
FT                   /gene="metN"
FT                   /locus_tag="EcE24377A_0206"
FT   CDS_pept        complement(223476..224507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="EcE24377A_0206"
FT                   /product="D-methionine ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR02314"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20143"
FT                   /db_xref="GOA:A7ZHU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012692"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU1"
FT                   /protein_id="ABV20143.1"
FT                   GYV"
FT   gene            224695..225270
FT                   /locus_tag="EcE24377A_0207"
FT   CDS_pept        224695..225270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0207"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="identified by match to protein family HMM PF08645;
FT                   match to protein family HMM TIGR00213; match to protein
FT                   family HMM TIGR01656; match to protein family HMM
FT                   TIGR01662"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19716"
FT                   /db_xref="GOA:A7ZHU2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU2"
FT                   /protein_id="ABV19716.1"
FT   gene            225632..227173
FT                   /gene="rrsA"
FT                   /locus_tag="EcE24377A_5003"
FT   rRNA            225632..227173
FT                   /gene="rrsA"
FT                   /locus_tag="EcE24377A_5003"
FT                   /product="16S ribosomal RNA"
FT   gene            227242..227318
FT                   /locus_tag="EcE24377A_5004"
FT   tRNA            227242..227318
FT                   /locus_tag="EcE24377A_5004"
FT                   /product="tRNA-Ile"
FT   gene            227361..227436
FT                   /locus_tag="EcE24377A_5005"
FT   tRNA            227361..227436
FT                   /locus_tag="EcE24377A_5005"
FT                   /product="tRNA-Ala"
FT   gene            227600..230523
FT                   /gene="rrlA"
FT                   /locus_tag="EcE24377A_5006"
FT   rRNA            227600..230523
FT                   /gene="rrlA"
FT                   /locus_tag="EcE24377A_5006"
FT                   /product="23S ribosomal RNA"
FT   gene            230616..230735
FT                   /gene="rrfA"
FT                   /locus_tag="EcE24377A_5007"
FT   rRNA            230616..230735
FT                   /gene="rrfA"
FT                   /locus_tag="EcE24377A_5007"
FT                   /product="5S ribosomal RNA"
FT   gene            230927..231003
FT                   /locus_tag="EcE24377A_5008"
FT   tRNA            230927..231003
FT                   /locus_tag="EcE24377A_5008"
FT                   /product="tRNA-Asp"
FT   gene            231166..231969
FT                   /gene="dkgB"
FT                   /locus_tag="EcE24377A_0213"
FT   CDS_pept        231166..231969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="EcE24377A_0213"
FT                   /product="2,5-didehydrogluconate reductase B"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P30863; match to
FT                   protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21015"
FT                   /db_xref="GOA:A7ZHU3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU3"
FT                   /protein_id="ABV21015.1"
FT   gene            complement(231966..232880)
FT                   /locus_tag="EcE24377A_0212"
FT   CDS_pept        complement(231966..232880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0212"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16796"
FT                   /db_xref="GOA:A7ZHU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU4"
FT                   /protein_id="ABV16796.1"
FT   gene            233121..233921
FT                   /locus_tag="EcE24377A_0214"
FT   CDS_pept        233121..233921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0214"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17578"
FT                   /db_xref="GOA:A7ZHU5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR022958"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHU5"
FT                   /protein_id="ABV17578.1"
FT   gene            233999..234769
FT                   /locus_tag="EcE24377A_0215"
FT   CDS_pept        233999..234769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0215"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18125"
FT                   /db_xref="GOA:A7ZHU6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU6"
FT                   /protein_id="ABV18125.1"
FT   gene            complement(234817..236175)
FT                   /gene="mltD"
FT                   /locus_tag="EcE24377A_0216"
FT   CDS_pept        complement(234817..236175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="EcE24377A_0216"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by similarity to SP:P0AEZ7; match to
FT                   protein family HMM PF01464; match to protein family HMM
FT                   PF01476; match to protein family HMM PF06474"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18938"
FT                   /db_xref="GOA:A7ZHU7"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU7"
FT                   /protein_id="ABV18938.1"
FT   gene            complement(236247..237002)
FT                   /gene="gloB"
FT                   /locus_tag="EcE24377A_0217"
FT   CDS_pept        complement(236247..237002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="EcE24377A_0217"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0AC84; match to
FT                   protein family HMM PF00753; match to protein family HMM
FT                   TIGR03413"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19437"
FT                   /db_xref="GOA:A7ZHU8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHU8"
FT                   /protein_id="ABV19437.1"
FT   gene            237036..237758
FT                   /locus_tag="EcE24377A_0220"
FT   CDS_pept        237036..237758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0220"
FT                   /product="putative methyltransferase"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17274"
FT                   /db_xref="GOA:A7ZHU9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHU9"
FT                   /protein_id="ABV17274.1"
FT                   PRIRQAVGATRQCRKPQA"
FT   gene            complement(237199..237327)
FT                   /locus_tag="EcE24377A_0218"
FT   CDS_pept        complement(237199..237327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0218"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18944"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV0"
FT                   /protein_id="ABV18944.1"
FT   gene            complement(237755..238222)
FT                   /gene="rnhA"
FT                   /locus_tag="EcE24377A_0219"
FT   CDS_pept        complement(237755..238222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="EcE24377A_0219"
FT                   /product="ribonuclease H"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17831"
FT                   /db_xref="GOA:A7ZHV1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHV1"
FT                   /protein_id="ABV17831.1"
FT   gene            238287..239018
FT                   /gene="dnaQ"
FT                   /locus_tag="EcE24377A_0221"
FT   CDS_pept        238287..239018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="EcE24377A_0221"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P03007; match to
FT                   protein family HMM PF00929; match to protein family HMM
FT                   TIGR00573; match to protein family HMM TIGR01406"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18398"
FT                   /db_xref="GOA:A7ZHV2"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV2"
FT                   /protein_id="ABV18398.1"
FT   gene            239151..239227
FT                   /locus_tag="EcE24377A_5009"
FT   tRNA            239151..239227
FT                   /locus_tag="EcE24377A_5009"
FT                   /product="tRNA-Asp"
FT   gene            239237..239335
FT                   /locus_tag="EcE24377A_0223"
FT   CDS_pept        239237..239335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19549"
FT                   /db_xref="GOA:A7ZHV3"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV3"
FT                   /protein_id="ABV19549.1"
FT                   /translation="MKMSSENRKIFNFAVFLHLNPAISSVYGFVML"
FT   gene            239557..240342
FT                   /locus_tag="EcE24377A_0224"
FT   CDS_pept        239557..240342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0224"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20235"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV4"
FT                   /protein_id="ABV20235.1"
FT   gene            complement(240968..241882)
FT                   /locus_tag="EcE24377A_0225"
FT   CDS_pept        complement(240968..241882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20901"
FT                   /db_xref="GOA:A7ZHV5"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV5"
FT                   /protein_id="ABV20901.1"
FT   gene            complement(241926..242408)
FT                   /locus_tag="EcE24377A_0226"
FT   CDS_pept        complement(241926..242408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE12300.1; match to
FT                   protein family HMM PF05638; match to protein family HMM
FT                   TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17373"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV6"
FT                   /protein_id="ABV17373.1"
FT   gene            complement(242432..243784)
FT                   /locus_tag="EcE24377A_0227"
FT   CDS_pept        complement(242432..243784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0227"
FT                   /product="ImpA domain protein"
FT                   /note="identified by match to protein family HMM PF06812"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16754"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR021069"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV7"
FT                   /protein_id="ABV16754.1"
FT   gene            complement(243795..247319)
FT                   /locus_tag="EcE24377A_0228"
FT   CDS_pept        complement(243795..247319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06744;
FT                   match to protein family HMM PF06761; match to protein
FT                   family HMM TIGR03348"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17476"
FT                   /db_xref="GOA:A7ZHV8"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV8"
FT                   /protein_id="ABV17476.1"
FT                   FGLSDTLY"
FT   gene            complement(247338..248750)
FT                   /locus_tag="EcE24377A_0229"
FT   CDS_pept        complement(247338..248750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0229"
FT                   /product="ImpA domain protein"
FT                   /note="identified by match to protein family HMM PF06812;
FT                   match to protein family HMM TIGR03362"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18177"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHV9"
FT                   /protein_id="ABV18177.1"
FT                   LEQLEQKFTAEQ"
FT   gene            complement(248755..249498)
FT                   /locus_tag="EcE24377A_0230"
FT   CDS_pept        complement(248755..249498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0230"
FT                   /product="type VI secretion-associated protein, VC_A0118
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR03360"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18819"
FT                   /db_xref="InterPro:IPR017738"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW0"
FT                   /protein_id="ABV18819.1"
FT   gene            complement(249495..252254)
FT                   /locus_tag="EcE24377A_0231"
FT   CDS_pept        complement(249495..252254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0231"
FT                   /product="ATP-dependent chaperone protein ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07724; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR03345"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19435"
FT                   /db_xref="GOA:A7ZHW1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW1"
FT                   /protein_id="ABV19435.1"
FT   gene            complement(252263..253024)
FT                   /locus_tag="EcE24377A_0232"
FT   CDS_pept        complement(252263..253024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAF96029.1; match to
FT                   protein family HMM TIGR03349"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20010"
FT                   /db_xref="GOA:A7ZHW2"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW2"
FT                   /protein_id="ABV20010.1"
FT   gene            complement(253029..254360)
FT                   /locus_tag="EcE24377A_0233"
FT   CDS_pept        complement(253029..254360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAM83869.1; match to
FT                   protein family HMM PF05936; match to protein family HMM
FT                   TIGR03353"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20868"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW3"
FT                   /protein_id="ABV20868.1"
FT   gene            complement(254363..254887)
FT                   /locus_tag="EcE24377A_0234"
FT   CDS_pept        complement(254363..254887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0234"
FT                   /product="type VI secretion lipoprotein, VC_A0113 family"
FT                   /note="identified by match to protein family HMM TIGR03352"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20127"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW4"
FT                   /protein_id="ABV20127.1"
FT                   QSSIEMKKEDE"
FT   gene            complement(254884..256164)
FT                   /locus_tag="EcE24377A_0235"
FT   CDS_pept        complement(254884..256164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAC92824.1; match to
FT                   protein family HMM TIGR03354"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20875"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW5"
FT                   /protein_id="ABV20875.1"
FT   gene            complement(256189..257271)
FT                   /locus_tag="EcE24377A_0236"
FT   CDS_pept        complement(256189..257271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB33651.1; match to
FT                   protein family HMM PF06996; match to protein family HMM
FT                   TIGR03347"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20192"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW6"
FT                   /protein_id="ABV20192.1"
FT   gene            complement(257235..259085)
FT                   /locus_tag="EcE24377A_0237"
FT   CDS_pept        complement(257235..259085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ87034.1; match to
FT                   protein family HMM PF05947; match to protein family HMM
FT                   TIGR03359"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17461"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW7"
FT                   /protein_id="ABV17461.1"
FT   gene            complement(259089..259502)
FT                   /locus_tag="EcE24377A_0238"
FT   CDS_pept        complement(259089..259502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG76342.1; match to
FT                   protein family HMM PF04965; match to protein family HMM
FT                   TIGR03357"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16805"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW8"
FT                   /protein_id="ABV16805.1"
FT   gene            complement(259509..260984)
FT                   /locus_tag="EcE24377A_0239"
FT   CDS_pept        complement(259509..260984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAB33654.1; match to
FT                   protein family HMM PF05943; match to protein family HMM
FT                   TIGR03355"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18837"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHW9"
FT                   /protein_id="ABV18837.1"
FT   gene            complement(261035..261259)
FT                   /locus_tag="EcE24377A_0240"
FT   CDS_pept        complement(261035..261259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18033"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX0"
FT                   /protein_id="ABV18033.1"
FT   gene            complement(261294..261794)
FT                   /locus_tag="EcE24377A_0241"
FT   CDS_pept        complement(261294..261794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ87038.1; match to
FT                   protein family HMM PF05591; match to protein family HMM
FT                   TIGR03358"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19982"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX1"
FT                   /protein_id="ABV19982.1"
FT                   SNK"
FT   gene            262222..262365
FT                   /locus_tag="EcE24377A_0242"
FT   CDS_pept        262222..262365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19158"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX2"
FT                   /protein_id="ABV19158.1"
FT                   KF"
FT   gene            262492..263010
FT                   /locus_tag="EcE24377A_0243"
FT   CDS_pept        262492..263010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05638;
FT                   match to protein family HMM TIGR03344"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19482"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX3"
FT                   /protein_id="ABV19482.1"
FT                   DDWRAPLEA"
FT   gene            263043..263180
FT                   /locus_tag="EcE24377A_0244"
FT   CDS_pept        263043..263180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18999"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX4"
FT                   /protein_id="ABV18999.1"
FT                   "
FT   gene            263220..265361
FT                   /locus_tag="EcE24377A_0245"
FT   CDS_pept        263220..265361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0245"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM PF06715; match to protein
FT                   family HMM TIGR01646; match to protein family HMM
FT                   TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20831"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX5"
FT                   /protein_id="ABV20831.1"
FT   gene            265437..269684
FT                   /locus_tag="EcE24377A_0246"
FT   CDS_pept        265437..269684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0246"
FT                   /product="Rhs protein"
FT                   /note="identified by match to protein family HMM PF03527;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20272"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX6"
FT                   /protein_id="ABV20272.1"
FT                   IKAKQGSSDASNY"
FT   gene            269668..270150
FT                   /locus_tag="EcE24377A_0247"
FT   CDS_pept        269668..270150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16838"
FT                   /db_xref="GOA:A7ZHX7"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX7"
FT                   /protein_id="ABV16838.1"
FT   gene            270331..271077
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0248"
FT                   /note="putative transposase, IS4 family, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts; identified by match to protein family HMM
FT                   PF01609"
FT   gene            271121..271321
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0249"
FT                   /note="putative transposase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            271560..272696
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0250"
FT                   /note="ISEc3, transposase, authentic point mutation; this
FT                   gene contains a premature stop which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01609"
FT   gene            complement(272738..273508)
FT                   /locus_tag="EcE24377A_0251"
FT   CDS_pept        complement(272738..273508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0251"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /note="identified by match to protein family HMM PF00795"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20084"
FT                   /db_xref="GOA:A7ZHX8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX8"
FT                   /protein_id="ABV20084.1"
FT   gene            273662..274135
FT                   /locus_tag="EcE24377A_0252"
FT   CDS_pept        273662..274135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0252"
FT                   /product="Inhibitor of vertebrate lysozyme"
FT                   /note="identified by match to protein family HMM PF08816"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20639"
FT                   /db_xref="GOA:A7ZHX9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHX9"
FT                   /protein_id="ABV20639.1"
FT   gene            complement(274178..276622)
FT                   /gene="fadE"
FT                   /locus_tag="EcE24377A_0253"
FT   CDS_pept        complement(274178..276622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="EcE24377A_0253"
FT                   /product="acyl-coenzyme A dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by similarity to SP:Q8ZRJ7; match to
FT                   protein family HMM PF00441; match to protein family HMM
FT                   PF09317"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21016"
FT                   /db_xref="GOA:A7ZHY0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY0"
FT                   /protein_id="ABV21016.1"
FT                   AA"
FT   gene            276862..277440
FT                   /gene="gmhA"
FT                   /locus_tag="EcE24377A_0254"
FT   CDS_pept        276862..277440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="EcE24377A_0254"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="identified by match to protein family HMM TIGR00441"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19721"
FT                   /db_xref="GOA:A7ZHY1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHY1"
FT                   /protein_id="ABV19721.1"
FT   gene            277494..277586
FT                   /locus_tag="EcE24377A_0255"
FT   CDS_pept        277494..277586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18001"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY2"
FT                   /protein_id="ABV18001.1"
FT                   /translation="MPDAMLTRLIMPTNLYANRRPNNSFTPHPT"
FT   gene            277646..278413
FT                   /locus_tag="EcE24377A_0257"
FT   CDS_pept        277646..278413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0257"
FT                   /product="glutamine amidotransferase, class II"
FT                   /note="identified by match to protein family HMM PF00310"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16942"
FT                   /db_xref="GOA:A7ZHY3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY3"
FT                   /protein_id="ABV16942.1"
FT   gene            complement(278384..279124)
FT                   /locus_tag="EcE24377A_0256"
FT   CDS_pept        complement(278384..279124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06104"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18647"
FT                   /db_xref="GOA:A7ZHY4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY4"
FT                   /protein_id="ABV18647.1"
FT   gene            complement(279280..279558)
FT                   /locus_tag="EcE24377A_0258"
FT   CDS_pept        complement(279280..279558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0258"
FT                   /product="conserved hypothetical protein TIGR00053"
FT                   /note="identified by match to protein family HMM PF05016;
FT                   match to protein family HMM TIGR00053; match to protein
FT                   family HMM TIGR02385"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17148"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY5"
FT                   /protein_id="ABV17148.1"
FT   gene            complement(279561..279821)
FT                   /locus_tag="EcE24377A_0259"
FT   CDS_pept        complement(279561..279821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0259"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="identified by similarity to SP:Q47150; match to
FT                   protein family HMM PF04221; match to protein family HMM
FT                   TIGR02384"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17280"
FT                   /db_xref="GOA:A7ZHY6"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY6"
FT                   /protein_id="ABV17280.1"
FT   gene            279971..280780
FT                   /locus_tag="EcE24377A_0261"
FT   CDS_pept        279971..280780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0261"
FT                   /product="NlpC/P60 family protein"
FT                   /note="identified by match to protein family HMM PF00877"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20480"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY7"
FT                   /protein_id="ABV20480.1"
FT   gene            complement(280015..280128)
FT                   /locus_tag="EcE24377A_0260"
FT   CDS_pept        complement(280015..280128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0260"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18308"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY8"
FT                   /protein_id="ABV18308.1"
FT   gene            complement(280837..281193)
FT                   /locus_tag="EcE24377A_0262"
FT   CDS_pept        complement(280837..281193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0262"
FT                   /product="HicB family protein"
FT                   /note="identified by match to protein family HMM PF05534"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17433"
FT                   /db_xref="GOA:A7ZHY9"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHY9"
FT                   /protein_id="ABV17433.1"
FT                   LIVDVLEREFSAHM"
FT   gene            complement(281569..283308)
FT                   /gene="fhiA"
FT                   /locus_tag="EcE24377A_0263"
FT   CDS_pept        complement(281569..283308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhiA"
FT                   /locus_tag="EcE24377A_0263"
FT                   /product="protein FhiA"
FT                   /note="identified by match to protein family HMM PF00771"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19842"
FT                   /db_xref="GOA:A7ZHZ0"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHZ0"
FT                   /protein_id="ABV19842.1"
FT                   ALS"
FT   gene            283268..284038
FT                   /locus_tag="EcE24377A_0264"
FT   CDS_pept        283268..284038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0264"
FT                   /product="putative chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19197"
FT                   /db_xref="GOA:A7ZHZ1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHZ1"
FT                   /protein_id="ABV19197.1"
FT   gene            284109..285164
FT                   /gene="dinB"
FT                   /locus_tag="EcE24377A_0265"
FT   CDS_pept        284109..285164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="EcE24377A_0265"
FT                   /product="DNA polymerase IV"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:Q47155; match to
FT                   protein family HMM PF00817"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17967"
FT                   /db_xref="GOA:A7ZHZ2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHZ2"
FT                   /protein_id="ABV17967.1"
FT                   PQMERQLVLGL"
FT   gene            285161..285613
FT                   /locus_tag="EcE24377A_0266"
FT   CDS_pept        285161..285613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0266"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19571"
FT                   /db_xref="GOA:A7ZHZ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHZ3"
FT                   /protein_id="ABV19571.1"
FT   gene            285832..286998
FT                   /locus_tag="EcE24377A_0267"
FT   CDS_pept        285832..286998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAG76514.1; match to
FT                   protein family HMM PF01139; match to protein family HMM
FT                   TIGR03073"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18341"
FT                   /db_xref="GOA:A7ZHZ4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR017510"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHZ4"
FT                   /protein_id="ABV18341.1"
FT   gene            286995..287609
FT                   /locus_tag="EcE24377A_0268"
FT   CDS_pept        286995..287609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0268"
FT                   /product="putative peptide chain release factor H"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM TIGR03072"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17779"
FT                   /db_xref="GOA:A7ZHZ5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHZ5"
FT                   /protein_id="ABV17779.1"
FT   gene            complement(287666..289123)
FT                   /gene="pepD"
FT                   /locus_tag="EcE24377A_0269"
FT   CDS_pept        complement(287666..289123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="EcE24377A_0269"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="identified by similarity to SP:P15288; match to
FT                   protein family HMM PF01546; match to protein family HMM
FT                   PF07687; match to protein family HMM TIGR01893"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17237"
FT                   /db_xref="GOA:A7ZHZ6"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZHZ6"
FT                   /protein_id="ABV17237.1"
FT   gene            289384..289842
FT                   /gene="gpt"
FT                   /locus_tag="EcE24377A_0270"
FT   CDS_pept        289384..289842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="EcE24377A_0270"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0A9M5; match to
FT                   protein family HMM PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17281"
FT                   /db_xref="GOA:A7ZHZ7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHZ7"
FT                   /protein_id="ABV17281.1"
FT   gene            289934..291178
FT                   /gene="frsA"
FT                   /locus_tag="EcE24377A_0271"
FT   CDS_pept        289934..291178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="EcE24377A_0271"
FT                   /product="fermentation-respiration switch protein"
FT                   /note="identified by similarity to SP:P04335; match to
FT                   protein family HMM PF06500"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20914"
FT                   /db_xref="GOA:A7ZHZ8"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHZ8"
FT                   /protein_id="ABV20914.1"
FT                   KGLQEITGWIEKRLC"
FT   gene            291236..291637
FT                   /gene="crl"
FT                   /locus_tag="EcE24377A_0272"
FT   CDS_pept        291236..291637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="EcE24377A_0272"
FT                   /product="sigma factor-binding protein Crl"
FT                   /note="identified by match to protein family HMM PF07417"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16827"
FT                   /db_xref="GOA:A7ZHZ9"
FT                   /db_xref="InterPro:IPR009986"
FT                   /db_xref="InterPro:IPR038208"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZHZ9"
FT                   /protein_id="ABV16827.1"
FT   gene            complement(291676..292731)
FT                   /gene="phoE"
FT                   /locus_tag="EcE24377A_0273"
FT   CDS_pept        complement(291676..292731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="EcE24377A_0273"
FT                   /product="outer membrane pore protein E"
FT                   /note="identified by similarity to SP:P02932; match to
FT                   protein family HMM PF00267; match to protein family HMM
FT                   TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19932"
FT                   /db_xref="GOA:A7ZI00"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI00"
FT                   /protein_id="ABV19932.1"
FT                   DIVAVGMTYQF"
FT   gene            293019..294122
FT                   /gene="proB"
FT                   /locus_tag="EcE24377A_0274"
FT   CDS_pept        293019..294122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="EcE24377A_0274"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01472; match to protein
FT                   family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20559"
FT                   /db_xref="GOA:A7ZI01"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI01"
FT                   /protein_id="ABV20559.1"
FT   gene            294134..295387
FT                   /gene="proA"
FT                   /locus_tag="EcE24377A_0275"
FT   CDS_pept        294134..295387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="EcE24377A_0275"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19367"
FT                   /db_xref="GOA:A7ZI02"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI02"
FT                   /protein_id="ABV19367.1"
FT                   EALTTYKWIGIGDYTIRA"
FT   gene            295502..295577
FT                   /locus_tag="EcE24377A_5010"
FT   tRNA            295502..295577
FT                   /locus_tag="EcE24377A_5010"
FT                   /product="tRNA-Thr"
FT   gene            295804..296661
FT                   /locus_tag="EcE24377A_0278"
FT   CDS_pept        295804..296661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17230"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI03"
FT                   /protein_id="ABV17230.1"
FT                   KSKK"
FT   gene            296783..297001
FT                   /locus_tag="EcE24377A_0279"
FT   CDS_pept        296783..297001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0279"
FT                   /product="prophage CP4-57 regulatory protein"
FT                   /note="identified by match to protein family HMM PF05930"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17705"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI04"
FT                   /protein_id="ABV17705.1"
FT   gene            297108..298190
FT                   /locus_tag="EcE24377A_0280"
FT   CDS_pept        297108..298190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16677"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI05"
FT                   /protein_id="ABV16677.1"
FT   gene            298177..298890
FT                   /locus_tag="EcE24377A_0281"
FT   CDS_pept        298177..298890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19934"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI06"
FT                   /protein_id="ABV19934.1"
FT                   FPEGIIDPMLLKPFL"
FT   gene            complement(299412..302654)
FT                   /locus_tag="EcE24377A_0282"
FT   CDS_pept        complement(299412..302654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0282"
FT                   /product="helicase, SNF2 family"
FT                   /note="identified by match to protein family HMM PF00176;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17208"
FT                   /db_xref="GOA:A7ZI07"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI07"
FT                   /protein_id="ABV17208.1"
FT   gene            complement(302654..304357)
FT                   /locus_tag="EcE24377A_0283"
FT   CDS_pept        complement(302654..304357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0283"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16709"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI08"
FT                   /protein_id="ABV16709.1"
FT   gene            complement(304333..305073)
FT                   /locus_tag="EcE24377A_0284"
FT   CDS_pept        complement(304333..305073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0284"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17786"
FT                   /db_xref="GOA:A7ZI09"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI09"
FT                   /protein_id="ABV17786.1"
FT   gene            complement(305087..307306)
FT                   /locus_tag="EcE24377A_0285"
FT   CDS_pept        complement(305087..307306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17222"
FT                   /db_xref="GOA:A7ZI10"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI10"
FT                   /protein_id="ABV17222.1"
FT   gene            307639..309348
FT                   /locus_tag="EcE24377A_0286"
FT   CDS_pept        307639..309348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0286"
FT                   /product="N4/N6-methyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF02384"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19111"
FT                   /db_xref="GOA:A7ZI11"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI11"
FT                   /protein_id="ABV19111.1"
FT   gene            309338..310753
FT                   /locus_tag="EcE24377A_0287"
FT   CDS_pept        309338..310753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0287"
FT                   /product="type I restriction modification DNA specificity
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01420"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18482"
FT                   /db_xref="GOA:A7ZI12"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI12"
FT                   /protein_id="ABV18482.1"
FT                   PEAEQAVSEVENV"
FT   gene            310746..311933
FT                   /locus_tag="EcE24377A_0288"
FT   CDS_pept        310746..311933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAF28525.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19778"
FT                   /db_xref="GOA:A7ZI13"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR025364"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI13"
FT                   /protein_id="ABV19778.1"
FT   gene            311933..315067
FT                   /locus_tag="EcE24377A_0289"
FT   CDS_pept        311933..315067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0289"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="identified by similarity to GB:AAB70710.1; match to
FT                   protein family HMM PF04313; match to protein family HMM
FT                   PF04851; match to protein family HMM TIGR00348"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19256"
FT                   /db_xref="GOA:A7ZI14"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI14"
FT                   /protein_id="ABV19256.1"
FT   gene            315244..318276
FT                   /locus_tag="EcE24377A_0290"
FT   CDS_pept        315244..318276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0290"
FT                   /product="helicase, UvrD family"
FT                   /note="identified by similarity to SP:P15038; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   PF01396"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21103"
FT                   /db_xref="GOA:A7ZI15"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI15"
FT                   /protein_id="ABV21103.1"
FT   gene            318276..319091
FT                   /locus_tag="EcE24377A_0291"
FT   CDS_pept        318276..319091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0291"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17825"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI16"
FT                   /protein_id="ABV17825.1"
FT   gene            complement(319243..320565)
FT                   /locus_tag="EcE24377A_0292"
FT   CDS_pept        complement(319243..320565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0292"
FT                   /product="phage integrase family protein"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17149"
FT                   /db_xref="GOA:A7ZI17"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI17"
FT                   /protein_id="ABV17149.1"
FT   gene            320696..320775
FT                   /pseudo
FT                   /locus_tag="EcE24377A_5011"
FT   tRNA            320696..320775
FT                   /pseudo
FT                   /locus_tag="EcE24377A_5011"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            complement(321291..322247)
FT                   /locus_tag="EcE24377A_0294"
FT   CDS_pept        complement(321291..322247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0294"
FT                   /product="putative xanthine dehydrogenase accessory factor"
FT                   /note="identified by match to protein family HMM PF02625"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16478"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI18"
FT                   /protein_id="ABV16478.1"
FT   gene            complement(322257..324455)
FT                   /locus_tag="EcE24377A_0295"
FT   CDS_pept        complement(322257..324455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0295"
FT                   /product="xanthine dehydrogenase family protein,
FT                   molybdopterin-binding subunit"
FT                   /note="identified by match to protein family HMM PF01315;
FT                   match to protein family HMM PF02738"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18623"
FT                   /db_xref="GOA:A7ZI19"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI19"
FT                   /protein_id="ABV18623.1"
FT   gene            complement(324452..325408)
FT                   /locus_tag="EcE24377A_0296"
FT   CDS_pept        complement(324452..325408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0296"
FT                   /product="FAD binding domain in molybdopterin
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00941"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17811"
FT                   /db_xref="GOA:A7ZI20"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI20"
FT                   /protein_id="ABV17811.1"
FT   gene            complement(325405..326094)
FT                   /locus_tag="EcE24377A_0297"
FT   CDS_pept        complement(325405..326094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0297"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF01799; match to protein
FT                   family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19938"
FT                   /db_xref="GOA:A7ZI21"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI21"
FT                   /protein_id="ABV19938.1"
FT                   AAGEIKS"
FT   gene            326512..327126
FT                   /locus_tag="EcE24377A_0298"
FT   CDS_pept        326512..327126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07274"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19168"
FT                   /db_xref="GOA:A7ZI22"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI22"
FT                   /protein_id="ABV19168.1"
FT   gene            complement(328011..328721)
FT                   /locus_tag="EcE24377A_0299"
FT   CDS_pept        complement(328011..328721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20087"
FT                   /db_xref="GOA:A7ZI23"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI23"
FT                   /protein_id="ABV20087.1"
FT                   KISDSCPAKPPSAD"
FT   gene            complement(328690..330333)
FT                   /locus_tag="EcE24377A_0300"
FT   CDS_pept        complement(328690..330333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20508"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI24"
FT                   /protein_id="ABV20508.1"
FT   gene            complement(330323..332848)
FT                   /locus_tag="EcE24377A_0301"
FT   CDS_pept        complement(330323..332848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16647"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI25"
FT                   /protein_id="ABV16647.1"
FT   gene            complement(332874..333542)
FT                   /locus_tag="EcE24377A_0302"
FT   CDS_pept        complement(332874..333542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN78884.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20964"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI26"
FT                   /protein_id="ABV20964.1"
FT                   "
FT   gene            complement(333600..334187)
FT                   /gene="matB"
FT                   /locus_tag="EcE24377A_0303"
FT   CDS_pept        complement(333600..334187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="EcE24377A_0303"
FT                   /product="fimbrillin MatB"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17389"
FT                   /db_xref="GOA:A7ZI27"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI27"
FT                   /protein_id="ABV17389.1"
FT   gene            complement(334262..334852)
FT                   /gene="matA"
FT                   /locus_tag="EcE24377A_0304"
FT   CDS_pept        complement(334262..334852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matA"
FT                   /locus_tag="EcE24377A_0304"
FT                   /product="fimbrillin MatA"
FT                   /note="identified by match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17890"
FT                   /db_xref="GOA:A7ZI28"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI28"
FT                   /protein_id="ABV17890.1"
FT   gene            complement(335050..335145)
FT                   /locus_tag="EcE24377A_0305"
FT   CDS_pept        complement(335050..335145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0305"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18475"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI29"
FT                   /protein_id="ABV18475.1"
FT                   /translation="MQVRIERYIANNLMKPNVFFFLSKKQYFQFF"
FT   gene            complement(335889..336029)
FT                   /gene="rpmJ2"
FT                   /locus_tag="EcE24377A_0306"
FT   CDS_pept        complement(335889..336029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ2"
FT                   /locus_tag="EcE24377A_0306"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18981"
FT                   /db_xref="GOA:A7ZI30"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI30"
FT                   /protein_id="ABV18981.1"
FT                   R"
FT   gene            complement(336029..336295)
FT                   /gene="rpmE1"
FT                   /locus_tag="EcE24377A_0307"
FT   CDS_pept        complement(336029..336295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE1"
FT                   /locus_tag="EcE24377A_0307"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20108"
FT                   /db_xref="GOA:A7ZI31"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI31"
FT                   /protein_id="ABV20108.1"
FT   gene            336456..336548
FT                   /locus_tag="EcE24377A_0308"
FT   CDS_pept        336456..336548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0308"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20579"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI32"
FT                   /protein_id="ABV20579.1"
FT                   /translation="MIDDGFAESMDFSRMEVISTLLADDLSQYD"
FT   gene            complement(336656..336757)
FT                   /locus_tag="EcE24377A_0309"
FT   CDS_pept        complement(336656..336757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0309"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21099"
FT                   /db_xref="GOA:A7ZI33"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI33"
FT                   /protein_id="ABV21099.1"
FT   gene            336725..336838
FT                   /locus_tag="EcE24377A_0310"
FT   CDS_pept        336725..336838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0310"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16830"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI34"
FT                   /protein_id="ABV16830.1"
FT   gene            complement(337864..337974)
FT                   /locus_tag="EcE24377A_0311"
FT   CDS_pept        complement(337864..337974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0311"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18083"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI35"
FT                   /protein_id="ABV18083.1"
FT   gene            337935..342125
FT                   /locus_tag="EcE24377A_0312"
FT   CDS_pept        337935..342125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0312"
FT                   /product="EaeH"
FT                   /note="identified by similarity to SP:P36943; match to
FT                   protein family HMM PF02369"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18209"
FT                   /db_xref="GOA:A7ZI36"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003535"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR024519"
FT                   /db_xref="InterPro:IPR038177"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI36"
FT                   /protein_id="ABV18209.1"
FT   gene            complement(342246..343103)
FT                   /locus_tag="EcE24377A_0313"
FT   CDS_pept        complement(342246..343103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0313"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF06445"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18197"
FT                   /db_xref="GOA:A7ZI37"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI37"
FT                   /protein_id="ABV18197.1"
FT                   VRPV"
FT   gene            343352..344221
FT                   /locus_tag="EcE24377A_0314"
FT   CDS_pept        343352..344221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0314"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18723"
FT                   /db_xref="GOA:A7ZI38"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI38"
FT                   /protein_id="ABV18723.1"
FT                   CLAVKIHD"
FT   gene            complement(344381..344974)
FT                   /locus_tag="EcE24377A_0315"
FT   CDS_pept        complement(344381..344974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0315"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04224"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18896"
FT                   /db_xref="GOA:A7ZI39"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI39"
FT                   /protein_id="ABV18896.1"
FT   gene            344957..345226
FT                   /locus_tag="EcE24377A_0317"
FT   CDS_pept        344957..345226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0317"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20833"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI40"
FT                   /protein_id="ABV20833.1"
FT   gene            complement(344986..345222)
FT                   /locus_tag="EcE24377A_0316"
FT   CDS_pept        complement(344986..345222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19709"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI41"
FT                   /protein_id="ABV19709.1"
FT   gene            complement(345331..346656)
FT                   /locus_tag="EcE24377A_0318"
FT   CDS_pept        complement(345331..346656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0318"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17472"
FT                   /db_xref="GOA:A7ZI42"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI42"
FT                   /protein_id="ABV17472.1"
FT   gene            346736..346828
FT                   /locus_tag="EcE24377A_0319"
FT   CDS_pept        346736..346828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18189"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI43"
FT                   /protein_id="ABV18189.1"
FT                   /translation="MIFCLIVWYFLFLNQNHKTKIMINHLMVLD"
FT   gene            346882..347736
FT                   /locus_tag="EcE24377A_0320"
FT   CDS_pept        346882..347736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0320"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18736"
FT                   /db_xref="GOA:A7ZI44"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI44"
FT                   /protein_id="ABV18736.1"
FT                   LAP"
FT   gene            348263..348982
FT                   /locus_tag="EcE24377A_0321"
FT   CDS_pept        348263..348982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0321"
FT                   /product="cysteine-rich domain protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18731"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI45"
FT                   /protein_id="ABV18731.1"
FT                   EGQKVKVMHIAEVLMSR"
FT   gene            348993..350420
FT                   /locus_tag="EcE24377A_0322"
FT   CDS_pept        348993..350420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0322"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF02589;
FT                   match to protein family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20930"
FT                   /db_xref="GOA:A7ZI46"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI46"
FT                   /protein_id="ABV20930.1"
FT                   SFRSWFKKHQAQEKKNG"
FT   gene            350413..351108
FT                   /locus_tag="EcE24377A_0323"
FT   CDS_pept        350413..351108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAP15803.1; match to
FT                   protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20728"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI47"
FT                   /protein_id="ABV20728.1"
FT                   AVYLIIEDC"
FT   gene            complement(351182..351379)
FT                   /locus_tag="EcE24377A_0324"
FT   CDS_pept        complement(351182..351379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0324"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19412"
FT                   /db_xref="GOA:A7ZI48"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI48"
FT                   /protein_id="ABV19412.1"
FT   gene            complement(351351..352019)
FT                   /locus_tag="EcE24377A_0325"
FT   CDS_pept        complement(351351..352019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAD02590.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17305"
FT                   /db_xref="GOA:A7ZI49"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI49"
FT                   /protein_id="ABV17305.1"
FT                   "
FT   gene            complement(352232..353902)
FT                   /gene="betA"
FT                   /locus_tag="EcE24377A_0326"
FT   CDS_pept        complement(352232..353902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="EcE24377A_0326"
FT                   /product="choline dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00732;
FT                   match to protein family HMM PF05199; match to protein
FT                   family HMM TIGR01810"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20254"
FT                   /db_xref="GOA:A7ZI50"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI50"
FT                   /protein_id="ABV20254.1"
FT   gene            complement(353916..355388)
FT                   /gene="betB"
FT                   /locus_tag="EcE24377A_0327"
FT   CDS_pept        complement(353916..355388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="EcE24377A_0327"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01804"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18550"
FT                   /db_xref="GOA:A7ZI51"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI51"
FT                   /protein_id="ABV18550.1"
FT   gene            complement(355402..355989)
FT                   /gene="betI"
FT                   /locus_tag="EcE24377A_0328"
FT   CDS_pept        complement(355402..355989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="EcE24377A_0328"
FT                   /product="transcriptional repressor BetI"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM TIGR03384"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17388"
FT                   /db_xref="GOA:A7ZI52"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI52"
FT                   /protein_id="ABV17388.1"
FT   gene            356127..356402
FT                   /locus_tag="EcE24377A_0329"
FT   CDS_pept        356127..356402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0329"
FT                   /product="IS1, transposase orfA"
FT                   /note="identified by match to protein family HMM PF03811"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18120"
FT                   /db_xref="GOA:A7ZGQ4"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZGQ4"
FT                   /protein_id="ABV18120.1"
FT   gene            356321..356824
FT                   /locus_tag="EcE24377A_0330"
FT   CDS_pept        356321..356824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0330"
FT                   /product="IS1, transposase orfB"
FT                   /note="identified by match to protein family HMM PF03400"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18792"
FT                   /db_xref="GOA:A7ZGQ5"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZGQ5"
FT                   /protein_id="ABV18792.1"
FT                   KHYQ"
FT   gene            356894..358927
FT                   /gene="betT"
FT                   /locus_tag="EcE24377A_0331"
FT   CDS_pept        356894..358927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="EcE24377A_0331"
FT                   /product="transporter, betaine/carnitine/choline
FT                   transporter (BCCT) family"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20482"
FT                   /db_xref="GOA:A7ZI55"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI55"
FT                   /protein_id="ABV20482.1"
FT   gene            359500..363483
FT                   /locus_tag="EcE24377A_0332"
FT   CDS_pept        359500..363483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0332"
FT                   /product="putative outer membrane autotransporter"
FT                   /note="identified by match to protein family HMM PF03212;
FT                   match to protein family HMM PF03797; match to protein
FT                   family HMM TIGR01414; match to protein family HMM
FT                   TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19995"
FT                   /db_xref="GOA:A7ZI56"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI56"
FT                   /protein_id="ABV19995.1"
FT   gene            363625..364713
FT                   /locus_tag="EcE24377A_0333"
FT   CDS_pept        363625..364713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0333"
FT                   /product="LuxR-family transcriptional regulator/cyclic
FT                   diguanylate phosphodiesterase (EAL) domain protein"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19759"
FT                   /db_xref="GOA:A7ZI57"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI57"
FT                   /protein_id="ABV19759.1"
FT   gene            complement(364755..365687)
FT                   /locus_tag="EcE24377A_0334"
FT   CDS_pept        complement(364755..365687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0334"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18042"
FT                   /db_xref="GOA:A7ZI58"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI58"
FT                   /protein_id="ABV18042.1"
FT   gene            complement(365779..366276)
FT                   /locus_tag="EcE24377A_0335"
FT   CDS_pept        complement(365779..366276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P77219; match to
FT                   protein family HMM PF06496"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20967"
FT                   /db_xref="GOA:A7ZI59"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI59"
FT                   /protein_id="ABV20967.1"
FT                   GY"
FT   gene            366353..366586
FT                   /locus_tag="EcE24377A_0336"
FT   CDS_pept        366353..366586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN78919.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19122"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI60"
FT                   /protein_id="ABV19122.1"
FT   gene            366534..367139
FT                   /locus_tag="EcE24377A_0337"
FT   CDS_pept        366534..367139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0337"
FT                   /product="ankyrin repeat protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17537"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI61"
FT                   /protein_id="ABV17537.1"
FT   gene            367179..368042
FT                   /locus_tag="EcE24377A_0338"
FT   CDS_pept        367179..368042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ87092.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20436"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI62"
FT                   /protein_id="ABV20436.1"
FT                   GGNYVS"
FT   gene            368032..369579
FT                   /locus_tag="EcE24377A_0339"
FT   CDS_pept        368032..369579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0339"
FT                   /product="bacterial FdrA protein"
FT                   /note="identified by match to protein family HMM PF06263"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16538"
FT                   /db_xref="GOA:A7ZI63"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI63"
FT                   /protein_id="ABV16538.1"
FT   gene            369579..370997
FT                   /locus_tag="EcE24377A_0340"
FT   CDS_pept        369579..370997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06545"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17065"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI64"
FT                   /protein_id="ABV17065.1"
FT                   FEKAILGWCERYGV"
FT   gene            371140..372090
FT                   /locus_tag="EcE24377A_0341"
FT   CDS_pept        371140..372090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0341"
FT                   /product="carbamate kinase family protein"
FT                   /note="yahI; identified by match to protein family HMM
FT                   PF00696"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19004"
FT                   /db_xref="GOA:A7ZI65"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI65"
FT                   /protein_id="ABV19004.1"
FT   gene            372238..373482
FT                   /locus_tag="EcE24377A_0342"
FT   CDS_pept        372238..373482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0342"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17423"
FT                   /db_xref="GOA:A7ZI66"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI66"
FT                   /protein_id="ABV17423.1"
FT                   ATFHKGQLVWGSVAG"
FT   gene            373751..374191
FT                   /locus_tag="EcE24377A_0343"
FT   CDS_pept        373751..374191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06171"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19152"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI67"
FT                   /protein_id="ABV19152.1"
FT   gene            complement(374219..374320)
FT                   /locus_tag="EcE24377A_0344"
FT   CDS_pept        complement(374219..374320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0344"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21202"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI68"
FT                   /protein_id="ABV21202.1"
FT   gene            374445..375428
FT                   /locus_tag="EcE24377A_0345"
FT   CDS_pept        374445..375428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0345"
FT                   /product="sugar ABC transporter, periplasmic sugar-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18289"
FT                   /db_xref="GOA:A7ZI69"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI69"
FT                   /protein_id="ABV18289.1"
FT   gene            375477..376961
FT                   /locus_tag="EcE24377A_0346"
FT   CDS_pept        375477..376961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0346"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17756"
FT                   /db_xref="GOA:A7ZI70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI70"
FT                   /protein_id="ABV17756.1"
FT   gene            376954..377925
FT                   /locus_tag="EcE24377A_0347"
FT   CDS_pept        376954..377925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0347"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18506"
FT                   /db_xref="GOA:A7ZI71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI71"
FT                   /protein_id="ABV18506.1"
FT   gene            377922..378878
FT                   /locus_tag="EcE24377A_0348"
FT   CDS_pept        377922..378878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0348"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17783"
FT                   /db_xref="GOA:A7ZI72"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI72"
FT                   /protein_id="ABV17783.1"
FT   gene            378965..380014
FT                   /locus_tag="EcE24377A_0349"
FT   CDS_pept        378965..380014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0349"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17425"
FT                   /db_xref="GOA:A7ZI73"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI73"
FT                   /protein_id="ABV17425.1"
FT                   VIDNRTLTD"
FT   gene            380257..381072
FT                   /locus_tag="EcE24377A_0350"
FT   CDS_pept        380257..381072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ87085.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16732"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI74"
FT                   /protein_id="ABV16732.1"
FT   gene            381414..381494
FT                   /pseudo
FT                   /locus_tag="EcE24377A_5012"
FT   tRNA            381414..381494
FT                   /pseudo
FT                   /locus_tag="EcE24377A_5012"
FT                   /product="tRNA-OTHER"
FT                   /note="tRNA-Pseudo"
FT   gene            complement(381746..382393)
FT                   /locus_tag="EcE24377A_0352"
FT   CDS_pept        complement(381746..382393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0352"
FT                   /product="putative homoserine/threonine efflux protein"
FT                   /note="yahN; identified by match to protein family HMM
FT                   PF01810; match to protein family HMM TIGR00949"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21150"
FT                   /db_xref="GOA:A7ZI75"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI75"
FT                   /protein_id="ABV21150.1"
FT   gene            382564..382839
FT                   /locus_tag="EcE24377A_0353"
FT   CDS_pept        382564..382839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07338"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17946"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI76"
FT                   /protein_id="ABV17946.1"
FT   gene            complement(382937..384523)
FT                   /gene="prpR"
FT                   /locus_tag="EcE24377A_0354"
FT   CDS_pept        complement(382937..384523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="EcE24377A_0354"
FT                   /product="propionate catabolism operon regulatory protein
FT                   PrpR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF06506; match to protein family HMM TIGR02329"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21062"
FT                   /db_xref="GOA:A7ZI77"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR012704"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI77"
FT                   /protein_id="ABV21062.1"
FT                   SRTTFWRRLKS"
FT   gene            384584..384682
FT                   /locus_tag="EcE24377A_0355"
FT   CDS_pept        384584..384682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0355"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20347"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI78"
FT                   /protein_id="ABV20347.1"
FT                   /translation="MKRGETLPETLTETHICGLVHDVISNKLKLNI"
FT   gene            384761..385651
FT                   /gene="prpB"
FT                   /locus_tag="EcE24377A_0356"
FT   CDS_pept        384761..385651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="EcE24377A_0356"
FT                   /product="methylisocitrate lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR02317"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19969"
FT                   /db_xref="GOA:A7ZI79"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI79"
FT                   /protein_id="ABV19969.1"
FT                   YEAKLDDLFARSQVK"
FT   gene            385696..386865
FT                   /gene="prpC"
FT                   /locus_tag="EcE24377A_0357"
FT   CDS_pept        385696..386865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="EcE24377A_0357"
FT                   /product="2-methylcitrate synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P31660; match to
FT                   protein family HMM PF00285; match to protein family HMM
FT                   TIGR01800"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19317"
FT                   /db_xref="GOA:A7ZI80"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI80"
FT                   /protein_id="ABV19317.1"
FT   gene            386899..388350
FT                   /gene="prpD"
FT                   /locus_tag="EcE24377A_0358"
FT   CDS_pept        386899..388350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="EcE24377A_0358"
FT                   /product="2-methylcitrate dehydratase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF03972;
FT                   match to protein family HMM TIGR02330"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20000"
FT                   /db_xref="GOA:A7ZI81"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI81"
FT                   /protein_id="ABV20000.1"
FT   gene            388390..390276
FT                   /gene="prpE"
FT                   /locus_tag="EcE24377A_0359"
FT   CDS_pept        388390..390276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="EcE24377A_0359"
FT                   /product="propionate--CoA ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02316"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19340"
FT                   /db_xref="GOA:A7ZI82"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI82"
FT                   /protein_id="ABV19340.1"
FT   gene            390513..391772
FT                   /gene="codB"
FT                   /locus_tag="EcE24377A_0360"
FT   CDS_pept        390513..391772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="EcE24377A_0360"
FT                   /product="cytosine permease"
FT                   /note="identified by match to protein family HMM PF02133;
FT                   match to protein family HMM TIGR00800"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18404"
FT                   /db_xref="GOA:A7ZI83"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI83"
FT                   /protein_id="ABV18404.1"
FT   gene            391762..393045
FT                   /gene="codA"
FT                   /locus_tag="EcE24377A_0361"
FT   CDS_pept        391762..393045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="EcE24377A_0361"
FT                   /product="cytosine deaminase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P25524; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17899"
FT                   /db_xref="GOA:A7ZI84"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI84"
FT                   /protein_id="ABV17899.1"
FT   gene            complement(393085..393984)
FT                   /gene="cynR"
FT                   /locus_tag="EcE24377A_0362"
FT   CDS_pept        complement(393085..393984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="EcE24377A_0362"
FT                   /product="transcriptional regulator cynR"
FT                   /note="identified by similarity to SP:P27111; match to
FT                   protein family HMM PF00126; match to protein family HMM
FT                   PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17320"
FT                   /db_xref="GOA:A7ZI85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037403"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI85"
FT                   /protein_id="ABV17320.1"
FT                   FLHMALEECADVGENESR"
FT   gene            393907..394002
FT                   /locus_tag="EcE24377A_0363"
FT   CDS_pept        393907..394002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0363"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16787"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI86"
FT                   /protein_id="ABV16787.1"
FT                   /translation="MQRTGGTGEAAMFSHGKKIIDMSREHSPTYK"
FT   gene            394094..394753
FT                   /gene="cynT"
FT                   /locus_tag="EcE24377A_0364"
FT   CDS_pept        394094..394753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="EcE24377A_0364"
FT                   /product="carbonic anhydrase"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18814"
FT                   /db_xref="GOA:A7ZI87"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI87"
FT                   /protein_id="ABV18814.1"
FT   gene            394784..395254
FT                   /gene="cynS"
FT                   /locus_tag="EcE24377A_0365"
FT   CDS_pept        394784..395254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="EcE24377A_0365"
FT                   /product="cyanate hydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00816; match to
FT                   protein family HMM PF02560; match to protein family HMM
FT                   TIGR00673"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19490"
FT                   /db_xref="GOA:A7ZI88"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI88"
FT                   /protein_id="ABV19490.1"
FT   gene            395287..396441
FT                   /gene="cynX"
FT                   /locus_tag="EcE24377A_0366"
FT   CDS_pept        395287..396441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="EcE24377A_0366"
FT                   /product="cyanate transport protein CynX"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00896"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17453"
FT                   /db_xref="GOA:A7ZI89"
FT                   /db_xref="InterPro:IPR004747"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI89"
FT                   /protein_id="ABV17453.1"
FT   gene            complement(396520..397773)
FT                   /gene="lacY"
FT                   /locus_tag="EcE24377A_0367"
FT   CDS_pept        complement(396520..397773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="EcE24377A_0367"
FT                   /product="lactose permease"
FT                   /note="identified by match to protein family HMM PF01306;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00882"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18153"
FT                   /db_xref="GOA:A7ZI90"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR018457"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI90"
FT                   /protein_id="ABV18153.1"
FT                   LSGPGPLSLLRRQVNEVA"
FT   gene            complement(397825..400899)
FT                   /gene="lacZ"
FT                   /locus_tag="EcE24377A_0368"
FT   CDS_pept        complement(397825..400899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="EcE24377A_0368"
FT                   /product="beta-galactosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00722; match to
FT                   protein family HMM PF00703; match to protein family HMM
FT                   PF02836; match to protein family HMM PF02837; match to
FT                   protein family HMM PF02929"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16715"
FT                   /db_xref="GOA:A7ZI91"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI91"
FT                   /protein_id="ABV16715.1"
FT   gene            complement(401022..402113)
FT                   /gene="lacI"
FT                   /locus_tag="EcE24377A_0369"
FT   CDS_pept        complement(401022..402113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="EcE24377A_0369"
FT                   /product="lactose operon repressor"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17381"
FT                   /db_xref="GOA:A7ZI92"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI92"
FT                   /protein_id="ABV17381.1"
FT   gene            complement(402181..403128)
FT                   /gene="mhpR"
FT                   /locus_tag="EcE24377A_0370"
FT   CDS_pept        complement(402181..403128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="EcE24377A_0370"
FT                   /product="Mhp operon transcriptional activator"
FT                   /note="identified by similarity to SP:P77569; match to
FT                   protein family HMM PF01614; match to protein family HMM
FT                   PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20160"
FT                   /db_xref="GOA:A7ZI93"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZI93"
FT                   /protein_id="ABV20160.1"
FT   gene            403205..404869
FT                   /gene="mhpA"
FT                   /locus_tag="EcE24377A_0371"
FT   CDS_pept        403205..404869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="EcE24377A_0371"
FT                   /product="3-(3-hydroxy-phenyl)propionate hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by similarity to SP:P77397; match to
FT                   protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20772"
FT                   /db_xref="GOA:A7ZI94"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR023786"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI94"
FT                   /protein_id="ABV20772.1"
FT   gene            404871..405815
FT                   /gene="mhpB"
FT                   /locus_tag="EcE24377A_0372"
FT   CDS_pept        404871..405815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="EcE24377A_0372"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.-"
FT                   /note="identified by similarity to SP:P0ABR9; match to
FT                   protein family HMM PF02900"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19400"
FT                   /db_xref="GOA:A7ZI95"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI95"
FT                   /protein_id="ABV19400.1"
FT   gene            405818..406699
FT                   /gene="mhpC"
FT                   /locus_tag="EcE24377A_0373"
FT   CDS_pept        405818..406699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="EcE24377A_0373"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedioic acid
FT                   hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /note="identified by similarity to SP:P77044; match to
FT                   protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17339"
FT                   /db_xref="GOA:A7ZI96"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR023791"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI96"
FT                   /protein_id="ABV17339.1"
FT                   FNQLVLNFLARP"
FT   gene            406709..407518
FT                   /gene="mhpD"
FT                   /locus_tag="EcE24377A_0374"
FT   CDS_pept        406709..407518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="EcE24377A_0374"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by similarity to SP:P77608; match to
FT                   protein family HMM PF01689"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17981"
FT                   /db_xref="GOA:A7ZI97"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR023793"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI97"
FT                   /protein_id="ABV17981.1"
FT   gene            407515..408465
FT                   /gene="mhpF"
FT                   /locus_tag="EcE24377A_0375"
FT   CDS_pept        407515..408465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="EcE24377A_0375"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF09290; match to protein
FT                   family HMM TIGR03215"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17887"
FT                   /db_xref="GOA:A7ZI98"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI98"
FT                   /protein_id="ABV17887.1"
FT   gene            408462..409475
FT                   /gene="mhpE"
FT                   /locus_tag="EcE24377A_0376"
FT   CDS_pept        408462..409475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="EcE24377A_0376"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.3.-"
FT                   /note="identified by similarity to SP:P51020; match to
FT                   protein family HMM PF00682; match to protein family HMM
FT                   PF07836; match to protein family HMM TIGR03217"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16944"
FT                   /db_xref="GOA:A7ZI99"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZI99"
FT                   /protein_id="ABV16944.1"
FT   gene            409651..410862
FT                   /locus_tag="EcE24377A_0377"
FT   CDS_pept        409651..410862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0377"
FT                   /product="putative 3-hydroxyphenylpropionic acid
FT                   transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00895"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17440"
FT                   /db_xref="GOA:A7ZIA0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA0"
FT                   /protein_id="ABV17440.1"
FT                   CADA"
FT   gene            410964..411503
FT                   /locus_tag="EcE24377A_0378"
FT   CDS_pept        410964..411503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20081"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA1"
FT                   /protein_id="ABV20081.1"
FT                   EDDPYADFKVPDDLMW"
FT   gene            411525..411632
FT                   /locus_tag="EcE24377A_0379"
FT   CDS_pept        411525..411632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0379"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21204"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA2"
FT                   /protein_id="ABV21204.1"
FT   gene            complement(411729..412562)
FT                   /gene="fghA1"
FT                   /locus_tag="EcE24377A_0380"
FT   CDS_pept        complement(411729..412562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fghA1"
FT                   /locus_tag="EcE24377A_0380"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00756;
FT                   match to protein family HMM TIGR02821"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18859"
FT                   /db_xref="GOA:A7ZIA3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIA3"
FT                   /protein_id="ABV18859.1"
FT   gene            complement(412655..413764)
FT                   /locus_tag="EcE24377A_0381"
FT   CDS_pept        complement(412655..413764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0381"
FT                   /product="alcohol dehydrogenase class III"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240; match to protein
FT                   family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17265"
FT                   /db_xref="GOA:A7ZIA4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIA4"
FT                   /protein_id="ABV17265.1"
FT   gene            complement(413799..414074)
FT                   /locus_tag="EcE24377A_0382"
FT   CDS_pept        complement(413799..414074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P15753; match to
FT                   protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20643"
FT                   /db_xref="GOA:A7ZIA5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIA5"
FT                   /protein_id="ABV20643.1"
FT   gene            complement(414260..415033)
FT                   /locus_tag="EcE24377A_0383"
FT   CDS_pept        complement(414260..415033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0383"
FT                   /product="hypothetical protein"
FT                   /note="yaiO; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18335"
FT                   /db_xref="InterPro:IPR016504"
FT                   /db_xref="InterPro:IPR030887"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA6"
FT                   /protein_id="ABV18335.1"
FT   gene            complement(415035..415475)
FT                   /locus_tag="EcE24377A_0384"
FT   CDS_pept        complement(415035..415475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0384"
FT                   /product="putative acyltransferase"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19146"
FT                   /db_xref="GOA:A7ZIA7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA7"
FT                   /protein_id="ABV19146.1"
FT   gene            complement(415594..416790)
FT                   /locus_tag="EcE24377A_0385"
FT   CDS_pept        complement(415594..416790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0385"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="yaiP; identified by match to protein family HMM
FT                   PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17267"
FT                   /db_xref="GOA:A7ZIA8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA8"
FT                   /protein_id="ABV17267.1"
FT   gene            complement(416800..417471)
FT                   /locus_tag="EcE24377A_0386"
FT   CDS_pept        complement(416800..417471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0386"
FT                   /product="putative GlcNAc-PI de-N-acetylase"
FT                   /note="yaiS; identified by match to protein family HMM
FT                   PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18115"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIA9"
FT                   /protein_id="ABV18115.1"
FT                   L"
FT   gene            417643..417750
FT                   /locus_tag="EcE24377A_0387"
FT   CDS_pept        417643..417750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20454"
FT                   /db_xref="GOA:A7ZIB0"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB0"
FT                   /protein_id="ABV20454.1"
FT   gene            complement(417909..418133)
FT                   /locus_tag="EcE24377A_0388"
FT   CDS_pept        complement(417909..418133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20975"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB1"
FT                   /protein_id="ABV20975.1"
FT   gene            418087..419049
FT                   /gene="tauA"
FT                   /locus_tag="EcE24377A_0389"
FT   CDS_pept        418087..419049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="EcE24377A_0389"
FT                   /product="taurine ABC transporter, periplasmic
FT                   taurine-binding protein"
FT                   /note="identified by match to protein family HMM PF04069;
FT                   match to protein family HMM TIGR01729"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19564"
FT                   /db_xref="GOA:A7ZIB2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB2"
FT                   /protein_id="ABV19564.1"
FT   gene            419062..419828
FT                   /pseudo
FT                   /gene="tauB"
FT                   /locus_tag="EcE24377A_0390"
FT                   /note="taurine ABC transporter, ATP-binding protein,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   similarity to SP:Q47538; match to protein family HMM
FT                   PF00005"
FT   gene            419825..420652
FT                   /gene="tauC"
FT                   /locus_tag="EcE24377A_0391"
FT   CDS_pept        419825..420652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="EcE24377A_0391"
FT                   /product="taurine uptake ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19302"
FT                   /db_xref="GOA:A7ZIB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB3"
FT                   /protein_id="ABV19302.1"
FT   gene            420649..421500
FT                   /gene="tauD"
FT                   /locus_tag="EcE24377A_0392"
FT   CDS_pept        420649..421500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="EcE24377A_0392"
FT                   /product="taurine dioxygenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P37610; match to
FT                   protein family HMM PF02668"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18165"
FT                   /db_xref="GOA:A7ZIB4"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB4"
FT                   /protein_id="ABV18165.1"
FT                   AG"
FT   gene            complement(421658..422632)
FT                   /gene="hemB"
FT                   /locus_tag="EcE24377A_0393"
FT   CDS_pept        complement(421658..422632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="EcE24377A_0393"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0ACB3; match to
FT                   protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18599"
FT                   /db_xref="GOA:A7ZIB5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB5"
FT                   /protein_id="ABV18599.1"
FT   gene            complement(423338..424243)
FT                   /locus_tag="EcE24377A_0394"
FT   CDS_pept        complement(423338..424243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0394"
FT                   /product="IS2, transposase orfB"
FT                   /note="identified by similarity to SP:P19777; match to
FT                   protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16820"
FT                   /db_xref="GOA:A7ZGY0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZGY0"
FT                   /protein_id="ABV16820.1"
FT   gene            complement(424201..424566)
FT                   /locus_tag="EcE24377A_0395"
FT   CDS_pept        complement(424201..424566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0395"
FT                   /product="IS2, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16607"
FT                   /db_xref="GOA:A7ZGR1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZGR1"
FT                   /protein_id="ABV16607.1"
FT                   RAKKWIAHAPLLPGDGE"
FT   gene            424630..427398
FT                   /locus_tag="EcE24377A_0396"
FT   CDS_pept        424630..427398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0396"
FT                   /product="outer membrane autotransporter"
FT                   /note="identified by match to protein family HMM PF03797;
FT                   match to protein family HMM TIGR01414; match to protein
FT                   family HMM TIGR03304"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19053"
FT                   /db_xref="GOA:A7ZIB8"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB8"
FT                   /protein_id="ABV19053.1"
FT   gene            427486..428109
FT                   /locus_tag="EcE24377A_0397"
FT   CDS_pept        427486..428109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P0AAP5"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20445"
FT                   /db_xref="GOA:A7ZIB9"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR034719"
FT                   /db_xref="InterPro:IPR041687"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIB9"
FT                   /protein_id="ABV20445.1"
FT   gene            complement(428110..429267)
FT                   /gene="ampH"
FT                   /locus_tag="EcE24377A_0398"
FT   CDS_pept        complement(428110..429267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="EcE24377A_0398"
FT                   /product="penicillin-binding protein AmpH"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18612"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC0"
FT                   /protein_id="ABV18612.1"
FT   gene            complement(429313..429414)
FT                   /locus_tag="EcE24377A_0399"
FT   CDS_pept        complement(429313..429414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0399"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19399"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC1"
FT                   /protein_id="ABV19399.1"
FT   gene            429405..429599
FT                   /locus_tag="EcE24377A_0400"
FT   CDS_pept        429405..429599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17016"
FT                   /db_xref="GOA:A7ZIC2"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC2"
FT                   /protein_id="ABV17016.1"
FT   gene            429619..430839
FT                   /gene="smbA"
FT                   /locus_tag="EcE24377A_0401"
FT   CDS_pept        429619..430839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smbA"
FT                   /locus_tag="EcE24377A_0401"
FT                   /product="protein SbmA"
FT                   /note="identified by similarity to SP:P0AFY6; match to
FT                   protein family HMM PF05992"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18193"
FT                   /db_xref="GOA:A7ZIC3"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC3"
FT                   /protein_id="ABV18193.1"
FT                   EVTHTLS"
FT   gene            430852..431946
FT                   /locus_tag="EcE24377A_0402"
FT   CDS_pept        430852..431946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0402"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07759"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19047"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC4"
FT                   /protein_id="ABV19047.1"
FT   gene            complement(431947..432051)
FT                   /locus_tag="EcE24377A_0403"
FT   CDS_pept        complement(431947..432051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0403"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20723"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC5"
FT                   /protein_id="ABV20723.1"
FT   gene            complement(432005..432313)
FT                   /locus_tag="EcE24377A_0404"
FT   CDS_pept        complement(432005..432313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0404"
FT                   /product="putative membrane protein"
FT                   /note="identified by similarity to SP:P0AAP7"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20362"
FT                   /db_xref="GOA:A7ZIC6"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC6"
FT                   /protein_id="ABV20362.1"
FT   gene            432441..432785
FT                   /locus_tag="EcE24377A_0405"
FT   CDS_pept        432441..432785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ87131.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16623"
FT                   /db_xref="GOA:A7ZIC7"
FT                   /db_xref="InterPro:IPR020490"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC7"
FT                   /protein_id="ABV16623.1"
FT                   RRDEETENAQ"
FT   gene            complement(432809..433903)
FT                   /gene="ddlA"
FT                   /locus_tag="EcE24377A_0406"
FT   CDS_pept        complement(432809..433903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="EcE24377A_0406"
FT                   /product="D-alanine--D-alanine ligase A"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0A6J8; match to
FT                   protein family HMM PF01820; match to protein family HMM
FT                   PF02222; match to protein family HMM PF07478; match to
FT                   protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16774"
FT                   /db_xref="GOA:A7ZIC8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC8"
FT                   /protein_id="ABV16774.1"
FT   gene            433984..434184
FT                   /locus_tag="EcE24377A_0407"
FT   CDS_pept        433984..434184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16927"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIC9"
FT                   /protein_id="ABV16927.1"
FT   gene            434207..434320
FT                   /locus_tag="EcE24377A_0408"
FT   CDS_pept        434207..434320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0408"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18708"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID0"
FT                   /protein_id="ABV18708.1"
FT   gene            434366..434626
FT                   /locus_tag="EcE24377A_0409"
FT   CDS_pept        434366..434626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19474"
FT                   /db_xref="GOA:A7ZID1"
FT                   /db_xref="InterPro:IPR019732"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZID1"
FT                   /protein_id="ABV19474.1"
FT   gene            434727..436142
FT                   /gene="phoA"
FT                   /locus_tag="EcE24377A_0410"
FT   CDS_pept        434727..436142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="EcE24377A_0410"
FT                   /product="alkaline phosphatase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P00634; match to
FT                   protein family HMM PF00245"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17881"
FT                   /db_xref="GOA:A7ZID2"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID2"
FT                   /protein_id="ABV17881.1"
FT                   DLFYTMKAALGLK"
FT   gene            436261..436581
FT                   /gene="psiF"
FT                   /locus_tag="EcE24377A_0411"
FT   CDS_pept        436261..436581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="EcE24377A_0411"
FT                   /product="phosphate starvation-inducible protein PsiF"
FT                   /note="identified by match to protein family HMM PF07769"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18801"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID3"
FT                   /protein_id="ABV18801.1"
FT                   AA"
FT   gene            436683..437798
FT                   /locus_tag="EcE24377A_0412"
FT   CDS_pept        436683..437798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0412"
FT                   /product="MASE2 domain/diguanylate cyclase"
FT                   /note="identified by match to protein family HMM PF00990;
FT                   match to protein family HMM PF05230; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19167"
FT                   /db_xref="GOA:A7ZID4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR007894"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID4"
FT                   /protein_id="ABV19167.1"
FT   gene            complement(437815..438624)
FT                   /gene="proC"
FT                   /locus_tag="EcE24377A_0413"
FT   CDS_pept        complement(437815..438624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="EcE24377A_0413"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM PF03807; match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18917"
FT                   /db_xref="GOA:A7ZID5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID5"
FT                   /protein_id="ABV18917.1"
FT   gene            438744..439202
FT                   /locus_tag="EcE24377A_0414"
FT   CDS_pept        438744..439202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q3Z523; match to
FT                   protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19554"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZID6"
FT                   /protein_id="ABV19554.1"
FT   gene            439385..439909
FT                   /gene="aroL"
FT                   /locus_tag="EcE24377A_0415"
FT   CDS_pept        439385..439909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="EcE24377A_0415"
FT                   /product="shikimate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P10880; match to
FT                   protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20210"
FT                   /db_xref="GOA:A7ZID7"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027544"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZID7"
FT                   /protein_id="ABV20210.1"
FT                   IRSALAQTINC"
FT   gene            439959..440150
FT                   /locus_tag="EcE24377A_0416"
FT   CDS_pept        439959..440150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20859"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID8"
FT                   /protein_id="ABV20859.1"
FT                   TAQEAMDAKKRYEDPDKE"
FT   gene            440408..441085
FT                   /gene="aroM"
FT                   /locus_tag="EcE24377A_0417"
FT   CDS_pept        440408..441085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="EcE24377A_0417"
FT                   /product="AroM protein"
FT                   /note="identified by match to protein family HMM PF07302"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17001"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZID9"
FT                   /protein_id="ABV17001.1"
FT                   LLV"
FT   gene            441157..441441
FT                   /locus_tag="EcE24377A_0418"
FT   CDS_pept        441157..441441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06865"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17539"
FT                   /db_xref="GOA:A7ZIE0"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIE0"
FT                   /protein_id="ABV17539.1"
FT   gene            441649..441930
FT                   /locus_tag="EcE24377A_0419"
FT   CDS_pept        441649..441930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0419"
FT                   /product="hypothetical protein"
FT                   /note="ykiA; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17209"
FT                   /db_xref="InterPro:IPR024497"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE1"
FT                   /protein_id="ABV17209.1"
FT   gene            complement(442088..442999)
FT                   /locus_tag="EcE24377A_0420"
FT   CDS_pept        complement(442088..442999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0420"
FT                   /product="putative recombination-associated exonuclease
FT                   RdgC"
FT                   /note="identified by similarity to SP:P36767; match to
FT                   protein family HMM PF04381"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18020"
FT                   /db_xref="GOA:A7ZIE2"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIE2"
FT                   /protein_id="ABV18020.1"
FT   gene            443124..444032
FT                   /gene="mak"
FT                   /locus_tag="EcE24377A_0421"
FT   CDS_pept        443124..444032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="EcE24377A_0421"
FT                   /product="manno(fructo)kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by similarity to SP:P23917; match to
FT                   protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17321"
FT                   /db_xref="GOA:A7ZIE3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE3"
FT                   /protein_id="ABV17321.1"
FT   gene            444011..444151
FT                   /locus_tag="EcE24377A_0422"
FT   CDS_pept        444011..444151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19052"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE4"
FT                   /protein_id="ABV19052.1"
FT                   Q"
FT   gene            complement(444175..445443)
FT                   /gene="araJ"
FT                   /locus_tag="EcE24377A_0423"
FT   CDS_pept        complement(444175..445443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="EcE24377A_0423"
FT                   /product="protein araJ"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18373"
FT                   /db_xref="GOA:A7ZIE5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE5"
FT                   /protein_id="ABV18373.1"
FT   gene            complement(445485..448628)
FT                   /gene="sbcC"
FT                   /locus_tag="EcE24377A_0424"
FT   CDS_pept        complement(445485..448628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="EcE24377A_0424"
FT                   /product="nuclease SbcCD, C subunit"
FT                   /note="identified by similarity to SP:P13458; match to
FT                   protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16923"
FT                   /db_xref="GOA:A7ZIE6"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE6"
FT                   /protein_id="ABV16923.1"
FT   gene            complement(448625..449827)
FT                   /gene="sbcD"
FT                   /locus_tag="EcE24377A_0425"
FT   CDS_pept        complement(448625..449827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="EcE24377A_0425"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="identified by similarity to SP:P0AG76; match to
FT                   protein family HMM PF00149; match to protein family HMM
FT                   TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17631"
FT                   /db_xref="GOA:A7ZIE7"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE7"
FT                   /protein_id="ABV17631.1"
FT                   A"
FT   gene            449813..449944
FT                   /locus_tag="EcE24377A_0426"
FT   CDS_pept        449813..449944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16992"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE8"
FT                   /protein_id="ABV16992.1"
FT   gene            450017..450706
FT                   /gene="phoB"
FT                   /locus_tag="EcE24377A_0427"
FT   CDS_pept        450017..450706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="EcE24377A_0427"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486; match to protein
FT                   family HMM TIGR02154"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16572"
FT                   /db_xref="GOA:A7ZIE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIE9"
FT                   /protein_id="ABV16572.1"
FT                   YRFSTRF"
FT   gene            450764..452059
FT                   /gene="phoR"
FT                   /locus_tag="EcE24377A_0428"
FT   CDS_pept        450764..452059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="EcE24377A_0428"
FT                   /product="phosphate regulon sensor protein PhoR"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF02518; match to protein family HMM TIGR00229;
FT                   match to protein family HMM TIGR02966"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18717"
FT                   /db_xref="GOA:A7ZIF0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF0"
FT                   /protein_id="ABV18717.1"
FT   gene            complement(452070..452180)
FT                   /locus_tag="EcE24377A_0429"
FT   CDS_pept        complement(452070..452180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0429"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18078"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF1"
FT                   /protein_id="ABV18078.1"
FT   gene            complement(452272..452421)
FT                   /locus_tag="EcE24377A_0430"
FT   CDS_pept        complement(452272..452421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAX64346.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19162"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF2"
FT                   /protein_id="ABV19162.1"
FT                   FKRL"
FT   gene            452466..453785
FT                   /gene="brnQ"
FT                   /locus_tag="EcE24377A_0431"
FT   CDS_pept        452466..453785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="EcE24377A_0431"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="identified by match to protein family HMM PF05525;
FT                   match to protein family HMM TIGR00796"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19804"
FT                   /db_xref="GOA:A7ZIF3"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF3"
FT                   /protein_id="ABV19804.1"
FT   gene            453861..455234
FT                   /gene="proY"
FT                   /locus_tag="EcE24377A_0432"
FT   CDS_pept        453861..455234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="EcE24377A_0432"
FT                   /product="proline-specific permease ProY"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17178"
FT                   /db_xref="GOA:A7ZIF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF4"
FT                   /protein_id="ABV17178.1"
FT   gene            455390..457207
FT                   /gene="malZ"
FT                   /locus_tag="EcE24377A_0433"
FT   CDS_pept        455390..457207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="EcE24377A_0433"
FT                   /product="maltodextrin glucosidase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P21517; match to
FT                   protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17852"
FT                   /db_xref="GOA:A7ZIF5"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017069"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF5"
FT                   /protein_id="ABV17852.1"
FT   gene            complement(457212..457793)
FT                   /gene="acpH"
FT                   /locus_tag="EcE24377A_0434"
FT   CDS_pept        complement(457212..457793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpH"
FT                   /locus_tag="EcE24377A_0434"
FT                   /product="acyl carrier protein phosphodiesterase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04336"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21149"
FT                   /db_xref="GOA:A7ZIF6"
FT                   /db_xref="InterPro:IPR007431"
FT                   /db_xref="InterPro:IPR023491"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIF6"
FT                   /protein_id="ABV21149.1"
FT   gene            457886..458956
FT                   /gene="queA"
FT                   /locus_tag="EcE24377A_0435"
FT   CDS_pept        457886..458956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="EcE24377A_0435"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF02547;
FT                   match to protein family HMM TIGR00113"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16454"
FT                   /db_xref="GOA:A7ZIF7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIF7"
FT                   /protein_id="ABV16454.1"
FT                   MFITYNPQAINERVGE"
FT   gene            459012..460139
FT                   /gene="tgt"
FT                   /locus_tag="EcE24377A_0436"
FT   CDS_pept        459012..460139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="EcE24377A_0436"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01702;
FT                   match to protein family HMM TIGR00430; match to protein
FT                   family HMM TIGR00449"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19963"
FT                   /db_xref="GOA:A7ZIF8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIF8"
FT                   /protein_id="ABV19963.1"
FT   gene            460162..460494
FT                   /gene="yajC"
FT                   /locus_tag="EcE24377A_0437"
FT   CDS_pept        460162..460494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="EcE24377A_0437"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20450"
FT                   /db_xref="GOA:A7ZIF9"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIF9"
FT                   /protein_id="ABV20450.1"
FT                   GTMKAL"
FT   gene            460522..462369
FT                   /gene="secD"
FT                   /locus_tag="EcE24377A_0438"
FT   CDS_pept        460522..462369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="EcE24377A_0438"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR01129"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18516"
FT                   /db_xref="GOA:A7ZIG0"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG0"
FT                   /protein_id="ABV18516.1"
FT   gene            462380..463351
FT                   /gene="secF"
FT                   /locus_tag="EcE24377A_0439"
FT   CDS_pept        462380..463351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="EcE24377A_0439"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="identified by match to protein family HMM PF02355;
FT                   match to protein family HMM PF07549; match to protein
FT                   family HMM TIGR00916; match to protein family HMM
FT                   TIGR00966"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18605"
FT                   /db_xref="GOA:A7ZIG1"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG1"
FT                   /protein_id="ABV18605.1"
FT   gene            463480..463827
FT                   /locus_tag="EcE24377A_0440"
FT   CDS_pept        463480..463827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0440"
FT                   /product="HNH endonuclease family protein"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20919"
FT                   /db_xref="GOA:A7ZIG2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG2"
FT                   /protein_id="ABV20919.1"
FT                   ADLKAMMNKKK"
FT   gene            463841..463963
FT                   /locus_tag="EcE24377A_0441"
FT   CDS_pept        463841..463963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABB67500.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20080"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG3"
FT                   /protein_id="ABV20080.1"
FT   gene            complement(464004..464888)
FT                   /gene="tsx"
FT                   /locus_tag="EcE24377A_0442"
FT   CDS_pept        complement(464004..464888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="EcE24377A_0442"
FT                   /product="nucleoside-specific channel-forming protein"
FT                   /note="identified by match to protein family HMM PF03502"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19496"
FT                   /db_xref="GOA:A7ZIG4"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG4"
FT                   /protein_id="ABV19496.1"
FT                   TGWGGYLVVGYNF"
FT   gene            complement(465187..465726)
FT                   /locus_tag="EcE24377A_0443"
FT   CDS_pept        complement(465187..465726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0443"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19910"
FT                   /db_xref="InterPro:IPR021658"
FT                   /db_xref="InterPro:IPR037125"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG5"
FT                   /protein_id="ABV19910.1"
FT                   EQLDFVRIHDIQPVMQ"
FT   gene            465877..466326
FT                   /gene="nrdR"
FT                   /locus_tag="EcE24377A_0444"
FT   CDS_pept        465877..466326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="EcE24377A_0444"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18820"
FT                   /db_xref="GOA:A7ZIG6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIG6"
FT                   /protein_id="ABV18820.1"
FT   gene            466330..467433
FT                   /gene="ribD"
FT                   /locus_tag="EcE24377A_0445"
FT   CDS_pept        466330..467433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="EcE24377A_0445"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P25539; match to
FT                   protein family HMM PF00383; match to protein family HMM
FT                   PF01872; match to protein family HMM TIGR00227; match to
FT                   protein family HMM TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18019"
FT                   /db_xref="GOA:A7ZIG7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIG7"
FT                   /protein_id="ABV18019.1"
FT   gene            467522..467992
FT                   /gene="ribH"
FT                   /locus_tag="EcE24377A_0446"
FT   CDS_pept        467522..467992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="EcE24377A_0446"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by similarity to SP:P61714; match to
FT                   protein family HMM PF00885; match to protein family HMM
FT                   TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17290"
FT                   /db_xref="GOA:A7ZIG8"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIG8"
FT                   /protein_id="ABV17290.1"
FT   gene            468012..468431
FT                   /gene="nusB"
FT                   /locus_tag="EcE24377A_0447"
FT   CDS_pept        468012..468431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="EcE24377A_0447"
FT                   /product="transcription termination/antitermination factor
FT                   NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16621"
FT                   /db_xref="GOA:A7ZIG9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIG9"
FT                   /protein_id="ABV16621.1"
FT   gene            468509..469486
FT                   /gene="thiL"
FT                   /locus_tag="EcE24377A_0448"
FT   CDS_pept        468509..469486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="EcE24377A_0448"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P77785; match to
FT                   protein family HMM PF02769; match to protein family HMM
FT                   TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19029"
FT                   /db_xref="GOA:A7ZIH0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH0"
FT                   /protein_id="ABV19029.1"
FT   gene            469464..469982
FT                   /gene="pgpA"
FT                   /locus_tag="EcE24377A_0449"
FT   CDS_pept        469464..469982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="EcE24377A_0449"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04608"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21025"
FT                   /db_xref="GOA:A7ZIH1"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH1"
FT                   /protein_id="ABV21025.1"
FT                   HHWPLGILS"
FT   gene            complement(470036..471010)
FT                   /locus_tag="EcE24377A_0450"
FT   CDS_pept        complement(470036..471010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0450"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20807"
FT                   /db_xref="GOA:A7ZIH2"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH2"
FT                   /protein_id="ABV20807.1"
FT   gene            complement(471190..473052)
FT                   /gene="dxs"
FT                   /locus_tag="EcE24377A_0451"
FT   CDS_pept        complement(471190..473052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="EcE24377A_0451"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P77488; match to
FT                   protein family HMM PF02779; match to protein family HMM
FT                   PF02780; match to protein family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20138"
FT                   /db_xref="GOA:A7ZIH3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIH3"
FT                   /protein_id="ABV20138.1"
FT   gene            complement(473077..473976)
FT                   /gene="ispA"
FT                   /locus_tag="EcE24377A_0452"
FT   CDS_pept        complement(473077..473976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="EcE24377A_0452"
FT                   /product="geranyltranstransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P22939; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17605"
FT                   /db_xref="GOA:A7ZIH4"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH4"
FT                   /protein_id="ABV17605.1"
FT                   LDTSALEALADYIIQRNK"
FT   gene            complement(473976..474218)
FT                   /gene="xseB"
FT                   /locus_tag="EcE24377A_0453"
FT   CDS_pept        complement(473976..474218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="EcE24377A_0453"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0A8H2; match to
FT                   protein family HMM PF02609; match to protein family HMM
FT                   TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16922"
FT                   /db_xref="GOA:A7ZIH5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIH5"
FT                   /protein_id="ABV16922.1"
FT   gene            474306..474398
FT                   /locus_tag="EcE24377A_0454"
FT   CDS_pept        474306..474398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19334"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH6"
FT                   /protein_id="ABV19334.1"
FT                   /translation="MRSKAMLVVYFRAWMQPQVWAAVFFPIQVA"
FT   gene            474424..475872
FT                   /gene="thiI"
FT                   /locus_tag="EcE24377A_0455"
FT   CDS_pept        474424..475872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="EcE24377A_0455"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="identified by similarity to SP:P77718; match to
FT                   protein family HMM PF02568; match to protein family HMM
FT                   PF02926; match to protein family HMM TIGR00342"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18689"
FT                   /db_xref="GOA:A7ZIH7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIH7"
FT                   /protein_id="ABV18689.1"
FT   gene            complement(475926..476516)
FT                   /gene="thiJ"
FT                   /locus_tag="EcE24377A_0456"
FT   CDS_pept        complement(475926..476516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="EcE24377A_0456"
FT                   /product="protein ThiJ"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01383"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20377"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH8"
FT                   /protein_id="ABV20377.1"
FT   gene            complement(476479..477390)
FT                   /gene="panE"
FT                   /locus_tag="EcE24377A_0457"
FT   CDS_pept        complement(476479..477390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="EcE24377A_0457"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02558;
FT                   match to protein family HMM PF08546; match to protein
FT                   family HMM TIGR00745"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19128"
FT                   /db_xref="GOA:A7ZIH9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIH9"
FT                   /protein_id="ABV19128.1"
FT   gene            477558..478049
FT                   /locus_tag="EcE24377A_0458"
FT   CDS_pept        477558..478049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04461"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16579"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZII0"
FT                   /protein_id="ABV16579.1"
FT                   "
FT   gene            complement(478177..479541)
FT                   /locus_tag="EcE24377A_0459"
FT   CDS_pept        complement(478177..479541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0459"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20787"
FT                   /db_xref="GOA:A7ZII1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII1"
FT                   /protein_id="ABV20787.1"
FT   gene            479889..480884
FT                   /locus_tag="EcE24377A_0460"
FT   CDS_pept        479889..480884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0460"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20247"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII2"
FT                   /protein_id="ABV20247.1"
FT   gene            complement(480940..481482)
FT                   /locus_tag="EcE24377A_0461"
FT   CDS_pept        complement(480940..481482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0461"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17438"
FT                   /db_xref="GOA:A7ZII3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII3"
FT                   /protein_id="ABV17438.1"
FT                   AFGAVPMFLAIQHILAA"
FT   gene            complement(481466..481825)
FT                   /locus_tag="EcE24377A_0462"
FT   CDS_pept        complement(481466..481825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAZ87186.1; match to
FT                   protein family HMM PF08681"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18923"
FT                   /db_xref="GOA:A7ZII4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII4"
FT                   /protein_id="ABV18923.1"
FT                   LKALMKRKNSDGRQA"
FT   gene            complement(481962..482852)
FT                   /gene="cyoE"
FT                   /locus_tag="EcE24377A_0463"
FT   CDS_pept        complement(481962..482852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="EcE24377A_0463"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20910"
FT                   /db_xref="GOA:A7ZII5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZII5"
FT                   /protein_id="ABV20910.1"
FT                   DFMVPDSHTLLAAVW"
FT   gene            complement(482864..483193)
FT                   /gene="cyoD"
FT                   /locus_tag="EcE24377A_0464"
FT   CDS_pept        complement(482864..483193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="EcE24377A_0464"
FT                   /product="cytochrome o ubiquinol oxidase, subunit IV"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by similarity to SP:P0ABJ6; match to
FT                   protein family HMM PF03626; match to protein family HMM
FT                   TIGR02847"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18751"
FT                   /db_xref="GOA:A7ZII6"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII6"
FT                   /protein_id="ABV18751.1"
FT                   NMMMH"
FT   gene            complement(483193..483807)
FT                   /gene="cyoC"
FT                   /locus_tag="EcE24377A_0465"
FT   CDS_pept        complement(483193..483807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="EcE24377A_0465"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by similarity to SP:P0ABJ3; match to
FT                   protein family HMM PF00510; match to protein family HMM
FT                   TIGR02842"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19553"
FT                   /db_xref="GOA:A7ZII7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII7"
FT                   /protein_id="ABV19553.1"
FT   gene            complement(483797..485788)
FT                   /gene="cyoB"
FT                   /locus_tag="EcE24377A_0466"
FT   CDS_pept        complement(483797..485788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="EcE24377A_0466"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF00115;
FT                   match to protein family HMM TIGR02843"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17385"
FT                   /db_xref="GOA:A7ZII8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII8"
FT                   /protein_id="ABV17385.1"
FT   gene            complement(485810..486757)
FT                   /gene="cyoA"
FT                   /locus_tag="EcE24377A_0467"
FT   CDS_pept        complement(485810..486757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="EcE24377A_0467"
FT                   /product="cytochrome o ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by similarity to SP:P0ABJ1; match to
FT                   protein family HMM PF00116; match to protein family HMM
FT                   PF06481; match to protein family HMM TIGR01433"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17018"
FT                   /db_xref="GOA:A7ZII9"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZII9"
FT                   /protein_id="ABV17018.1"
FT   gene            complement(487218..488693)
FT                   /locus_tag="EcE24377A_0468"
FT   CDS_pept        complement(487218..488693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0468"
FT                   /product="AmpG family permease"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00901"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17099"
FT                   /db_xref="GOA:A7ZIJ0"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ0"
FT                   /protein_id="ABV17099.1"
FT   gene            complement(488737..489315)
FT                   /locus_tag="EcE24377A_0469"
FT   CDS_pept        complement(488737..489315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0469"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF03923"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16718"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ1"
FT                   /protein_id="ABV16718.1"
FT   gene            489620..489937
FT                   /locus_tag="EcE24377A_0470"
FT   CDS_pept        489620..489937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0470"
FT                   /product="protein BolA"
FT                   /note="identified by match to protein family HMM PF01722"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17236"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ2"
FT                   /protein_id="ABV17236.1"
FT                   A"
FT   gene            489946..490134
FT                   /locus_tag="EcE24377A_0471"
FT   CDS_pept        489946..490134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16735"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ3"
FT                   /protein_id="ABV16735.1"
FT                   YATARNNRSRLIKVMPL"
FT   gene            490281..491579
FT                   /gene="tig"
FT                   /locus_tag="EcE24377A_0472"
FT   CDS_pept        490281..491579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="EcE24377A_0472"
FT                   /product="trigger factor"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17673"
FT                   /db_xref="GOA:A7ZIJ4"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIJ4"
FT                   /protein_id="ABV17673.1"
FT   gene            491825..492448
FT                   /gene="clpP"
FT                   /locus_tag="EcE24377A_0473"
FT   CDS_pept        491825..492448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="EcE24377A_0473"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20037"
FT                   /db_xref="GOA:A7ZIJ5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIJ5"
FT                   /protein_id="ABV20037.1"
FT   gene            492574..493848
FT                   /gene="clpX"
FT                   /locus_tag="EcE24377A_0474"
FT   CDS_pept        492574..493848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="EcE24377A_0474"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06689; match to protein
FT                   family HMM PF07724; match to protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19393"
FT                   /db_xref="GOA:A7ZIJ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIJ6"
FT                   /protein_id="ABV19393.1"
FT   gene            494036..496390
FT                   /gene="lon"
FT                   /locus_tag="EcE24377A_0475"
FT   CDS_pept        494036..496390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="EcE24377A_0475"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02190; match to protein
FT                   family HMM PF05362; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21172"
FT                   /db_xref="GOA:A7ZIJ7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ7"
FT                   /protein_id="ABV21172.1"
FT   gene            496599..496871
FT                   /gene="hupB"
FT                   /locus_tag="EcE24377A_0476"
FT   CDS_pept        496599..496871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="EcE24377A_0476"
FT                   /product="DNA-binding protein HU-beta"
FT                   /note="identified by similarity to SP:P0ACF4; match to
FT                   protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20333"
FT                   /db_xref="GOA:A7ZIJ8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ8"
FT                   /protein_id="ABV20333.1"
FT   gene            497063..498934
FT                   /gene="ppiD"
FT                   /locus_tag="EcE24377A_0477"
FT   CDS_pept        497063..498934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="EcE24377A_0477"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0ADY1; match to
FT                   protein family HMM PF00639; match to protein family HMM
FT                   PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18186"
FT                   /db_xref="GOA:A7ZIJ9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIJ9"
FT                   /protein_id="ABV18186.1"
FT   gene            499085..499456
FT                   /locus_tag="EcE24377A_0478"
FT   CDS_pept        499085..499456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0478"
FT                   /product="competence protein ComEA"
FT                   /note="identified by match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18687"
FT                   /db_xref="GOA:A7ZIK0"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK0"
FT                   /protein_id="ABV18687.1"
FT   gene            499550..499948
FT                   /locus_tag="EcE24377A_0479"
FT   CDS_pept        499550..499948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0479"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17748"
FT                   /db_xref="GOA:A7ZIK1"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK1"
FT                   /protein_id="ABV17748.1"
FT   gene            complement(500000..500695)
FT                   /gene="queC"
FT                   /locus_tag="EcE24377A_0480"
FT   CDS_pept        complement(500000..500695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="EcE24377A_0480"
FT                   /product="queuosine biosynthesis protein QueC"
FT                   /note="identified by similarity to SP:P77756; match to
FT                   protein family HMM PF06508; match to protein family HMM
FT                   TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18274"
FT                   /db_xref="GOA:A7ZIK2"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIK2"
FT                   /protein_id="ABV18274.1"
FT                   AMKQKTGLR"
FT   gene            complement(500760..502460)
FT                   /locus_tag="EcE24377A_0481"
FT   CDS_pept        complement(500760..502460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0481"
FT                   /product="bacterial extracellular solute-binding proteins,
FT                   family 5"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17587"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR025370"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK3"
FT                   /protein_id="ABV17587.1"
FT   gene            502560..503378
FT                   /gene="cof"
FT                   /locus_tag="EcE24377A_0482"
FT   CDS_pept        502560..503378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="EcE24377A_0482"
FT                   /product="hydrolase Cof"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF05116; match to protein
FT                   family HMM PF08282; match to protein family HMM TIGR00099;
FT                   match to protein family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17995"
FT                   /db_xref="GOA:A7ZIK4"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023938"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIK4"
FT                   /protein_id="ABV17995.1"
FT   gene            503531..503989
FT                   /locus_tag="EcE24377A_0483"
FT   CDS_pept        503531..503989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0483"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="identified by match to protein family HMM PF01037"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21029"
FT                   /db_xref="GOA:A7ZIK5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK5"
FT                   /protein_id="ABV21029.1"
FT   gene            504019..505791
FT                   /gene="mdlA"
FT                   /locus_tag="EcE24377A_0484"
FT   CDS_pept        504019..505791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="EcE24377A_0484"
FT                   /product="multidrug resistance, ATP-binding protein mdlA"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16641"
FT                   /db_xref="GOA:A7ZIK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK6"
FT                   /protein_id="ABV16641.1"
FT                   LDDAPEIREEAVDA"
FT   gene            505784..507565
FT                   /gene="mdlB"
FT                   /locus_tag="EcE24377A_0485"
FT   CDS_pept        505784..507565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="EcE24377A_0485"
FT                   /product="multidrug ABC transporter, permease/ATP-binding
FT                   protein"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0AAG5; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19677"
FT                   /db_xref="GOA:A7ZIK7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK7"
FT                   /protein_id="ABV19677.1"
FT                   AGEELAASVREEESLSA"
FT   gene            507746..508084
FT                   /gene="glnK"
FT                   /locus_tag="EcE24377A_0486"
FT   CDS_pept        507746..508084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="EcE24377A_0486"
FT                   /product="nitrogen regulatory protein P-II 2"
FT                   /note="identified by similarity to PDB:2GNK_A; match to
FT                   protein family HMM PF00543"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20062"
FT                   /db_xref="GOA:A7ZIK8"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK8"
FT                   /protein_id="ABV20062.1"
FT                   GEADEAAL"
FT   gene            508114..509400
FT                   /gene="amt"
FT                   /locus_tag="EcE24377A_0487"
FT   CDS_pept        508114..509400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt"
FT                   /locus_tag="EcE24377A_0487"
FT                   /product="ammonium transporter"
FT                   /note="identified by match to protein family HMM PF00909;
FT                   match to protein family HMM TIGR00836"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19446"
FT                   /db_xref="GOA:A7ZIK9"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIK9"
FT                   /protein_id="ABV19446.1"
FT   gene            complement(509448..510308)
FT                   /gene="tesB"
FT                   /locus_tag="EcE24377A_0488"
FT   CDS_pept        complement(509448..510308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="EcE24377A_0488"
FT                   /product="acyl-CoA thioesterase II"
FT                   /EC_number="3.1.2.-"
FT                   /note="identified by match to protein family HMM PF02551;
FT                   match to protein family HMM TIGR00189"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20290"
FT                   /db_xref="GOA:A7ZIL0"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL0"
FT                   /protein_id="ABV20290.1"
FT                   MRNHN"
FT   gene            510526..511098
FT                   /locus_tag="EcE24377A_0489"
FT   CDS_pept        510526..511098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0489"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19617"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL1"
FT                   /protein_id="ABV19617.1"
FT   gene            complement(511129..511518)
FT                   /locus_tag="EcE24377A_0490"
FT   CDS_pept        complement(511129..511518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0490"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19120"
FT                   /db_xref="GOA:A7ZIL2"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL2"
FT                   /protein_id="ABV19120.1"
FT   gene            511819..512172
FT                   /locus_tag="EcE24377A_0491"
FT   CDS_pept        511819..512172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07237"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20703"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL3"
FT                   /protein_id="ABV20703.1"
FT                   RMIYGGFESIIDE"
FT   gene            complement(512214..513770)
FT                   /locus_tag="EcE24377A_0492"
FT   CDS_pept        complement(512214..513770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0492"
FT                   /product="cyclic diguanylate phosphodiesterase (EAL) domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00563"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20146"
FT                   /db_xref="GOA:A7ZIL4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL4"
FT                   /protein_id="ABV20146.1"
FT                   L"
FT   gene            complement(513928..514437)
FT                   /locus_tag="EcE24377A_0493"
FT   CDS_pept        complement(513928..514437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17998"
FT                   /db_xref="GOA:A7ZIL5"
FT                   /db_xref="InterPro:IPR019713"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL5"
FT                   /protein_id="ABV17998.1"
FT                   RAESTS"
FT   gene            complement(514514..515065)
FT                   /gene="maa"
FT                   /locus_tag="EcE24377A_0494"
FT   CDS_pept        complement(514514..515065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="EcE24377A_0494"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P77791; match to
FT                   protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17650"
FT                   /db_xref="GOA:A7ZIL6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL6"
FT                   /protein_id="ABV17650.1"
FT   gene            complement(515481..515855)
FT                   /locus_tag="EcE24377A_0495"
FT   CDS_pept        complement(515481..515855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:ABB65073.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19016"
FT                   /db_xref="InterPro:IPR019693"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL7"
FT                   /protein_id="ABV19016.1"
FT   gene            complement(516401..519550)
FT                   /locus_tag="EcE24377A_0496"
FT   CDS_pept        complement(516401..519550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0496"
FT                   /product="acriflavine resistance protein B"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18693"
FT                   /db_xref="GOA:A7ZIL8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL8"
FT                   /protein_id="ABV18693.1"
FT                   H"
FT   gene            complement(519573..520766)
FT                   /gene="acrA"
FT                   /locus_tag="EcE24377A_0497"
FT   CDS_pept        complement(519573..520766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="EcE24377A_0497"
FT                   /product="acriflavine resistance protein A"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19112"
FT                   /db_xref="GOA:A7ZIL9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIL9"
FT                   /protein_id="ABV19112.1"
FT   gene            520908..521555
FT                   /gene="acrR"
FT                   /locus_tag="EcE24377A_0498"
FT   CDS_pept        520908..521555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="EcE24377A_0498"
FT                   /product="transcriptional regulator AcrR"
FT                   /note="identified by similarity to SP:P0ACS9; match to
FT                   protein family HMM PF00440; match to protein family HMM
FT                   PF08361"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18643"
FT                   /db_xref="GOA:A7ZIM0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM0"
FT                   /protein_id="ABV18643.1"
FT   gene            521637..521801
FT                   /locus_tag="EcE24377A_0499"
FT   CDS_pept        521637..521801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18803"
FT                   /db_xref="GOA:A7ZIM1"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM1"
FT                   /protein_id="ABV18803.1"
FT                   GVCAGVIEW"
FT   gene            521683..525045
FT                   /gene="kefA"
FT                   /locus_tag="EcE24377A_0500"
FT   CDS_pept        521683..525045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="EcE24377A_0500"
FT                   /product="potassium efflux system KefA"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17909"
FT                   /db_xref="GOA:A7ZIM2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM2"
FT                   /protein_id="ABV17909.1"
FT                   RDYKGDDPTPAVG"
FT   gene            525091..525240
FT                   /locus_tag="EcE24377A_0501"
FT   CDS_pept        525091..525240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0501"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19462"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM3"
FT                   /protein_id="ABV19462.1"
FT                   LGDI"
FT   gene            complement(525257..525418)
FT                   /locus_tag="EcE24377A_0502"
FT   CDS_pept        complement(525257..525418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:NP_455077.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19782"
FT                   /db_xref="InterPro:IPR019630"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM4"
FT                   /protein_id="ABV19782.1"
FT                   TRDDEAEK"
FT   gene            complement(525432..525959)
FT                   /gene="priC"
FT                   /locus_tag="EcE24377A_0503"
FT   CDS_pept        complement(525432..525959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="EcE24377A_0503"
FT                   /product="primosomal replication protein N''"
FT                   /note="identified by similarity to SP:P23862; match to
FT                   protein family HMM PF07445"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19275"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM5"
FT                   /protein_id="ABV19275.1"
FT                   EKIENRLARLTR"
FT   gene            526029..526406
FT                   /locus_tag="EcE24377A_0504"
FT   CDS_pept        526029..526406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0504"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF04304"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21116"
FT                   /db_xref="GOA:A7ZIM6"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM6"
FT                   /protein_id="ABV21116.1"
FT   gene            526381..526491
FT                   /locus_tag="EcE24377A_0505"
FT   CDS_pept        526381..526491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0505"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20571"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM7"
FT                   /protein_id="ABV20571.1"
FT   gene            526559..527110
FT                   /gene="apt"
FT                   /locus_tag="EcE24377A_0506"
FT   CDS_pept        526559..527110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="EcE24377A_0506"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01090"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17111"
FT                   /db_xref="GOA:A7ZIM8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIM8"
FT                   /protein_id="ABV17111.1"
FT   gene            527239..529170
FT                   /gene="dnaX"
FT                   /locus_tag="EcE24377A_0507"
FT   CDS_pept        527239..529170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="EcE24377A_0507"
FT                   /product="DNA polymerase III, tau and gamma subunits"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P06710; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16591"
FT                   /db_xref="GOA:A7ZIM9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022001"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIM9"
FT                   /protein_id="ABV16591.1"
FT                   DEESIRPI"
FT   gene            complement(529199..529576)
FT                   /locus_tag="EcE24377A_0508"
FT   CDS_pept        complement(529199..529576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0508"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17507"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIN0"
FT                   /protein_id="ABV17507.1"
FT   gene            529223..529552
FT                   /locus_tag="EcE24377A_0509"
FT   CDS_pept        529223..529552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0509"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by similarity to GB:AAZ90762.1; match to
FT                   protein family HMM PF02575; match to protein family HMM
FT                   TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20678"
FT                   /db_xref="GOA:A7ZIN1"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIN1"
FT                   /protein_id="ABV20678.1"
FT                   FKMPF"
FT   gene            529552..530157
FT                   /gene="recR"
FT                   /locus_tag="EcE24377A_0510"
FT   CDS_pept        529552..530157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="EcE24377A_0510"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19567"
FT                   /db_xref="GOA:A7ZIN2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIN2"
FT                   /protein_id="ABV19567.1"
FT   gene            530267..532141
FT                   /gene="htpG"
FT                   /locus_tag="EcE24377A_0511"
FT   CDS_pept        530267..532141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="EcE24377A_0511"
FT                   /product="chaperone protein HtpG"
FT                   /note="identified by match to protein family HMM PF00183;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17720"
FT                   /db_xref="GOA:A7ZIN3"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIN3"
FT                   /protein_id="ABV17720.1"
FT   gene            532322..532966
FT                   /gene="adk"
FT                   /locus_tag="EcE24377A_0513"
FT   CDS_pept        532322..532966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="EcE24377A_0513"
FT                   /product="adenylate kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P69441; match to
FT                   protein family HMM PF00406; match to protein family HMM
FT                   PF05191; match to protein family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16637"
FT                   /db_xref="GOA:A7ZIN4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIN4"
FT                   /protein_id="ABV16637.1"
FT   gene            533202..534164
FT                   /gene="hemH"
FT                   /locus_tag="EcE24377A_0515"
FT   CDS_pept        533202..534164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="EcE24377A_0515"
FT                   /product="ferrochelatase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20426"
FT                   /db_xref="GOA:A7ZIN5"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIN5"
FT                   /protein_id="ABV20426.1"
FT   gene            complement(534161..535120)
FT                   /gene="aes"
FT                   /locus_tag="EcE24377A_0514"
FT   CDS_pept        complement(534161..535120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="EcE24377A_0514"
FT                   /product="acetyl esterase"
FT                   /EC_number="3.1.1.-"
FT                   /note="identified by similarity to SP:P23872; match to
FT                   protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20987"
FT                   /db_xref="GOA:A7ZIN6"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR023508"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIN6"
FT                   /protein_id="ABV20987.1"
FT   gene            535272..536576
FT                   /gene="gsk"
FT                   /locus_tag="EcE24377A_0516"
FT   CDS_pept        535272..536576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="EcE24377A_0516"
FT                   /product="inosine kinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0AEW6; match to
FT                   protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19398"
FT                   /db_xref="GOA:A7ZIN7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIN7"
FT                   /protein_id="ABV19398.1"
FT   gene            complement(536709..538385)
FT                   /locus_tag="EcE24377A_0517"
FT   CDS_pept        complement(536709..538385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0517"
FT                   /product="transporter, monovalent cation:proton
FT                   antiporter-2 family"
FT                   /note="identified by match to protein family HMM PF00999;
FT                   match to protein family HMM PF02254; match to protein
FT                   family HMM TIGR00932"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19954"
FT                   /db_xref="GOA:A7ZIN8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIN8"
FT                   /protein_id="ABV19954.1"
FT   gene            complement(538623..539843)
FT                   /gene="fsr"
FT                   /locus_tag="EcE24377A_0518"
FT   CDS_pept        complement(538623..539843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="EcE24377A_0518"
FT                   /product="fosmidomycin resistance protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20448"
FT                   /db_xref="GOA:A7ZIN9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIN9"
FT                   /protein_id="ABV20448.1"
FT                   PDNRHKD"
FT   gene            540061..541713
FT                   /gene="ushA"
FT                   /locus_tag="EcE24377A_0519"
FT   CDS_pept        540061..541713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="EcE24377A_0519"
FT                   /product="UDP-sugar hydrolase/5'-nucleotidase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P07024; match to
FT                   protein family HMM PF00149; match to protein family HMM
FT                   PF02872"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19341"
FT                   /db_xref="GOA:A7ZIP0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP0"
FT                   /protein_id="ABV19341.1"
FT   gene            complement(541750..542229)
FT                   /locus_tag="EcE24377A_0520"
FT   CDS_pept        complement(541750..542229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0520"
FT                   /product="YbaK/EbsC protein"
FT                   /note="identified by match to protein family HMM PF04073;
FT                   match to protein family HMM TIGR00011"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19996"
FT                   /db_xref="GOA:A7ZIP1"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP1"
FT                   /protein_id="ABV19996.1"
FT   gene            complement(542433..543227)
FT                   /locus_tag="EcE24377A_0521"
FT   CDS_pept        complement(542433..543227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0521"
FT                   /product="GumN family protein"
FT                   /note="identified by match to protein family HMM PF07446"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20367"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP2"
FT                   /protein_id="ABV20367.1"
FT   gene            543311..543706
FT                   /locus_tag="EcE24377A_0522"
FT   CDS_pept        543311..543706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0522"
FT                   /product="addiction module antidote protein, HigA family"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM TIGR02607"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21068"
FT                   /db_xref="GOA:A7ZIP3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP3"
FT                   /protein_id="ABV21068.1"
FT   gene            complement(543820..546324)
FT                   /gene="copA"
FT                   /locus_tag="EcE24377A_0523"
FT   CDS_pept        complement(543820..546324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="EcE24377A_0523"
FT                   /product="copper-exporting ATPase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01511; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17251"
FT                   /db_xref="GOA:A7ZIP4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP4"
FT                   /protein_id="ABV17251.1"
FT   gene            546586..547518
FT                   /gene="glsA1"
FT                   /locus_tag="EcE24377A_0524"
FT   CDS_pept        546586..547518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA1"
FT                   /locus_tag="EcE24377A_0524"
FT                   /product="glutaminase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17922"
FT                   /db_xref="GOA:A7ZIP5"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP5"
FT                   /protein_id="ABV17922.1"
FT   gene            547521..548813
FT                   /locus_tag="EcE24377A_0525"
FT   CDS_pept        547521..548813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0525"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF01490; match to protein
FT                   family HMM PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18381"
FT                   /db_xref="GOA:A7ZIP6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP6"
FT                   /protein_id="ABV18381.1"
FT   gene            548938..549345
FT                   /gene="cueR"
FT                   /locus_tag="EcE24377A_0526"
FT   CDS_pept        548938..549345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="EcE24377A_0526"
FT                   /product="Cu(I)-responsive transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF09278; match to protein
FT                   family HMM TIGR02044"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18951"
FT                   /db_xref="GOA:A7ZIP7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP7"
FT                   /protein_id="ABV18951.1"
FT   gene            complement(549346..549804)
FT                   /locus_tag="EcE24377A_0527"
FT   CDS_pept        complement(549346..549804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0527"
FT                   /product="nodulation efficiency family protein"
FT                   /note="identified by match to protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19999"
FT                   /db_xref="GOA:A7ZIP8"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP8"
FT                   /protein_id="ABV19999.1"
FT   gene            complement(549801..550718)
FT                   /locus_tag="EcE24377A_0528"
FT   CDS_pept        complement(549801..550718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0528"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17710"
FT                   /db_xref="GOA:A7ZIP9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIP9"
FT                   /protein_id="ABV17710.1"
FT   gene            550864..551541
FT                   /locus_tag="EcE24377A_0529"
FT   CDS_pept        550864..551541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0529"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18462"
FT                   /db_xref="GOA:A7ZIQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ0"
FT                   /protein_id="ABV18462.1"
FT                   ELA"
FT   gene            551528..552307
FT                   /locus_tag="EcE24377A_0530"
FT   CDS_pept        551528..552307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0530"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03649;
FT                   match to protein family HMM TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17695"
FT                   /db_xref="GOA:A7ZIQ1"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ1"
FT                   /protein_id="ABV17695.1"
FT   gene            complement(552370..553224)
FT                   /gene="ybbN"
FT                   /locus_tag="EcE24377A_0531"
FT   CDS_pept        complement(552370..553224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="EcE24377A_0531"
FT                   /product="protein YbbN"
FT                   /note="identified by similarity to SP:P77395; match to
FT                   protein family HMM PF00085"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18190"
FT                   /db_xref="GOA:A7ZIQ2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ2"
FT                   /protein_id="ABV18190.1"
FT                   LLY"
FT   gene            complement(553285..554094)
FT                   /locus_tag="EcE24377A_0532"
FT   CDS_pept        complement(553285..554094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0532"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17505"
FT                   /db_xref="GOA:A7ZIQ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ3"
FT                   /protein_id="ABV17505.1"
FT   gene            complement(554084..554740)
FT                   /gene="tesA"
FT                   /locus_tag="EcE24377A_0533"
FT   CDS_pept        complement(554084..554740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="EcE24377A_0533"
FT                   /product="acyl-CoA thioesterase I"
FT                   /EC_number="3.1.2.-"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0ADA1; match to
FT                   protein family HMM PF00657"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16770"
FT                   /db_xref="GOA:A7ZIQ4"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ4"
FT                   /protein_id="ABV16770.1"
FT   gene            554678..555364
FT                   /locus_tag="EcE24377A_0534"
FT   CDS_pept        554678..555364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0534"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20851"
FT                   /db_xref="GOA:A7ZIQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ5"
FT                   /protein_id="ABV20851.1"
FT                   QLQEEA"
FT   gene            555361..557775
FT                   /locus_tag="EcE24377A_0535"
FT   CDS_pept        555361..557775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0535"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20236"
FT                   /db_xref="GOA:A7ZIQ6"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ6"
FT                   /protein_id="ABV20236.1"
FT   gene            558205..562494
FT                   /locus_tag="EcE24377A_0536"
FT   CDS_pept        558205..562494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0536"
FT                   /product="RhsD protein precursor"
FT                   /note="identified by match to protein family HMM PF03527;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19565"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR025479"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ7"
FT                   /protein_id="ABV19565.1"
FT   gene            562534..562902
FT                   /locus_tag="EcE24377A_0537"
FT   CDS_pept        562534..562902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0537"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18877"
FT                   /db_xref="InterPro:IPR028921"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ8"
FT                   /protein_id="ABV18877.1"
FT                   IIEINKKNGCVLNFLHSK"
FT   gene            562902..563612
FT                   /locus_tag="EcE24377A_0538"
FT   CDS_pept        562902..563612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0538"
FT                   /product="Rhs domain protein"
FT                   /note="identified by match to protein family HMM PF03527"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20370"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIQ9"
FT                   /protein_id="ABV20370.1"
FT                   KKTIKALQDAGYLK"
FT   gene            complement(564600..564971)
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0539"
FT                   /note="transposase, IS481 family, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts"
FT   gene            complement(565087..566181)
FT                   /gene="selU"
FT                   /locus_tag="EcE24377A_0540"
FT   CDS_pept        complement(565087..566181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selU"
FT                   /locus_tag="EcE24377A_0540"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="identified by similarity to SP:Q8ZR88; match to
FT                   protein family HMM TIGR03167"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18288"
FT                   /db_xref="GOA:A7ZIR0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIR0"
FT                   /protein_id="ABV18288.1"
FT   gene            complement(566250..567176)
FT                   /locus_tag="EcE24377A_0541"
FT   CDS_pept        complement(566250..567176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0541"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17765"
FT                   /db_xref="GOA:A7ZIR1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR1"
FT                   /protein_id="ABV17765.1"
FT   gene            567406..567888
FT                   /gene="allA"
FT                   /locus_tag="EcE24377A_0542"
FT   CDS_pept        567406..567888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="EcE24377A_0542"
FT                   /product="ureidoglycolate hydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04115"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17202"
FT                   /db_xref="GOA:A7ZIR2"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIR2"
FT                   /protein_id="ABV17202.1"
FT   gene            567966..568781
FT                   /gene="allR"
FT                   /locus_tag="EcE24377A_0543"
FT   CDS_pept        567966..568781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="EcE24377A_0543"
FT                   /product="transcriptional regulator AllR"
FT                   /note="identified by similarity to SP:P0ACN4; match to
FT                   protein family HMM PF01614; match to protein family HMM
FT                   PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16676"
FT                   /db_xref="GOA:A7ZIR3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR3"
FT                   /protein_id="ABV16676.1"
FT   gene            568871..570652
FT                   /gene="gcl"
FT                   /locus_tag="EcE24377A_0544"
FT   CDS_pept        568871..570652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="EcE24377A_0544"
FT                   /product="glyoxylate carboligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR01504"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20391"
FT                   /db_xref="GOA:A7ZIR4"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR4"
FT                   /protein_id="ABV20391.1"
FT                   ADNAADAPTETCFMHYE"
FT   gene            570665..571441
FT                   /gene="hyi"
FT                   /locus_tag="EcE24377A_0545"
FT   CDS_pept        570665..571441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="EcE24377A_0545"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01261;
FT                   match to protein family HMM TIGR03234"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19971"
FT                   /db_xref="GOA:A7ZIR5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR5"
FT                   /protein_id="ABV19971.1"
FT   gene            571541..572419
FT                   /locus_tag="EcE24377A_0546"
FT   CDS_pept        571541..572419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0546"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /note="identified by match to protein family HMM PF03446;
FT                   match to protein family HMM TIGR01505"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19315"
FT                   /db_xref="GOA:A7ZIR6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR6"
FT                   /protein_id="ABV19315.1"
FT                   ALELMANHKLA"
FT   gene            572588..574042
FT                   /locus_tag="EcE24377A_0547"
FT   CDS_pept        572588..574042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0547"
FT                   /product="permease, cytosine/purines, uracil, thiamine,
FT                   allantoin family"
FT                   /note="identified by match to protein family HMM PF02133;
FT                   match to protein family HMM TIGR00800"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18362"
FT                   /db_xref="GOA:A7ZIR7"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR7"
FT                   /protein_id="ABV18362.1"
FT   gene            574102..575463
FT                   /gene="allB"
FT                   /locus_tag="EcE24377A_0548"
FT   CDS_pept        574102..575463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allB"
FT                   /locus_tag="EcE24377A_0548"
FT                   /product="allantoinase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P77671; match to
FT                   protein family HMM PF01979; match to protein family HMM
FT                   PF07969; match to protein family HMM TIGR03178"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17665"
FT                   /db_xref="GOA:A7ZIR8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIR8"
FT                   /protein_id="ABV17665.1"
FT   gene            575520..576821
FT                   /locus_tag="EcE24377A_0550"
FT   CDS_pept        575520..576821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0550"
FT                   /product="putative nucleobase permease"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19473"
FT                   /db_xref="GOA:A7ZIR9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIR9"
FT                   /protein_id="ABV19473.1"
FT   gene            complement(576482..576574)
FT                   /locus_tag="EcE24377A_0549"
FT   CDS_pept        complement(576482..576574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20018"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS0"
FT                   /protein_id="ABV20018.1"
FT                   /translation="MTALLTGKGILQNSRVSAGTSATSRQITLP"
FT   gene            576843..577988
FT                   /locus_tag="EcE24377A_0551"
FT   CDS_pept        576843..577988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0551"
FT                   /product="glycerate kinase"
FT                   /note="identified by similarity to SP:P77364; match to
FT                   protein family HMM PF02595; match to protein family HMM
FT                   TIGR00045"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17745"
FT                   /db_xref="GOA:A7ZIS1"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS1"
FT                   /protein_id="ABV17745.1"
FT   gene            578047..578187
FT                   /locus_tag="EcE24377A_0552"
FT   CDS_pept        578047..578187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18139"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS2"
FT                   /protein_id="ABV18139.1"
FT                   T"
FT   gene            complement(578216..579001)
FT                   /locus_tag="EcE24377A_0553"
FT   CDS_pept        complement(578216..579001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0553"
FT                   /product="cupin domain protein"
FT                   /note="identified by match to protein family HMM PF05899;
FT                   match to protein family HMM PF07883; match to protein
FT                   family HMM TIGR03214"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18784"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS3"
FT                   /protein_id="ABV18784.1"
FT   gene            complement(579012..580247)
FT                   /gene="allC"
FT                   /locus_tag="EcE24377A_0554"
FT   CDS_pept        complement(579012..580247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="EcE24377A_0554"
FT                   /product="allantoate amidohydrolase"
FT                   /EC_number="3.5.3.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01879; match to protein family HMM
FT                   TIGR03176"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17456"
FT                   /db_xref="GOA:A7ZIS4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017591"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS4"
FT                   /protein_id="ABV17456.1"
FT                   LALMLYQLAWQK"
FT   gene            complement(580269..581318)
FT                   /gene="allD"
FT                   /locus_tag="EcE24377A_0555"
FT   CDS_pept        complement(580269..581318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="EcE24377A_0555"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P77555; match to
FT                   protein family HMM PF02615; match to protein family HMM
FT                   TIGR03175"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20324"
FT                   /db_xref="GOA:A7ZIS5"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR017590"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS5"
FT                   /protein_id="ABV20324.1"
FT                   YETKNPFAQ"
FT   gene            581635..583302
FT                   /locus_tag="EcE24377A_0556"
FT   CDS_pept        581635..583302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0556"
FT                   /product="bacterial FdrA protein"
FT                   /note="identified by match to protein family HMM PF06263"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21093"
FT                   /db_xref="GOA:A7ZIS6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS6"
FT                   /protein_id="ABV21093.1"
FT   gene            583312..584571
FT                   /locus_tag="EcE24377A_0557"
FT   CDS_pept        583312..584571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06545"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19247"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS7"
FT                   /protein_id="ABV19247.1"
FT   gene            584582..585397
FT                   /locus_tag="EcE24377A_0558"
FT   CDS_pept        584582..585397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="ylbF; identified by similarity to GB:ABB65130.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17788"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS8"
FT                   /protein_id="ABV17788.1"
FT   gene            585394..586287
FT                   /gene="arcC"
FT                   /locus_tag="EcE24377A_0559"
FT   CDS_pept        585394..586287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="EcE24377A_0559"
FT                   /product="carbamate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20984"
FT                   /db_xref="GOA:A7ZIS9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIS9"
FT                   /protein_id="ABV20984.1"
FT                   RIEETLAGEAGTCISL"
FT   gene            586324..586431
FT                   /locus_tag="EcE24377A_0561"
FT   CDS_pept        586324..586431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0561"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20179"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT0"
FT                   /protein_id="ABV20179.1"
FT   gene            complement(586424..587491)
FT                   /gene="purK"
FT                   /locus_tag="EcE24377A_0560"
FT   CDS_pept        complement(586424..587491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="EcE24377A_0560"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P09029; match to
FT                   protein family HMM PF02222; match to protein family HMM
FT                   TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20697"
FT                   /db_xref="GOA:A7ZIT1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT1"
FT                   /protein_id="ABV20697.1"
FT                   PEYASGVIWAQSKFS"
FT   gene            complement(587488..587997)
FT                   /gene="purE"
FT                   /locus_tag="EcE24377A_0562"
FT   CDS_pept        complement(587488..587997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="EcE24377A_0562"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P0AG18; match to
FT                   protein family HMM PF00731; match to protein family HMM
FT                   TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19605"
FT                   /db_xref="GOA:A7ZIT2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT2"
FT                   /protein_id="ABV19605.1"
FT                   DPRGAA"
FT   gene            complement(588115..588837)
FT                   /gene="lpxH"
FT                   /locus_tag="EcE24377A_0563"
FT   CDS_pept        complement(588115..588837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="EcE24377A_0563"
FT                   /product="UDP-2,3-diacylglucosamine hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR01854"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19098"
FT                   /db_xref="GOA:A7ZIT3"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIT3"
FT                   /protein_id="ABV19098.1"
FT                   GSMVKVTADDVELIHFPF"
FT   gene            complement(588840..589334)
FT                   /gene="ppiB"
FT                   /locus_tag="EcE24377A_0564"
FT   CDS_pept        complement(588840..589334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="EcE24377A_0564"
FT                   /product="peptidylprolyl isomerase"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P23869; match to
FT                   protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16693"
FT                   /db_xref="GOA:A7ZIT4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT4"
FT                   /protein_id="ABV16693.1"
FT                   E"
FT   gene            589508..590893
FT                   /gene="cysS"
FT                   /locus_tag="EcE24377A_0566"
FT   CDS_pept        589508..590893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="EcE24377A_0566"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17492"
FT                   /db_xref="GOA:A7ZIT5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIT5"
FT                   /protein_id="ABV17492.1"
FT                   RRK"
FT   gene            complement(590929..591450)
FT                   /locus_tag="EcE24377A_0567"
FT   CDS_pept        complement(590929..591450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16880"
FT                   /db_xref="GOA:A7ZIT6"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT6"
FT                   /protein_id="ABV16880.1"
FT                   LMGMLWWRRR"
FT   gene            complement(591558..591770)
FT                   /locus_tag="EcE24377A_0569"
FT   CDS_pept        complement(591558..591770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P0AAS8"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19808"
FT                   /db_xref="GOA:A7ZIT7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT7"
FT                   /protein_id="ABV19808.1"
FT   gene            complement(591772..592638)
FT                   /gene="folD"
FT                   /locus_tag="EcE24377A_0570"
FT   CDS_pept        complement(591772..592638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="EcE24377A_0570"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P24186; match to
FT                   protein family HMM PF00763; match to protein family HMM
FT                   PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17812"
FT                   /db_xref="GOA:A7ZIT8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIT8"
FT                   /protein_id="ABV17812.1"
FT                   YHDPQDE"
FT   gene            593119..593661
FT                   /locus_tag="EcE24377A_0571"
FT   CDS_pept        593119..593661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0571"
FT                   /product="type-1 fimbrial protein homolog"
FT                   /note="identified by similarity to SP:P04128; match to
FT                   protein family HMM PF00419"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18039"
FT                   /db_xref="GOA:A7ZIT9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIT9"
FT                   /protein_id="ABV18039.1"
FT                   ASAGQANADATFIMRYE"
FT   gene            593757..593891
FT                   /locus_tag="EcE24377A_0572"
FT   CDS_pept        593757..593891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0572"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21058"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU0"
FT                   /protein_id="ABV21058.1"
FT   gene            593881..594573
FT                   /gene="fimC"
FT                   /locus_tag="EcE24377A_0573"
FT   CDS_pept        593881..594573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimC"
FT                   /locus_tag="EcE24377A_0573"
FT                   /product="chaperone protein FimC"
FT                   /note="identified by match to protein family HMM PF00345;
FT                   match to protein family HMM PF02753"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19348"
FT                   /db_xref="GOA:A7ZIU1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU1"
FT                   /protein_id="ABV19348.1"
FT                   PVREVNLN"
FT   gene            594604..597212
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0574"
FT                   /note="outer membrane usher protein fimD, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P30130; match to protein family HMM PF00577"
FT   gene            597067..597228
FT                   /locus_tag="EcE24377A_0575"
FT   CDS_pept        597067..597228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16545"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU2"
FT                   /protein_id="ABV16545.1"
FT                   LAHKGNYQ"
FT   gene            597225..598232
FT                   /locus_tag="EcE24377A_0576"
FT   CDS_pept        597225..598232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0576"
FT                   /product="mannose binding protein FimH"
FT                   /note="identified by similarity to GB:AAD17914.1"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19608"
FT                   /db_xref="GOA:A7ZIU3"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU3"
FT                   /protein_id="ABV19608.1"
FT   gene            complement(598761..599393)
FT                   /gene="fimZ"
FT                   /locus_tag="EcE24377A_0577"
FT   CDS_pept        complement(598761..599393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimZ"
FT                   /locus_tag="EcE24377A_0577"
FT                   /product="fimbriae Z protein"
FT                   /note="identified by similarity to SP:P21502; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19179"
FT                   /db_xref="GOA:A7ZIU4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU4"
FT                   /protein_id="ABV19179.1"
FT   gene            599636..599712
FT                   /locus_tag="EcE24377A_5013"
FT   tRNA            599636..599712
FT                   /locus_tag="EcE24377A_5013"
FT                   /product="tRNA-Arg"
FT   gene            complement(599758..600519)
FT                   /locus_tag="EcE24377A_0579"
FT   CDS_pept        complement(599758..600519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0579"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17059"
FT                   /db_xref="GOA:A7ZIU5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU5"
FT                   /protein_id="ABV17059.1"
FT   gene            complement(600702..601592)
FT                   /locus_tag="EcE24377A_0580"
FT   CDS_pept        complement(600702..601592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16578"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU6"
FT                   /protein_id="ABV16578.1"
FT                   FSLRYLPVAHGILEY"
FT   gene            complement(601593..604565)
FT                   /locus_tag="EcE24377A_0581"
FT   CDS_pept        complement(601593..604565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0581"
FT                   /product="bacteriophage N4 adsorption protein A precursor"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21105"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU7"
FT                   /protein_id="ABV21105.1"
FT                   W"
FT   gene            complement(604552..606788)
FT                   /pseudo
FT                   /gene="nfrB"
FT                   /locus_tag="EcE24377A_0582"
FT                   /note="bacteriophage N4 adsorption protein B, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:P31599"
FT   gene            complement(607057..608193)
FT                   /locus_tag="EcE24377A_0583"
FT   CDS_pept        complement(607057..608193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0583"
FT                   /product="ISEc3, transposase"
FT                   /note="identified by match to protein family HMM PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18443"
FT                   /db_xref="GOA:A7ZIU8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU8"
FT                   /protein_id="ABV18443.1"
FT   gene            complement(608297..608608)
FT                   /locus_tag="EcE24377A_0584"
FT   CDS_pept        complement(608297..608608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0584"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17905"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIU9"
FT                   /protein_id="ABV17905.1"
FT   gene            complement(608971..613773)
FT                   /locus_tag="EcE24377A_0585"
FT   CDS_pept        complement(608971..613773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0585"
FT                   /product="YD repeat"
FT                   /note="identified by match to protein family HMM PF05488;
FT                   match to protein family HMM PF05593; match to protein
FT                   family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19924"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028912"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV0"
FT                   /protein_id="ABV19924.1"
FT   gene            complement(613853..614314)
FT                   /locus_tag="EcE24377A_0586"
FT   CDS_pept        complement(613853..614314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE12649.1; match to
FT                   protein family HMM PF08786"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19033"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV1"
FT                   /protein_id="ABV19033.1"
FT   gene            complement(614342..616243)
FT                   /locus_tag="EcE24377A_0587"
FT   CDS_pept        complement(614342..616243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0587"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="identified by match to protein family HMM PF04524;
FT                   match to protein family HMM TIGR01646; match to protein
FT                   family HMM TIGR03361"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17105"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV2"
FT                   /protein_id="ABV17105.1"
FT   gene            complement(616980..618428)
FT                   /gene="cusS"
FT                   /locus_tag="EcE24377A_0588"
FT   CDS_pept        complement(616980..618428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="EcE24377A_0588"
FT                   /product="sensor histidine kinase CusS"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P77485; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF02518; match to
FT                   protein family HMM TIGR01386"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16542"
FT                   /db_xref="GOA:A7ZIV3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV3"
FT                   /protein_id="ABV16542.1"
FT   gene            complement(618418..619101)
FT                   /gene="cusR"
FT                   /locus_tag="EcE24377A_0589"
FT   CDS_pept        complement(618418..619101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusR"
FT                   /locus_tag="EcE24377A_0589"
FT                   /product="transcriptional regulatory protein cusR"
FT                   /note="identified by similarity to SP:P0ACZ8; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486; match to protein family HMM TIGR01387"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18488"
FT                   /db_xref="GOA:A7ZIV4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV4"
FT                   /protein_id="ABV18488.1"
FT                   VPDGQ"
FT   gene            619258..620640
FT                   /gene="cusC"
FT                   /locus_tag="EcE24377A_0590"
FT   CDS_pept        619258..620640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="EcE24377A_0590"
FT                   /product="cation efflux system protein CusC"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17959"
FT                   /db_xref="GOA:A7ZIV5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV5"
FT                   /protein_id="ABV17959.1"
FT                   QQ"
FT   gene            620664..620996
FT                   /gene="cusF"
FT                   /locus_tag="EcE24377A_0591"
FT   CDS_pept        620664..620996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="EcE24377A_0591"
FT                   /product="cation efflux system protein CusF"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19755"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV6"
FT                   /protein_id="ABV19755.1"
FT                   DIKVSQ"
FT   gene            621012..622235
FT                   /gene="cusB"
FT                   /locus_tag="EcE24377A_0592"
FT   CDS_pept        621012..622235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="EcE24377A_0592"
FT                   /product="cation efflux system protein CusB"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18487"
FT                   /db_xref="GOA:A7ZIV7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV7"
FT                   /protein_id="ABV18487.1"
FT                   SESATHAH"
FT   gene            622247..625390
FT                   /gene="cusA"
FT                   /locus_tag="EcE24377A_0593"
FT   CDS_pept        622247..625390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="EcE24377A_0593"
FT                   /product="cation efflux system protein cusA"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00914"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21096"
FT                   /db_xref="GOA:A7ZIV8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV8"
FT                   /protein_id="ABV21096.1"
FT   gene            625492..626868
FT                   /gene="pheP"
FT                   /locus_tag="EcE24377A_0594"
FT   CDS_pept        625492..626868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="EcE24377A_0594"
FT                   /product="phenylalanine-specific permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20562"
FT                   /db_xref="GOA:A7ZIV9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIV9"
FT                   /protein_id="ABV20562.1"
FT                   "
FT   gene            complement(626936..628183)
FT                   /gene="ybdG"
FT                   /locus_tag="EcE24377A_0595"
FT   CDS_pept        complement(626936..628183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="EcE24377A_0595"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel (MscS) family"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20492"
FT                   /db_xref="GOA:A7ZIW0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW0"
FT                   /protein_id="ABV20492.1"
FT                   SPTGNDIRSLAGAFKQ"
FT   gene            complement(628291..628944)
FT                   /gene="nfnB"
FT                   /locus_tag="EcE24377A_0596"
FT   CDS_pept        complement(628291..628944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="EcE24377A_0596"
FT                   /product="oxygen-insensitive NAD(P)H nitroreductase"
FT                   /EC_number="1.-.-.-"
FT                   /EC_number=""
FT                   /note="identified by similarity to SP:P38489; match to
FT                   protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17696"
FT                   /db_xref="GOA:A7ZIW1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW1"
FT                   /protein_id="ABV17696.1"
FT   gene            complement(628992..629084)
FT                   /locus_tag="EcE24377A_0597"
FT   CDS_pept        complement(628992..629084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0597"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19933"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW2"
FT                   /protein_id="ABV19933.1"
FT                   /translation="MMVWLNAIKKECVQAKAEIYSAFFSLTISR"
FT   gene            complement(629038..629406)
FT                   /locus_tag="EcE24377A_0598"
FT   CDS_pept        complement(629038..629406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:BAA35219.1; match to
FT                   protein family HMM PF04237"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17399"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW3"
FT                   /protein_id="ABV17399.1"
FT                   NLVVDGLAKRDQKRVRPG"
FT   gene            complement(629471..629719)
FT                   /locus_tag="EcE24377A_0599"
FT   CDS_pept        complement(629471..629719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0599"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06643"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17310"
FT                   /db_xref="GOA:A7ZIW4"
FT                   /db_xref="InterPro:IPR010590"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW4"
FT                   /protein_id="ABV17310.1"
FT   gene            complement(629785..630903)
FT                   /locus_tag="EcE24377A_0600"
FT   CDS_pept        complement(629785..630903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0600"
FT                   /product="putative carboxylate-amine ligase"
FT                   /note="identified by similarity to SP:P77213; match to
FT                   protein family HMM PF04107; match to protein family HMM
FT                   TIGR02050"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19257"
FT                   /db_xref="GOA:A7ZIW5"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIW5"
FT                   /protein_id="ABV19257.1"
FT   gene            complement(632133..632762)
FT                   /gene="entD"
FT                   /locus_tag="EcE24377A_0601"
FT   CDS_pept        complement(632133..632762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="EcE24377A_0601"
FT                   /product="4'-phosphopantetheinyl transferase EntD"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by similarity to SP:P19925; match to
FT                   protein family HMM PF01648"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABV21135"
FT                   /db_xref="GOA:A7ZIW6"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW6"
FT                   /protein_id="ABV21135.1"
FT   gene            complement(632784..632903)
FT                   /pseudo
FT                   /locus_tag="EcE24377A_0602"
FT                   /note="hypothetical protein; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by glimmer; putative"
FT   gene            complement(632928..635168)
FT                   /gene="fepA"
FT                   /locus_tag="EcE24377A_0603"
FT   CDS_pept        complement(632928..635168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="EcE24377A_0603"
FT                   /product="ferrienterobactin receptor"
FT                   /note="identified by similarity to SP:P05825; match to
FT                   protein family HMM PF00593; match to protein family HMM
FT                   PF07715; match to protein family HMM TIGR01783"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18985"
FT                   /db_xref="GOA:A7ZIW7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW7"
FT                   /protein_id="ABV18985.1"
FT   gene            635489..636613
FT                   /gene="fes"
FT                   /locus_tag="EcE24377A_0604"
FT   CDS_pept        635489..636613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="EcE24377A_0604"
FT                   /product="enterochelin esterase"
FT                   /note="identified by similarity to SP:P13039; match to
FT                   protein family HMM PF00756"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18744"
FT                   /db_xref="GOA:A7ZIW8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR021764"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW8"
FT                   /protein_id="ABV18744.1"
FT   gene            636616..636834
FT                   /locus_tag="EcE24377A_0605"
FT   CDS_pept        636616..636834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0605"
FT                   /product="mbtH-like protein"
FT                   /note="identified by match to protein family HMM PF03621"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV18218"
FT                   /db_xref="InterPro:IPR005153"
FT                   /db_xref="InterPro:IPR037407"
FT                   /db_xref="InterPro:IPR038020"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIW9"
FT                   /protein_id="ABV18218.1"
FT   gene            636831..640712
FT                   /gene="entF"
FT                   /locus_tag="EcE24377A_0606"
FT   CDS_pept        636831..640712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="EcE24377A_0606"
FT                   /product="enterobactin synthetase component F"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by similarity to SP:P11454; match to
FT                   protein family HMM PF00501; match to protein family HMM
FT                   PF00550; match to protein family HMM PF00668; match to
FT                   protein family HMM PF00975; match to protein family HMM
FT                   TIGR01733"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABV17231"
FT                   /db_xref="GOA:A7ZIX0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIX0"
FT                   /protein_id="ABV17231.1"
FT                   PIIRATLNR"
FT   gene            640928..642061
FT                   /gene="fepE"
FT                   /locus_tag="EcE24377A_0608"
FT   CDS_pept        640928..642061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="EcE24377A_0608"
FT                   /product="ferric enterobactin transport protein fepE"
FT                   /note="identified by match to protein family HMM PF02706"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABV16549"
FT                   /db_xref="GOA:A7ZIX1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIX1"
FT                   /protein_id="ABV16549.1"
FT   gene            complement(642058..642873)
FT                   /gene="fepC"
FT                   /locus_tag="EcE24377A_0607"
FT   CDS_pept        complement(642058..642873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="EcE24377A_0607"
FT                   /product="ferric enterobactin ABC transporter, ATP-binding
FT                   protein FepC"
FT                   /note="identified by similarity to SP:P23878; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20637"
FT                   /db_xref="GOA:A7ZIX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIX2"
FT                   /protein_id="ABV20637.1"
FT   gene            complement(642870..643862)
FT                   /gene="fepG"
FT                   /locus_tag="EcE24377A_0609"
FT   CDS_pept        complement(642870..643862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="EcE24377A_0609"
FT                   /product="ferric enterobactin ABC transporter, permease
FT                   protein FepG"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABV20101"
FT                   /db_xref="GOA:A7ZIX3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIX3"
FT                   /protein_id="ABV20101.1"
FT   gene            complement(643859..644863)
FT                   /gene="fepD"
FT                   /locus_tag="EcE24377A_0610"
FT   CDS_pept        complement(643859..644863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="EcE24377A_0610"
FT                   /product="ferric enterobactin transport system permease
FT                   protein fepD"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19588"
FT                   /db_xref="GOA:A7ZIX4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A7ZIX4"
FT                   /protein_id="ABV19588.1"
FT   gene            644974..646224
FT                   /locus_tag="EcE24377A_0611"
FT   CDS_pept        644974..646224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="EcE24377A_0611"
FT                   /product="siderophore transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:EcE24377A_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABV19129"
FT                   /db_xref="GOA:A7ZIX5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023722"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7ZIX5"
FT                   /protein_id="ABV19129.1"