(data stored in SCRATCH3701 zone)

EMBL: CP000805

ID   CP000805; SV 1; circular; genomic DNA; STD; PRO; 1139457 BP.
XX
AC   CP000805;
XX
PR   Project:PRJNA20067;
XX
DT   23-MAY-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 3)
XX
DE   Treponema pallidum subsp. pallidum SS14, complete genome.
XX
KW   .
XX
OS   Treponema pallidum subsp. pallidum SS14
OC   Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1139457
RX   DOI; 10.1186/1471-2180-8-76.
RX   PUBMED; 18482458.
RA   Matejkova P., Strouhal M., Smajs D., Norris S.J., Palzkill T.,
RA   Petrosino J.F., Sodergren E., Norton J.E., Singh J., Richmond T.A.,
RA   Molla M.N., Albert T.J., Weinstock G.M.;
RT   "Complete genome sequence of Treponema pallidum ssp. pallidum strain SS14
RT   determined with oligonucleotide arrays";
RL   BMC Microbiol. 8:76-76(2008).
XX
RN   [2]
RP   1-1139457
RA   Matejkova P., Strouhal M., Smajs D., Norris S.J., Palzkill T.,
RA   Petrosino J.F., Sodergren E., Norton J.E., Singh J., Richmond T.A.,
RA   Molla M.N., Albert T.J., Weinstock G.M.;
RT   ;
RL   Submitted (20-AUG-2007) to the INSDC.
RL   Human Genome Sequencing Center, Baylor College of Medicine, 1 Baylor Plaza,
RL   Houston, TX 77030, USA
XX
DR   MD5; 7c43fa37f208eee1ae47685e6601af5a.
DR   BioSample; SAMN00000318.
DR   EnsemblGenomes-Gn; EBG00000997528.
DR   EnsemblGenomes-Gn; EBG00000997529.
DR   EnsemblGenomes-Gn; EBG00000997530.
DR   EnsemblGenomes-Gn; EBG00000997532.
DR   EnsemblGenomes-Gn; EBG00000997533.
DR   EnsemblGenomes-Gn; EBG00000997534.
DR   EnsemblGenomes-Gn; EBG00000997535.
DR   EnsemblGenomes-Gn; EBG00000997536.
DR   EnsemblGenomes-Gn; EBG00000997537.
DR   EnsemblGenomes-Gn; EBG00000997538.
DR   EnsemblGenomes-Gn; EBG00000997539.
DR   EnsemblGenomes-Gn; EBG00000997540.
DR   EnsemblGenomes-Gn; EBG00000997541.
DR   EnsemblGenomes-Gn; EBG00000997542.
DR   EnsemblGenomes-Gn; EBG00000997543.
DR   EnsemblGenomes-Gn; EBG00000997544.
DR   EnsemblGenomes-Gn; EBG00000997545.
DR   EnsemblGenomes-Gn; EBG00000997546.
DR   EnsemblGenomes-Gn; EBG00000997547.
DR   EnsemblGenomes-Gn; EBG00000997548.
DR   EnsemblGenomes-Gn; EBG00000997549.
DR   EnsemblGenomes-Gn; EBG00000997550.
DR   EnsemblGenomes-Gn; EBG00000997551.
DR   EnsemblGenomes-Gn; EBG00000997552.
DR   EnsemblGenomes-Gn; EBG00000997553.
DR   EnsemblGenomes-Gn; EBG00000997554.
DR   EnsemblGenomes-Gn; EBG00000997555.
DR   EnsemblGenomes-Gn; EBG00000997556.
DR   EnsemblGenomes-Gn; EBG00000997557.
DR   EnsemblGenomes-Gn; EBG00000997558.
DR   EnsemblGenomes-Gn; EBG00000997559.
DR   EnsemblGenomes-Gn; EBG00000997560.
DR   EnsemblGenomes-Gn; EBG00000997561.
DR   EnsemblGenomes-Gn; EBG00000997562.
DR   EnsemblGenomes-Gn; EBG00000997563.
DR   EnsemblGenomes-Gn; EBG00000997564.
DR   EnsemblGenomes-Gn; EBG00000997565.
DR   EnsemblGenomes-Gn; EBG00000997566.
DR   EnsemblGenomes-Gn; EBG00000997567.
DR   EnsemblGenomes-Gn; EBG00000997568.
DR   EnsemblGenomes-Gn; EBG00000997569.
DR   EnsemblGenomes-Gn; EBG00000997570.
DR   EnsemblGenomes-Gn; EBG00000997571.
DR   EnsemblGenomes-Gn; EBG00000997572.
DR   EnsemblGenomes-Gn; EBG00000997573.
DR   EnsemblGenomes-Gn; EBG00000997574.
DR   EnsemblGenomes-Gn; EBG00000997575.
DR   EnsemblGenomes-Gn; EBG00000997576.
DR   EnsemblGenomes-Gn; EBG00000997577.
DR   EnsemblGenomes-Gn; EBG00000997578.
DR   EnsemblGenomes-Gn; EBG00000997579.
DR   EnsemblGenomes-Gn; EBG00000997580.
DR   EnsemblGenomes-Gn; EBG00000997581.
DR   EnsemblGenomes-Gn; EBG00000997582.
DR   EnsemblGenomes-Gn; EBG00000997583.
DR   EnsemblGenomes-Gn; EBG00000997584.
DR   EnsemblGenomes-Gn; TPASS_r0001.
DR   EnsemblGenomes-Gn; TPASS_r0002.
DR   EnsemblGenomes-Gn; TPASS_r0003.
DR   EnsemblGenomes-Gn; TPASS_r0004.
DR   EnsemblGenomes-Gn; TPASS_r0005.
DR   EnsemblGenomes-Gn; TPASS_r0006.
DR   EnsemblGenomes-Gn; TPASS_t0001.
DR   EnsemblGenomes-Gn; TPASS_t0002.
DR   EnsemblGenomes-Gn; TPASS_t0003.
DR   EnsemblGenomes-Gn; TPASS_t0004.
DR   EnsemblGenomes-Gn; TPASS_t0005.
DR   EnsemblGenomes-Gn; TPASS_t0006.
DR   EnsemblGenomes-Gn; TPASS_t0007.
DR   EnsemblGenomes-Gn; TPASS_t0008.
DR   EnsemblGenomes-Gn; TPASS_t0009.
DR   EnsemblGenomes-Gn; TPASS_t0010.
DR   EnsemblGenomes-Gn; TPASS_t0011.
DR   EnsemblGenomes-Gn; TPASS_t0012.
DR   EnsemblGenomes-Gn; TPASS_t0013.
DR   EnsemblGenomes-Gn; TPASS_t0014.
DR   EnsemblGenomes-Gn; TPASS_t0015.
DR   EnsemblGenomes-Gn; TPASS_t0016.
DR   EnsemblGenomes-Gn; TPASS_t0017.
DR   EnsemblGenomes-Gn; TPASS_t0018.
DR   EnsemblGenomes-Gn; TPASS_t0019.
DR   EnsemblGenomes-Gn; TPASS_t0020.
DR   EnsemblGenomes-Gn; TPASS_t0021.
DR   EnsemblGenomes-Gn; TPASS_t0022.
DR   EnsemblGenomes-Gn; TPASS_t0023.
DR   EnsemblGenomes-Gn; TPASS_t0024.
DR   EnsemblGenomes-Gn; TPASS_t0025.
DR   EnsemblGenomes-Gn; TPASS_t0026.
DR   EnsemblGenomes-Gn; TPASS_t0027.
DR   EnsemblGenomes-Gn; TPASS_t0028.
DR   EnsemblGenomes-Gn; TPASS_t0029.
DR   EnsemblGenomes-Gn; TPASS_t0030.
DR   EnsemblGenomes-Gn; TPASS_t0031.
DR   EnsemblGenomes-Gn; TPASS_t0032.
DR   EnsemblGenomes-Gn; TPASS_t0033.
DR   EnsemblGenomes-Gn; TPASS_t0034.
DR   EnsemblGenomes-Gn; TPASS_t0035.
DR   EnsemblGenomes-Gn; TPASS_t0036.
DR   EnsemblGenomes-Gn; TPASS_t0037.
DR   EnsemblGenomes-Gn; TPASS_t0038.
DR   EnsemblGenomes-Gn; TPASS_t0039.
DR   EnsemblGenomes-Gn; TPASS_t0040.
DR   EnsemblGenomes-Gn; TPASS_t0041.
DR   EnsemblGenomes-Gn; TPASS_t0042.
DR   EnsemblGenomes-Gn; TPASS_t0043.
DR   EnsemblGenomes-Gn; TPASS_t0044.
DR   EnsemblGenomes-Gn; TPASS_t0045.
DR   EnsemblGenomes-Tr; EBT00001523337.
DR   EnsemblGenomes-Tr; EBT00001523338.
DR   EnsemblGenomes-Tr; EBT00001523340.
DR   EnsemblGenomes-Tr; EBT00001523341.
DR   EnsemblGenomes-Tr; EBT00001523342.
DR   EnsemblGenomes-Tr; EBT00001523344.
DR   EnsemblGenomes-Tr; EBT00001523346.
DR   EnsemblGenomes-Tr; EBT00001523348.
DR   EnsemblGenomes-Tr; EBT00001523349.
DR   EnsemblGenomes-Tr; EBT00001523350.
DR   EnsemblGenomes-Tr; EBT00001523352.
DR   EnsemblGenomes-Tr; EBT00001523353.
DR   EnsemblGenomes-Tr; EBT00001523355.
DR   EnsemblGenomes-Tr; EBT00001523356.
DR   EnsemblGenomes-Tr; EBT00001523358.
DR   EnsemblGenomes-Tr; EBT00001523359.
DR   EnsemblGenomes-Tr; EBT00001523361.
DR   EnsemblGenomes-Tr; EBT00001523362.
DR   EnsemblGenomes-Tr; EBT00001523364.
DR   EnsemblGenomes-Tr; EBT00001523365.
DR   EnsemblGenomes-Tr; EBT00001523367.
DR   EnsemblGenomes-Tr; EBT00001523368.
DR   EnsemblGenomes-Tr; EBT00001523370.
DR   EnsemblGenomes-Tr; EBT00001523371.
DR   EnsemblGenomes-Tr; EBT00001523373.
DR   EnsemblGenomes-Tr; EBT00001523375.
DR   EnsemblGenomes-Tr; EBT00001523377.
DR   EnsemblGenomes-Tr; EBT00001523379.
DR   EnsemblGenomes-Tr; EBT00001523381.
DR   EnsemblGenomes-Tr; EBT00001523382.
DR   EnsemblGenomes-Tr; EBT00001523384.
DR   EnsemblGenomes-Tr; EBT00001523385.
DR   EnsemblGenomes-Tr; EBT00001523386.
DR   EnsemblGenomes-Tr; EBT00001523388.
DR   EnsemblGenomes-Tr; EBT00001523389.
DR   EnsemblGenomes-Tr; EBT00001523391.
DR   EnsemblGenomes-Tr; EBT00001523393.
DR   EnsemblGenomes-Tr; EBT00001523394.
DR   EnsemblGenomes-Tr; EBT00001523395.
DR   EnsemblGenomes-Tr; EBT00001523397.
DR   EnsemblGenomes-Tr; EBT00001523399.
DR   EnsemblGenomes-Tr; EBT00001523401.
DR   EnsemblGenomes-Tr; EBT00001523402.
DR   EnsemblGenomes-Tr; EBT00001523404.
DR   EnsemblGenomes-Tr; EBT00001523406.
DR   EnsemblGenomes-Tr; EBT00001523407.
DR   EnsemblGenomes-Tr; EBT00001523409.
DR   EnsemblGenomes-Tr; EBT00001523411.
DR   EnsemblGenomes-Tr; EBT00001523412.
DR   EnsemblGenomes-Tr; EBT00001523414.
DR   EnsemblGenomes-Tr; EBT00001523415.
DR   EnsemblGenomes-Tr; EBT00001523416.
DR   EnsemblGenomes-Tr; EBT00001523418.
DR   EnsemblGenomes-Tr; EBT00001523419.
DR   EnsemblGenomes-Tr; EBT00001523421.
DR   EnsemblGenomes-Tr; EBT00001523424.
DR   EnsemblGenomes-Tr; TPASS_r0001-1.
DR   EnsemblGenomes-Tr; TPASS_r0002-1.
DR   EnsemblGenomes-Tr; TPASS_r0003-1.
DR   EnsemblGenomes-Tr; TPASS_r0004-1.
DR   EnsemblGenomes-Tr; TPASS_r0005-1.
DR   EnsemblGenomes-Tr; TPASS_r0006-1.
DR   EnsemblGenomes-Tr; TPASS_t0001-1.
DR   EnsemblGenomes-Tr; TPASS_t0002-1.
DR   EnsemblGenomes-Tr; TPASS_t0003-1.
DR   EnsemblGenomes-Tr; TPASS_t0004-1.
DR   EnsemblGenomes-Tr; TPASS_t0005-1.
DR   EnsemblGenomes-Tr; TPASS_t0006-1.
DR   EnsemblGenomes-Tr; TPASS_t0007-1.
DR   EnsemblGenomes-Tr; TPASS_t0008-1.
DR   EnsemblGenomes-Tr; TPASS_t0009-1.
DR   EnsemblGenomes-Tr; TPASS_t0010-1.
DR   EnsemblGenomes-Tr; TPASS_t0011-1.
DR   EnsemblGenomes-Tr; TPASS_t0012-1.
DR   EnsemblGenomes-Tr; TPASS_t0013-1.
DR   EnsemblGenomes-Tr; TPASS_t0014-1.
DR   EnsemblGenomes-Tr; TPASS_t0015-1.
DR   EnsemblGenomes-Tr; TPASS_t0016-1.
DR   EnsemblGenomes-Tr; TPASS_t0017-1.
DR   EnsemblGenomes-Tr; TPASS_t0018-1.
DR   EnsemblGenomes-Tr; TPASS_t0019-1.
DR   EnsemblGenomes-Tr; TPASS_t0020-1.
DR   EnsemblGenomes-Tr; TPASS_t0021-1.
DR   EnsemblGenomes-Tr; TPASS_t0022-1.
DR   EnsemblGenomes-Tr; TPASS_t0023-1.
DR   EnsemblGenomes-Tr; TPASS_t0024-1.
DR   EnsemblGenomes-Tr; TPASS_t0025-1.
DR   EnsemblGenomes-Tr; TPASS_t0026-1.
DR   EnsemblGenomes-Tr; TPASS_t0027-1.
DR   EnsemblGenomes-Tr; TPASS_t0028-1.
DR   EnsemblGenomes-Tr; TPASS_t0029-1.
DR   EnsemblGenomes-Tr; TPASS_t0030-1.
DR   EnsemblGenomes-Tr; TPASS_t0031-1.
DR   EnsemblGenomes-Tr; TPASS_t0032-1.
DR   EnsemblGenomes-Tr; TPASS_t0033-1.
DR   EnsemblGenomes-Tr; TPASS_t0034-1.
DR   EnsemblGenomes-Tr; TPASS_t0035-1.
DR   EnsemblGenomes-Tr; TPASS_t0036-1.
DR   EnsemblGenomes-Tr; TPASS_t0037-1.
DR   EnsemblGenomes-Tr; TPASS_t0038-1.
DR   EnsemblGenomes-Tr; TPASS_t0039-1.
DR   EnsemblGenomes-Tr; TPASS_t0040-1.
DR   EnsemblGenomes-Tr; TPASS_t0041-1.
DR   EnsemblGenomes-Tr; TPASS_t0042-1.
DR   EnsemblGenomes-Tr; TPASS_t0043-1.
DR   EnsemblGenomes-Tr; TPASS_t0044-1.
DR   EnsemblGenomes-Tr; TPASS_t0045-1.
DR   EuropePMC; PMC2408589; 18482458.
DR   EuropePMC; PMC3373638; 22720110.
DR   EuropePMC; PMC3416249; 22661689.
DR   EuropePMC; PMC3447947; 23029591.
DR   EuropePMC; PMC3460781; 22925589.
DR   EuropePMC; PMC3769245; 24058545.
DR   EuropePMC; PMC5049926; 27488881.
DR   EuropePMC; PMC5189996; 27344187.
DR   EuropePMC; PMC5659262; 25844928.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000805.
DR   SILVA-SSU; CP000805.
XX
CC   Source DNA available from Steven J. Norris, Department of Pathology
CC   and Laboratory Medicine, University of Texas-Houston Medical
CC   School, 6431 Fannin Street, Houston,  TX 77030, USA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1139457
FT                   /organism="Treponema pallidum subsp. pallidum SS14"
FT                   /sub_species="pallidum"
FT                   /strain="SS14"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:455434"
FT   gene            4..1398
FT                   /gene="dnaA"
FT                   /locus_tag="TPASS_0001"
FT   CDS_pept        4..1398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="TPASS_0001"
FT                   /product="chromosomal replication initiation protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70430"
FT                   /db_xref="GOA:B2S1V1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1V1"
FT                   /protein_id="ACD70430.1"
FT                   /translation="MDAVGYEVFWNETLSQIRSESTEAEFNMWFAHLFFIASFENAIEI
FT                   AVPSDFFRIQFSQKYQEKLERKFLELSGHPIKLLFAVKKGTPHGNTAPPKHVHTYLEKN
FT                   SPAEVPSKKSFHPDLNRDYTFENFVSGEETKFSHSAAISVSKNPGTSYNPLLIYGGVGL
FT                   GKTHLMQAIGHEIYKTTDLNVIYVTAENFGNEFISTLLNKKTQDFKKKYRYTADVLLID
FT                   DIHFFENKDGLQEELFYTFNELFEKKKQIIFTCDRPVQELKNLSSRLRSRCSRGLSTDL
FT                   NMPCFETRCAILIKKIQNYNSTYPHKAIHISDDVVRLVSENISSNIRDLEGALTKIIAF
FT                   IEVSGSITIDIVPSLLKEFFLSARPKHITVETILHVVADHFNISYSDLKGKKRNKSVVY
FT                   PRQIAMFLSKELTELSTTELGIEFGGRDHSTVIYGCQKIEGEILTNPSLQANLDLLKSK
FT                   VQDSIR"
FT   gene            1641..2756
FT                   /gene="dnaN"
FT                   /locus_tag="TPASS_0002"
FT   CDS_pept        1641..2756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="TPASS_0002"
FT                   /product="DNA-directed DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70431"
FT                   /db_xref="GOA:A0A0H3BI08"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI08"
FT                   /protein_id="ACD70431.1"
FT                   /translation="MKILCEKEAFLKEISTAQEVISNKKNTSIFSNVLLAAQGALLTIR
FT                   ATDTKVTFETSIPVNVLAEGTTTVFCDKLVNVVSALPTKEIELTLCEEQLVITPPNKKI
FT                   SFQLRTLSHESFPCFPQNEGGVSLAVPTSDLRNMINHTVFAVSEDSTRHFINGVHVDFQ
FT                   YGNIICVSTDGKRLAYIEKKGESSPQSFSGVIVPTKILGIVNRKLTPEGSVTLCITSQH
FT                   VYFFFGGYKFSSVLIEGQFPNYKRVIPDHQERSFCVGRVELMEALKRVSLLVEQKSHRI
FT                   FITIQQGLLTLSSKAHTQENEIGDAQEEIACAYTGESEVIALNYLYLEEPLKVFTSKEV
FT                   QVEFTDPAKALTLRAVPNTDCFHIIMPMQTE"
FT   gene            2623..3834
FT                   /gene="recF"
FT                   /locus_tag="TPASS_0003"
FT   CDS_pept        2623..3834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="TPASS_0003"
FT                   /product="recombination protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70432"
FT                   /db_xref="GOA:A0A0H3BHA4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHA4"
FT                   /protein_id="ACD70432.1"
FT                   /translation="MKNRLRFLLRRRFKWNLPILQKHSRFVLYQTRTAFTSLCLCKRSD
FT                   SLPFLTVTAINFRNLAHHTIDISSPEVFFVGNNGQGKTNILEVLYLAAYGNSFRTRTES
FT                   ELYATHARSNEYRVKVMYRGEYTHTVQIFSKNGKKRIEKNLKKIRTKKELISSIPCILF
FT                   FHNDLDFVVGTPERRRFFLDQSLSMCNPLYLEYLQKYHALTKTKNREIKEKRVQLLDAL
FT                   DTQIATVGFDLVQWRTQLVRDFNVIFTKYYERLGDLAQVRIEYKPSWSDSSVEEIVHSL
FT                   YKRRKHDLAMGMSMSGPHRDKIHFTRSQALFIPQASTGQRRLVSLVLRMSQAVFYTGVT
FT                   GKLPVLLMDDVLLELDPEKRERFMMSLPPYDQLFCTFLPGEAYRRYGREKTRVYFVSEG
FT                   ACHE"
FT   gene            3827..4264
FT                   /locus_tag="TPASS_0004"
FT   CDS_pept        3827..4264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70433"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI40"
FT                   /protein_id="ACD70433.1"
FT                   /translation="MNNGVNKLSDLLVLTTEYIQASYETEAFDAHREWVCIVGNPVALH
FT                   STLVDIRNGKVVVKVTHPGWAQYLLLKKDEIVHALRRRYPSLGVTGMSTYVDSTSRTPS
FT                   AKKDMQGLSVSEKQTRPVPELAEVFEQLRTLFQVKTEEPSH"
FT   gene            4391..6832
FT                   /gene="gyrA"
FT                   /locus_tag="TPASS_0005"
FT   CDS_pept        4391..6832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="TPASS_0005"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing) subunit A"
FT                   /note="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70434"
FT                   /db_xref="GOA:A0A0H3BJF4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJF4"
FT                   /protein_id="ACD70434.1"
FT                   /translation="MEEISTPEGGVLVPISIETEVKRAYIDYSMSVIVSRALPDVRDGL
FT                   KPVHRRILYAMEEKGLRFSGPTRKCAKIVGDVLGSFHPHGDASVYDALVRLGQDFSLRY
FT                   PVIHPQGNFGTIGGDPPAAYRYTEAKMARIAESMVEDIKKETVSFVPNFDDSDVEPTVL
FT                   PGRFPFLLANGSSGIAVGMTTNMPPHNLREIAAAISAYIENPNLSIQELCDCINGPDFP
FT                   TGGIIFGKNGIRQSYETGRGKIVVRARFTIETDSKGRDTIIFTEVPYQVNTTMLVMRIG
FT                   ELARAKVIEGIANVNDETSDRTGLRIVVELKKGTPAQVVLNHLFAKTPLQSSFNVINLA
FT                   LVEGRPRMLTLKDLVRYFVEHRVDVVTRRAHFELRKAQERIHLVRALIRALDAIDKIIT
FT                   LIRHSQNTELAKQRLREQFDFDNVQAQAIVDMQMKRLTGLEVESLRTELKDLTELISSL
FT                   EELLTSPQKVLGVVKKETRDIADMFGDDRRTDIVSNEIEYLDVEDFIQKEEMVILISHL
FT                   GYIKRVPVSAYRNQNRGGKGSSSANLAAHDFISQIFTASTHDYVMFVTSRGRAYWLKVY
FT                   GIPESGRANRGSHIKSLLMVATDEEITAIVSLREFSNKSYVFMATARGVVKKVTTDNFV
FT                   NAKTRGIIALKLSGGDTLVSAVLVQDEDEVMLITRQGKALRMSGREVREMGRNSSGVIG
FT                   IKLTSEDLVAGVLRVSEQRKVLIMTENGYGKRVSFSEFSVHGRGTAGQKIYTQTDRKGA
FT                   IIGALAVLDTDECMCITGQGKTIRVDVCAISVLGRGAQGVRVLDIEPSDLVVGLSCVMQ
FT                   G"
FT   gene            7014..7967
FT                   /locus_tag="TPASS_0006"
FT   CDS_pept        7014..7967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0006"
FT                   /product="protein Tp75"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70435"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJI8"
FT                   /protein_id="ACD70435.1"
FT                   /translation="MGTRVRFSFCGIAGVCLLALGFLVSCSLQSSRSATKKSEARRTSY
FT                   RIGLMTSTGSQSVDDVLAKTRLVSIYGEARGETGGRIVHVTYSDNFSHDHEATVSKLLA
FT                   LAEDSTIKAIVVSQAVPGVSKAFGIIKSKRPDVLLFAGEPLEPVEMLQESADIVVSQDY
FT                   LFGGYAVPWVAERMGARTLVHVSFPRHMSYPGLRVRRTVMRAACTDLGLSFAHEEAPDP
FT                   VDGVSDGELEDFFHKTIVKWIKKYGKETLFYCTNDAHNRPLISALLKYGGMLIGATIFD
FT                   YADALGVHYAELEDVYKIREKVEKSLVASAQRGALD"
FT   gene            7991..8260
FT                   /locus_tag="TPASS_0008"
FT   CDS_pept        7991..8260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI12"
FT                   /protein_id="ACD70436.1"
FT                   /translation="MTMGFVEYARKIIDGEPRKDDMREALAESFDLFTRDAHWRIAPYL
FT                   RLKTHEIVPNHVLVYTDTYVLGKFTLPVTDQVLPEGYWALTAKE"
FT   gene            complement(8340..10164)
FT                   /pseudo
FT                   /gene="tprA"
FT                   /locus_tag="TPASS_0009"
FT                   /note="protein TprA; frameshift"
FT   gene            10237..10362
FT                   /locus_tag="TPASS_0010"
FT   CDS_pept        10237..10362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHA8"
FT                   /protein_id="ACD70437.1"
FT                   /translation="MGGKKSHFLGRRIEGTGRGVVPFVRKLSEVVKKITADGKKC"
FT   gene            10396..12378
FT                   /gene="tprB"
FT                   /locus_tag="TPASS_0011"
FT   CDS_pept        10396..12378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprB"
FT                   /locus_tag="TPASS_0011"
FT                   /product="protein TprB"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70438"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI46"
FT                   /protein_id="ACD70438.1"
FT                   /translation="MGACISVYARFALGCGVFFLHGAVLDGVSRAFSSSAAFSGSAELS
FT                   WGVVFDAEGASPVTAGKSIRHGFRTKSSWKLAFPLLPKKGATYTSFSGEDPIWVELSLK
FT                   GLKVDFESALGSGTADPSMTTRSPFLKSGRSDFSLEATLHLYDVSFSVGKDPVFPSNFA
FT                   QLWTPFITTSYESRSVKYAPGFGGVGGKIAYQARNISNSGITFNCALSFSSNGIWKSAP
FT                   SVTSKVKGKGTNSRRMPADPHSKYGLGTEFTLVYARKGREQVRLEAASCATLSAGYRTG
FT                   PDQTHHQNKDTVLWNVGARLTLSPGAGFKIVCAFDAGTPYKKGAARESLAETLAAQRGC
FT                   NRFDTALMHALGLLVAAAKTRNELAAQMRSQSPPGVWEKFEQAVQSLPPITQGKPGVVG
FT                   AEVRPGTMWMELSPVRKALVDVLSVLEQGGFDRVAFDALLIVQWRWISLGAYVASAPTN
FT                   VFGSMLFPRGSSDHFDCAAFVRVESKWYDSLSKLVSGLSGGVEARLYIPFTHGLYLEPG
FT                   SCTPNSTRGKKPQAFVLPPPGVVHPGAHSALPVVGKLWLNYRITLAAHAWIRPMVSLYG
FT                   ATYGAQGFSYGPGGAAGTVKRNRTFRAGKNLYYQVGVAVSPFERCELLIEWSQGMLARR
FT                   PYISLEHGSWPDKRSELVCSCKVLW"
FT   gene            12372..12545
FT                   /locus_tag="TPASS_0012"
FT   CDS_pept        12372..12545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJG0"
FT                   /protein_id="ACD70439.1"
FT                   /translation="MVREPSIRGREGIPFWFAHDDFLMLYHKYTIDFPVGGWTIRLSVL
FT                   ERWCVQIVKGRL"
FT   gene            12542..13207
FT                   /locus_tag="TPASS_0013"
FT   CDS_pept        12542..13207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70440"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJJ3"
FT                   /protein_id="ACD70440.1"
FT                   /translation="MKSQFLLKVWVVCVGALLCRCGGARAPQNTGGTKAVEDYHIGVMT
FT                   GPGSHSSHDVVAAKRACAMYGAVGDGHRGCILHVTYPEDFVNRQDETVSRLLAFADDPL
FT                   MGAIVVSEGIHGTAEAFNKIRAKRSDIMLFVGDPHEYPELIQKSADIVVSDDYAFGGYA
FT                   IPWAAKKMGARTLVHVSFPRHLSKAELRTRRQVMEAVCADIGIEFASEEAPDPAGVRC"
FT   gene            13164..13772
FT                   /locus_tag="TPASS_0014"
FT   CDS_pept        13164..13772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70441"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI17"
FT                   /protein_id="ACD70441.1"
FT                   /translation="MRLRRLQIPQESGVEGARAFIGTHTKQWIGKYGKNTMFFCTNDTH
FT                   RVSLMRELVSKDGMLLGANVFDCAEALGVEYADDEDVSGILERVESAVEEKRLVGRFGV
FT                   NVSSHIFVSTLGLTEYARRILQNELREKDMRVALSDAFSLFSKGTRWRVAPYTDLLTGK
FT                   EVSNHVSVFSDIHILGKFSLPVTDQEFPEKYRSIRFGRQ"
FT   gene            13963..15777
FT                   /gene="pheT"
FT                   /locus_tag="TPASS_0015"
FT   CDS_pept        13963..15777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="TPASS_0015"
FT                   /product="phenylalanyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70442"
FT                   /db_xref="GOA:B2S1W3"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR022918"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1W3"
FT                   /protein_id="ACD70442.1"
FT                   /translation="MPKISIHEALFFELLGERCDDDTLERRLRSAKAELECSSFSVRED
FT                   KEGGSLSPGGEVCDPVQRTRGQASCVREGAFDARLLKIELNDTNRPDLWSTAGLARLLR
FT                   VHAGGASRAAQYRAFLSDRCTVRDSYGRCVVVDARLQTIRPFIAGFVARGTGLSEVRLW
FT                   DLIQTQERLASNFGRRRCTLSLGCYRAQDICWPLAYRAVLLAEVSFTPLGMSMPLSGEQ
FT                   ILTQHPKGREYGHLLKDYSFVPLLVDARGEVLSLIPITNSASLGAVVTGDTELFIECSG
FT                   TDMCAVLVAVNSLACDLSDMGMQIEPVQITYSFDTPWGRSVTTPFYFQEKREVAHEQID
FT                   RLLGMPLPVADITEAFARMDCAVQVKQGTYVVEPAAYRNDFLHAVDLIEEVMLGRTLDR
FT                   FSPQVPCSFTVGRLSDLTLLTRKIKHLLVGFGYQEMIFHYLGSAREFCTRMRCTADDLI
FT                   EIENPLTESYRFVRRSIIPCLLSAELKSAHALYPHRIFEIGKVAFCSPHGEHGTCTQQS
FT                   LGFLNASQEASYNEVASLVSGLLYCLKLPYQVEEAQDPRFVLGRQASICVHGSRVGIFG
FT                   EIHPQVLSNWDIRMPCFAGELDVGALLP"
FT   gene            15740..18313
FT                   /gene="lon1"
FT                   /locus_tag="TPASS_0016"
FT   CDS_pept        15740..18313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon1"
FT                   /locus_tag="TPASS_0016"
FT                   /product="ATP-dependent protease LA"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70443"
FT                   /db_xref="GOA:A0A0H3BHB3"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHB3"
FT                   /protein_id="ACD70443.1"
FT                   /translation="MLGNLMLGPYCRSSLWRELSWQEVTGIVAPDTIAYLKARAQDHPF
FT                   LLAHERACAAIRLGMRMYGDGYNICVIGASGTGKRTTLQYLLKDFVPRPEQMWDIAYAY
FT                   NFVHPHEPQVLQFPAGEGMPFATALRRSVNAILNTAQDIVKSDAFLRERRTLLADIETR
FT                   ECAELSRIEAELYTRGFRVRWHRKRGTYSFDLVPLLKGKDSSFEALHDLASRAKLSRCV
FT                   VHELHARYRLSCDEVSSLLHTLRTARRAARRRLAQYYRARLRLIILEQMACIKKRVACY
FT                   APVFSPPPVSCAAEQTEREKTSSSRLIEVPHEFEEMRARIISYIERIQTDVQVRVQCLM
FT                   SMRISALVKKRFFDRYTLNFVCVHTEHAGYVFTEHQPNLANLCGSIESKGNEGDTLENG
FT                   HLRIRAGALHRAHAGVLIVQLEDLLAEEEAWTHLKRALRTKQVLLPAGSSQSQGMLRPE
FT                   GVPLTCKLVLVGEPCSFERLSQEDSSFRELFKVCAEFDTSMPNSDKNQVALIAYLDRVV
FT                   ARYGTFSLDSSAYARLLAYAEELAESHTRLSTSFVQIADLVLESHAVAVDMHPDVSVIT
FT                   AHVVQEALNRRQYVCSRARERFQRMIACGELLVEVQGYRIGRINALAIEEHCGHSFGIV
FT                   ISLTAQASAGKEGVMNIEREAGLSGEIYDKAHLIITSLLREKCLSAFADAAFDPAVDDL
FT                   GKGQDSFPLCLSAALCFEQSYHGIDGDSASAAEFLVLLSAIGRFPLRQDRAITGSVNQL
FT                   GQVQAIGGVSEKISGFYDVCALNGLTGMQGVLIPKSSCAQLFLPERVQDAVRAGTFHVW
FT                   AVCTIDDALELMVPDDLKEQGSAQLYQCVRARLRDFYVTVKGHCE"
FT   gene            18401..19348
FT                   /locus_tag="TPASS_0017"
FT   CDS_pept        18401..19348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70444"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI51"
FT                   /protein_id="ACD70444.1"
FT                   /translation="MVARSIRVELESALDLLKQGDLRQAHQDLQDLLQKELDNRDVLYA
FT                   LTGIRFWEDRMQRVHTISGGLSQGEYLVGQWGAFVAYMQKRGGVVEPVMYALRCCVFTY
FT                   ALRFYGSLITGDAREHPAEVYRKTGLCYKALGNYDAARECLEFAVSLEPDSSAILAELA
FT                   DAYALAGDERWSKLYFREALFKGASKLELNLLESDLIFSLIERVKSYGFSGVELLEWLP
FT                   VYGTLEGVLTAKRELRAVEIGKLKQAIYSLENDLRNEKVSAERRLLRPRLINHFFWLVD
FT                   HYVNVQEDKRNIDEVLLKIKLLDEAVYHRYVRIA"
FT   gene            19415..21388
FT                   /locus_tag="TPASS_0018"
FT   CDS_pept        19415..21388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0018"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70445"
FT                   /db_xref="GOA:A0A0H3BJG6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJG6"
FT                   /protein_id="ACD70445.1"
FT                   /translation="MDTRDLTAYSAEKFKELDRIIAEAKRQSILDVLKGICDEHLAHSK
FT                   NSIIALYISGIISLSKQLLDDSCLVTLLTIFGDNHKNQIVEHLCTRVLEYGESKLALRA
FT                   LGECYKTSGNEQLYDVWERLVRIDYEEAEITRVLADKYEQEGNKEKATEFYKKALYRFI
FT                   ARRQNAAIKEVWTKLVALIPDDVEFFYREQKKISEKLGEGRGSVLMQDVYVYYKENEDW
FT                   TTCINILKHILEHDEKDVWARKEIIENFRCKYRGHSQLEEYLKISNISQSWRNVFEAIN
FT                   DFEKHISFDEGSFVFHRTWGVGRIAKVCNDELLIDFAKRRAHTMLLKMAISALQTLGKE
FT                   HIWVLKSVLKRQDLAAKIKQDPEWALKVIITSFDNNCNLKKVKQELVPSLLSVGEWTSW
FT                   STKARKILKESTGFAANPSNIDFYTVRSCPVSLEEKLAVEFKAQKNFFARIDILNTFMD
FT                   KADTDSDAFREMFDYFNTFLRAFSVVDGNVIAAYLVVTRVSTVLPHLNACRPHGFADLY
FT                   AHIADPRLVYTEIKDKGLKWEFVNSVKNFVSNWSDEYVKLFPEVLSLEILRALMEEGYK
FT                   EKALRVVEACFEYYADNRAAVIWLFKTVRMSLGSRSCALPQNSGLSSSSTLWTLLIGKS
FT                   LTGGTPLRTENLTAGSFGTLWE"
FT   gene            21555..22043
FT                   /gene="greA"
FT                   /locus_tag="TPASS_0019"
FT   CDS_pept        21555..22043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="TPASS_0019"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70446"
FT                   /db_xref="GOA:B2S1W7"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1W7"
FT                   /protein_id="ACD70446.1"
FT                   /translation="MVSGRGLVVTAKMLNAKKKELQDLLDVRIPENSREIGRALELGDL
FT                   RENAEYKAAREEQTRLNNMVTRLQEEIERAQVFDPTTVVAGRVSFGTVISLKNHTSGED
FT                   ETYTILGPWESAPERGIISYMSPLGSNLLNRKTGEQLAFTVGEHEKVYEILSISAAEI"
FT   gene            22043..24166
FT                   /locus_tag="TPASS_0020"
FT   CDS_pept        22043..24166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0020"
FT                   /product="protein 76K"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70447"
FT                   /db_xref="GOA:A0A0H3BJJ8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011191"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJJ8"
FT                   /protein_id="ACD70447.1"
FT                   /translation="MRKCAMRIMRRLMLFLMCLCAALFAQELVREQSVTKSADITVLLD
FT                   TSGTILPYRSVVSGSVLKDIATRFVRLGDSFHIISFSATPRHEISQVIRSEFDLSQVVS
FT                   RFMILHQLGLYSDFLTALDFARTHLRALPAAHEKILIVVSDGIFNPPARSAYKNYNKDQ
FT                   VKINLARAAADLRREQVRVFYIKLPFPQDIQIRDLDDNLLTDLQKTDDVQISAVGSFAE
FT                   GQTRRPKLDTVGVVSDQTGGVADNHAVATHGREDGTVQGVVGSHVEVARTQDRRSNADP
FT                   AKREGVRPSSEATDVSREFTEDLGIRVSPVDSDGSVRFSEKERTLPVLHFPRVLEVQGK
FT                   YAECMFEVENSTDAPVLLHLERVIFDNGVETDIVSVQTESCAVASGARAMLRTTFLLPK
FT                   RYHEEGTYQVTMRVQFADNVRVFPQVATAELRVSPLPFLGLVRRGIHGVLSSVGLTHAF
FT                   GYVLDMVGLSRTGFGAVLLPLFALAIFLVLVSAVVCRSKRVLSRKSWRGSPRTENGCQG
FT                   PGSMSDFRAHSVKEQRQDQERVYAGMERIVSQRKSDVQDRLSVLNAATAFGRDRVSFSP
FT                   RVTRAEHGCSRSGMTEIFVFDQTRAIGKRNIHVMKAGTRLGVGGHKGDDFLIFLVPFPR
FT                   RLAQVYFDGEVYHLAILKPRYFPYEESSVVHDCVGRVVTLVSDRGYHVPFTFRQYEDPA
FT                   VRLNNLLTSIEYA"
FT   gene            complement(24335..24422)
FT                   /locus_tag="TPASS_t0001"
FT   tRNA            complement(24335..24422)
FT                   /locus_tag="TPASS_t0001"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser1; codon recognized: UCC"
FT   gene            complement(24479..24567)
FT                   /locus_tag="TPASS_t0002"
FT   tRNA            complement(24479..24567)
FT                   /locus_tag="TPASS_t0002"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser2; codon recognized: UCG"
FT   gene            complement(24625..24698)
FT                   /locus_tag="TPASS_t0003"
FT   tRNA            complement(24625..24698)
FT                   /locus_tag="TPASS_t0003"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg1; codon recognized: CGC"
FT   gene            complement(24730..24816)
FT                   /locus_tag="TPASS_t0004"
FT   tRNA            complement(24730..24816)
FT                   /locus_tag="TPASS_t0004"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser3; codon recognized: AGC"
FT   gene            complement(24857..24941)
FT                   /locus_tag="TPASS_t0005"
FT   tRNA            complement(24857..24941)
FT                   /locus_tag="TPASS_t0005"
FT                   /product="tRNA-Ser"
FT                   /note="tRNA-Ser4; codon recognized: UCA"
FT   gene            25104..25370
FT                   /locus_tag="TPASS_0021"
FT   CDS_pept        25104..25370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI20"
FT                   /protein_id="ACD70448.1"
FT                   /translation="MDDARYAEWSASLVQLPDTHFFDLMRLYLGVLKTPFHKQRLVQQL
FT                   SAFLQRKSIQNAVVQMLDELDLLFISVVMCVPRATLELLTIFF"
FT   gene            25325..27493
FT                   /locus_tag="TPASS_0022"
FT   CDS_pept        25325..27493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHB8"
FT                   /protein_id="ACD70449.1"
FT                   /translation="MRSPCNARAADNFFLERVAQAEIRTRLLNLEERLILYRIPQMPGE
FT                   VTQAEVASVAQNGRVRQTPCYGINPLLQKALSTVAGLNLFLIPQKRMRPSAQLLTTDLM
FT                   LCALYSFFTHGENLLKVDGTFRKKAFVMFQALFPVDPDVVSVALPAYLQRAGEERGTSR
FT                   LLQEGRRVLEHLGLIVCESAQVHVQDKRWASFFSLTALERAVYLTVASTAILRKEVLVQ
FT                   RAQALRTLLCVLHPDAQYAPEDLTRVYRILVEEAAPSVAADFFSSLSLSKDTMLQKRKG
FT                   ALHDSSVFSMQSAITAIRTAQLFGLLCVKDGLCALNEALFKGQYTRGPGMVLSATAELT
FT                   IFPDGDMQGVLPILSCAHVCSLQTVATFELNKKSCTTGFARGLTVQALAQALECKTGEQ
FT                   VPQNILSSFRQWYAQITALTLRRGFVMQVDSSQQAFFESGGPLHPLVRTRLAEGVYFFD
FT                   ECQECMLYQALARARLSYLCEPIDTATPLFRPGEQGARALHVPSFSFPVRSARGVSEES
FT                   TRDFAHLGAFVLETPNVSCTHSAADTPSISEQTGGVAHVQSEEDVDPSTSGATGKYWDK
FT                   AQWRKVQRMRRAVRLQRLKEFEAHLQQLKLDATEQTELRARLQRGLILDRMQLSSETIR
FT                   RERTEASGVDFLGKYRLAECALRSGALLEIETSSGQSVHKIVGTVCAIEKCEEDALLHV
FT                   CVHAELPPERVSIARASRIVLLKNSIFS"
FT   gene            27554..28885
FT                   /locus_tag="TPASS_0023"
FT   CDS_pept        27554..28885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0023"
FT                   /product="sodium-and chloride-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70450"
FT                   /db_xref="GOA:A0A0H3BI56"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI56"
FT                   /protein_id="ACD70450.1"
FT                   /translation="MSRRKQGRELFNSHVGVVLSCVGAAMGLANVWLFPGRLVEFGGVT
FT                   FLIPYFIFLFGLSRFGLMGEYAFGKTLRCGPVRAFTRVCETHPSCFLRALRGSGWFPVG
FT                   VLLATCSFYVVIIGWILRYVVFSCTNALAGTQAHDLFYQVAGTSANVPWTLAAIALTAC
FT                   VVSAGVQKGVERGNIIMMVLFYGVLAFITGYIFTLPNAWIGMRRMLAFQSSSLCNPRLW
FT                   LYALGMSFFSLSLGGAAMVLYGSYMPDTVDIPRTAFQTATLDFLASGMSALCLIPSAWV
FT                   LGMDVSSGPEFLFVTITRVASQIPMGVMISVLFFLCVLCAALSSAIAMLEVILESFVHT
FT                   CTVGRRTLTWSLALVVAFVSLPLNASMRVFETFTDIVVVILSPLSALMGSVMIFWVYGA
FT                   ERCRVAINRCARGPLGKWFTPYMRYVYLGLCVMIMVLGVMFGGF"
FT   gene            29065..29775
FT                   /locus_tag="TPASS_0024"
FT   CDS_pept        29065..29775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70451"
FT                   /db_xref="GOA:A0A0H3BJH1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJH1"
FT                   /protein_id="ACD70451.1"
FT                   /translation="MKRFALIGLGDFGLSMLKELLKLTNNIVLLDRDRTLVETYRSRVR
FT                   IVRAIDVLDEFTLCKMIPQDINAAVIDLGVKIESSIMITTFLKKLEIADIVVKAYSAEQ
FT                   GHILSSVGATHVVLPDREAAKKVTPMIAFDLLFNFMPLSAQLAIAEMAVHEDYVGRTLR
FT                   EVDVRKNFSLNIIAIRKRDAEDFCFINDPEYCFEANDVLLVAGSHKDIYAQSQDKLAHT
FT                   HSFSDFFKQWFLTS"
FT   gene            complement(29854..32925)
FT                   /locus_tag="TPASS_0025"
FT   CDS_pept        complement(29854..32925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70452"
FT                   /db_xref="GOA:A0A0H3BJK3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK3"
FT                   /protein_id="ACD70452.1"
FT                   /translation="MSTLLHGFEIIWRHSLAELSAVGVYARHKKTGLELYHILNEDPEN
FT                   LFAFCFMTAEEASTGVAHILEHSVLCGSQHYPLKDPFLILAKQSVKTFLNALTFPDKTV
FT                   YPASSLVETDYFNVMSVYADAVFFPLIEEWTFKQEGHRFEFNEHNQLTLQGVVLNEMRG
FT                   VYADFHTLVYKHATHATTRGSVYAHDSGGHPTVIPRLTYESFKAFHKKHYHPSNCKLFL
FT                   YGNIPTEKQMAFIEDKCLSKFSARKALPPIPPIPAYQSPRTYTGYAPASEGMDLTRCAV
FT                   LLSWLLPESDKAEQLMDVFLLEHVLLGHDAAPLAQALLESELGEDLYAYNGSHIDLKRM
FT                   LFFVGMTGVQHTQVDALKACVFETLESLVAHGIPPQEVETALNALEFSNTEVRRSDGPF
FT                   SLVLMQRSLRGWLHGAGPESSLRYIPALQALREKVHHHPHYVENLILTHLLRNPQYTVL
FT                   SVHPDPDFSKKLDEQLEKYVQDFSRTLTQPAAARLRADQESLRVRQTTPDPEELLALLP
FT                   HIKREQLPVPTPELSETMQFFGSVPVLVHELATNDITYLHLAIPADMLSVKEAQLLPLY
FT                   GYALTGMGTETHHWSVVSAEIARLTGGFAARCIVAGDQGSEILPLLRGQNTLQRSDIVG
FT                   RAWLVVSVKMLSRFIVQAISYVCAHVRSLSFTDTRRLKDILAQYKNDLDSAAMHSGHSI
FT                   ALAKANARVNAAKAVEELWTGVTQIRLVRALWTECTETVASPSLAAKLKALHEKLLTAG
FT                   VIGCVCGTETSLHTALDALAKPLACFRAPLSTYFIHHTSAPTAHEQQIPSAHGVLFQEA
FT                   LQHMRTRNMLTLLPAPVQVGFAALSLAHPRLPLERRGVEQVFARYLSTEPFWEKIRTIG
FT                   GAYGAFTLPDPVHGIFSSLTYRDPNPLHSLDVIFKTIEHLHADHKGTSSLFNQKTMERL
FT                   IIGAYSTAVTPETPEHKSFASFLRFLNGTTETERIAAIEHILDARVTDMHLCTQLLWAQ
FT                   RTCAEAAVVSTATSIREAATLEPYFSKLEAEPPL"
FT   gene            complement(32954..33976)
FT                   /gene="fliG1"
FT                   /locus_tag="TPASS_0026"
FT   CDS_pept        complement(32954..33976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG1"
FT                   /locus_tag="TPASS_0026"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70453"
FT                   /db_xref="GOA:A0A0H3BI24"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI24"
FT                   /protein_id="ACD70453.1"
FT                   /translation="MNRTESPRGLIKATVREQDRGRTVYKKIAQFLSLIGEEQAALVLK
FT                   QLEPAQIEAVVAELLTLKPLSPEEAREILREFSALCARVSPVTGGLRAAQSMLSKAFGE
FT                   EKADLILKRAVPAAQPKPFEFLAALEASQLLPLLEGELPATKTLILSQLPPESAAHYLS
FT                   NISTEEKKDLIVRLAKLKHVNPQVLQVMSDSLHKKFAALHLSQRRDLDGHAVLAAILKK
FT                   MERATEHSILHALAEKNPTLAARVRTHLFTLDDIPALPDTFLQKHLASCSEKTLAALIN
FT                   TNHPAFVQKILSNLSKNRAQLVRDEYDTFPPSAHDTRTITEHFLATLRSAGAQQHIASK
FT                   "
FT   gene            34202..35425
FT                   /locus_tag="TPASS_0027"
FT   CDS_pept        34202..35425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0027"
FT                   /product="possible hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70454"
FT                   /db_xref="GOA:A0A0H3BHC3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHC3"
FT                   /protein_id="ACD70454.1"
FT                   /translation="MLSMLFSAAETAFCALNTLRLRYLYEKRHARARVAMRILRRKNFY
FT                   LAAVVIGNTLASSALSAVIALFARALFGIHAVGWSIGAGTVLTLLFGEIIPKSLALCRP
FT                   NAVALHTARFLQWSALMLTPFVQVFCMARSALLRLARVACHTPSLRVTDDDLHTVLYAG
FT                   EADGTVTSRERALYQRILHSASLTARDIMTCRAQLIAVPRASSLAEAIACAQKMRVSRV
FT                   PVYERSVDWIIGIFDVKKFLCSEEVDGRDLEECGTLMQHVSAPVFVFECTRLAYVQHKL
FT                   RAHSRAVAIVLDEYGGTAGLVTKHNIYQAFFKSSAHEFPVNSTGPQVTRAGVRAYIFPG
FT                   SLRLDEINDLLGTDFSSCTSETLAGLIMEYTGCIPDPGTTVVFGSWRCVVLQLHVRRIV
FT                   RVRFEFQG"
FT   gene            35439..36800
FT                   /locus_tag="TPASS_0028"
FT   CDS_pept        35439..36800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0028"
FT                   /product="possible hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70455"
FT                   /db_xref="GOA:A0A0H3BI62"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI62"
FT                   /protein_id="ACD70455.1"
FT                   /translation="MAYPFLVGLELMFLLVCSALCAGSESALSSVNQDDERKLKRHSTR
FT                   CTQRLCWLLARREQLITTVIVQNTALNMVLSSVVTLGSMELWGAQSVWKALVAVTCVII
FT                   LCGEMFPKALGARYSLGFLMWIAPFLQLSYWLLYPCACVSSALMHVLEGIFLPRHTTCL
FT                   SREEIKTLIAVGAREGVISSTENQLFQRALQFKRIPLAHVMVPHTHFVSVFQDTPLSHV
FT                   WDAFRTCSFSQLLVHDAAGIVWGFVHYWDIFGESKVLPSQSSDQMVSACVANTRAAVHR
FT                   VGDLAQELCCVPNVADLFSVLDMLSVSKQQMALVVDERGDGEGLVTMTDIMEVIFGSLA
FT                   GVSEGVEGYTVHGSMVQRMSKPRVDFQMKSVGTHEILCSGTVPLEYFNEVLGTRLQSRV
FT                   YHTVGGLLLERFGRLPTVGDELVIEGLRFKIRRVLDRYVVSALVDTRACRSSVG"
FT   gene            36908..38185
FT                   /gene="murA"
FT                   /locus_tag="TPASS_0029"
FT   CDS_pept        36908..38185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="TPASS_0029"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70456"
FT                   /db_xref="GOA:A0A0H3BJH7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJH7"
FT                   /protein_id="ACD70456.1"
FT                   /translation="MSCYRVEGGFPVSGCIRVCGNKNAALPCIAAAVLTQEPVLLQNVP
FT                   DIEDVAVMLTIFRAFGGSVERRGNHEYMLHLPQLQTCEVPCEAAQKVRASILFAGPLLA
FT                   RGRKAVLPPPGGDVIGRRRLDTHFLALAALGAQVRLDGVFTFSANKLVGCDVFLDEASV
FT                   TATENVLMASVLAEGVTVITNAASEPHVQDLCHLLNAMGARVSGIGSNVLTIEGVSALH
FT                   GTTYTLGADFMEVGSLIGLAVVTRGALTISDVNVRDLRPLGFAFKKLGVIWSEQEHAVS
FT                   VSASQDLRVNYDFGGMIPKIDDGPWPAFPPDLTSIMTVVATQVEGVILIHEKMFESRMF
FT                   FVDKLITMGARIILCDPHRALVSGPSALHGSDLVSPDVRAGMAMVLAACCARGVSIIRN
FT                   VYQIERGYERLVERLQAIGVRIWKEG"
FT   gene            38304..39938
FT                   /gene="groEL"
FT                   /locus_tag="TPASS_0030"
FT   CDS_pept        38304..39938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="TPASS_0030"
FT                   /product="heat shock protein GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70457"
FT                   /db_xref="GOA:B2S1X8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1X8"
FT                   /protein_id="ACD70457.1"
FT                   /translation="MAKQLLFNEEARKKLLSGVEQISSAVKVTLGPKGRNVLLEKGYGA
FT                   PTVTKDGVSVAKEVELEDPFENMGAQLLKEVATKTNDVAGDGTTTATVLAYSMVREGLK
FT                   AVAAGMTPLELKRGMDKAVAIAVDDIKQNSKGIKSNEEVAHVASVSANNDKEIGRILAS
FT                   AIEKVGNDGVIDVDEAQTMETVTEFVEGMQFDRGYISSYFVTDRDRMETVYENPYILIY
FT                   DKSISTMKDLLPLLEKIAQTGRPLLIIAEDVEGEALATLVVNSLRGTLKTCAVKAPGFG
FT                   DRRKEMLEDIAILSGGQVISEDLGLKLESADIALLGQAKSVKVDKENTTIIDGSGKSKD
FT                   IKDRIEQIKKQIEASTSDYDSEKLKERLAKLSGGVAVIKIGAVTEVEMKEKKHRVEDAL
FT                   NATRAAIEEGIVAGGGLALIQAAAALEKADLSGLTPDEAVGFKIVRRALEEPIRQISEN
FT                   AGIDGAVVAEKAKEKRGIGFDASKMEWVDMIKVGIIDPAKVTRSALQNAASVSGLLLTT
FT                   ECAIAAIPEKSSSTPPAPDMGGMGGMY"
FT   gene            40002..40280
FT                   /locus_tag="TPASS_0031"
FT   CDS_pept        40002..40280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70458"
FT                   /db_xref="GOA:A0A0H3BJK9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK9"
FT                   /protein_id="ACD70458.1"
FT                   /translation="MDLGQRVVRVIPLAPLPVRVYNAGGLRVDFFPRFFGRSPQGVGVG
FT                   FARLKLSASVGSNGFRLTRAVWIFWLCFLVSGLSRAFLVYFLSVIRI"
FT   gene            complement(40277..41077)
FT                   /locus_tag="TPASS_0032"
FT   CDS_pept        complement(40277..41077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70459"
FT                   /db_xref="GOA:A0A0H3BI28"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI28"
FT                   /protein_id="ACD70459.1"
FT                   /translation="MNIVLFEQEEVVHGCAVLSFRDSRFCHIKRVLKLSAGACFKAGII
FT                   NGVKGSARISLATEKYLVAVFEKLEYEDCALFPLHLVIGFPRPIQLRRILRDVSSLGIS
FT                   SIHLVGTELGERSYLDSGLAHMEKMHTYLIRGLEQAGGTKLPLITVSESVRTFCSQHTH
FT                   ILGDSTHQKLILDTKNTLTDLGSAALRGDVLWIAIGSERGWTESERLLFSAMGFRAVDM
FT                   GRRTLRTETAACAACAVVLANAHAWKRKIPRPGKRSSPISRKNP"
FT   gene            complement(41074..41685)
FT                   /locus_tag="TPASS_0033"
FT   CDS_pept        complement(41074..41685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0033"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70460"
FT                   /db_xref="GOA:A0A0H3BHD0"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHD0"
FT                   /protein_id="ACD70460.1"
FT                   /translation="MSVFCLLLSFGRRCVAADNFLSFLVWNLVLAFIPWLISAILHVRR
FT                   FAVRSVQLFLMLLWLLFFPNAPYILTDIIHLGKGKSFLLYYDLIILLAYSFTGLFYAFV
FT                   SLHLIESILARDFHIKRPFIISVFELYLCAFGIYLGRFLRWNSWDIVLHGRTILSDIGI
FT                   RVIRPVFYVDTWMFVFFFGTMLVLYYQSYRSFLTHTRNDK"
FT   gene            complement(41786..42736)
FT                   /locus_tag="TPASS_0034"
FT   CDS_pept        complement(41786..42736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0034"
FT                   /product="ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70461"
FT                   /db_xref="GOA:A0A0H3BI67"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI67"
FT                   /protein_id="ACD70461.1"
FT                   /translation="MQRCSVVAALAGVVFLAQACSLSTPSRITHTDKLPVVVTFNALKE
FT                   LTQMVGGEKIHLVSIVPDGVDSHDFEPKAKHMAFISDAKVIVYNGLGMEPWIHSVLHAA
FT                   RNSGSIRVEAAQGIVPLKAHTRGHTAHHVHAHASHGSAYDPHVWLSVCNAQTMLRTIGK
FT                   ALCKADPQHTRFYKRNARNAAARLEALYKEYRSKFAALSHRYFVTTHAAFGYLCRDFDL
FT                   QQKSIKDVFNTEEPSIKRLVELVEFSKKHSVRTIFSERGPSEKVARVLAQEIGASVETI
FT                   YTMEKNEENLSYYERMKHNINRIYRACSKQVTPSQ"
FT   gene            42934..43650
FT                   /locus_tag="TPASS_0035"
FT   CDS_pept        42934..43650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0035"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70462"
FT                   /db_xref="GOA:A0A0H3BJI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJI3"
FT                   /protein_id="ACD70462.1"
FT                   /translation="MRIMASPFAVLLQNVSFRYTADARFILHEVDLAIPKGAYLSVVGE
FT                   NGSGKSTLVKLVLKLLKPSTGTIAHFVQRVGSVPQTKMHTLYFPLTVYEMLNSYRRLLR
FT                   ISHKWVVDAVLEEVGMRGAKKKLVYTLSGGELQKVYIARSLIGDPDLLVLDELSTGIDS
FT                   RGQKDIYALLKGLNTSRNVTVISVEHNLDAAITNSTQIFHLSEGHGHLCNPQQYVSEFL
FT                   DMQKKDALACAQCRSR"
FT   gene            43650..44450
FT                   /locus_tag="TPASS_0036"
FT   CDS_pept        43650..44450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0036"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70463"
FT                   /db_xref="GOA:A0A0H3BJL4"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJL4"
FT                   /protein_id="ACD70463.1"
FT                   /translation="MLQYAFMRNAFVASFLIALLCPLVGMHLVLRRYALMGDALAHGSL
FT                   AGVSIAVSCGIHPGWGSFFFTALVGVLIEFLRAFFKNHHDLILSIVLSLSVGIAVTLLS
FT                   SGLIQADIDSYLFGSILVVSTRDLWIMLALSVFCVGTLALRYHQLLYLAFDEETARICG
FT                   VAADGINYVASVVISATIAASIKITGILVLSSLMTVPVATALQLRVGFLLTLVAAFLFS
FT                   MLDTALGLVFSYYLNVAPGGFTALVSVVVLMLVIALTQVGRART"
FT   gene            complement(44559..45554)
FT                   /locus_tag="TPASS_0037"
FT   CDS_pept        complement(44559..45554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0037"
FT                   /product="D-specific D-2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70464"
FT                   /db_xref="GOA:A0A0H3BI32"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI32"
FT                   /protein_id="ACD70464.1"
FT                   /translation="MRCVVFNLREEEAPYVEKWKQSHPGVVVDTYEEPLTAKNKELLKG
FT                   YEGLVVMQFLAMEDEVYDYMGACKLKVLSTRTAGFDMYNATLLKKHGIRLTNVPSYSPN
FT                   AIGEYALAAALQLTRHAREIETFVRKRDFRWQKPILSKELRCSRVGILGTGRIGQAAAR
FT                   LFKGVGAQVVGFDPYPNDAAKEWLTYVSMDELLSTSDVISLHMPATKDSHHLINAKTIA
FT                   QMKDGVYLVNTARGAVIDSQALLDSLDKGKIAGAALDAYEFEGPYIPKDNGNNPITDTV
FT                   YARLVAHERIIYTPHIAFYTETAIENMVFNSLDACTTVLRGEPCAAEIKL"
FT   gene            complement(45651..46703)
FT                   /gene="pfoS/R"
FT                   /locus_tag="TPASS_0038"
FT   CDS_pept        complement(45651..46703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfoS/R"
FT                   /locus_tag="TPASS_0038"
FT                   /product="regulatory protein PfoS/R"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70465"
FT                   /db_xref="GOA:A0A0H3BHD5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHD5"
FT                   /protein_id="ACD70465.1"
FT                   /translation="MHTQSLSPRQFMMKILNGSSAGIVIGLVPPAIAGELFRALAPLSP
FT                   LFAALYHVVLPIQFSVPALIGTLVGLQFHCSAPEVATLAFVSVIASGNVTLQNGAWLIT
FT                   GIGDVINVMLISALAIILVRALRGKLGSLTIIALPVIVAVVAGGVGSFSLPYVKMITLF
FT                   VGRVIATFIALQPLLMSILLSMSFSLIIISPVSSVAVGIAVGLTGLASGAANIGVSSCA
FT                   MTLIVGTMRVNKIGVPLAMFAGAMKMLMPNWIRYPILNIPLLLNGLVCGVLAWLFNLQG
FT                   TPASAGFGFIGLVGPINAYRLMAYTPMVRAGILFLVYFVLSFLAAYLIDFILVDRLKLY
FT                   RRELFIPEQG"
FT   gene            46752..46910
FT                   /locus_tag="TPASS_0039"
FT   CDS_pept        46752..46910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI74"
FT                   /protein_id="ACD70466.1"
FT                   /translation="MRQENKPCQQFYFVLDEKALQSPLRENPSKNVRTIPDAGDENSSF
FT                   GHARVIA"
FT   gene            47588..49381
FT                   /gene="mcp1"
FT                   /locus_tag="TPASS_0040"
FT   CDS_pept        47588..49381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp1"
FT                   /locus_tag="TPASS_0040"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70467"
FT                   /db_xref="GOA:A0A0H3BJI9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJI9"
FT                   /protein_id="ACD70467.1"
FT                   /translation="MTIGFAFTIFAYYLAMFCFRRLSSCSRKSYAENERADTAGVLGVS
FT                   EKSLYACSLFSLLIVVRLLLTGNAFLPRLITIGWDPMVRLEYLTLAFSGVSCLYYLSTL
FT                   YPGLVNQSFVVAFGAEGLAYAVIILLLPPASFARLLPLQQLFVLLLLGIVLWVMCKVLY
FT                   RKKRGAVPLSMGVLVLGVTALHDVLLAVGVLSGAPLLIFGFVGFLVTQTALIEWQVVLD
FT                   GRTAQRLSQDLSSSSQRLERLFGEVRRTAQELSHNEQNLTETMDRAEQVVQDLTRYTGA
FT                   VREELAVQGEGFSQTRVVNEELGSSLRELDEQMEAQGERAREALEAVERLGSTVHNLRG
FT                   KFSAVHADFEAITTASKTGKECVGRMMEVIEEITSRSRGLAVTNALVVDISGRTNLLAM
FT                   NAAIEAAHAGDAGRGFAVVAGEIRSLAARTAAESGATGKMLKEIEAVIGESGHASAGVA
FT                   QSFTDIRGKVDGFSTILADISGAVQVVGEENERTVERMRTVTGQLCTAREQGKVIAEVC
FT                   TRGAAHAERLTRDAQKVCAEVETMIGNVEVLTEVVARTRAVELHTREVIARLSGLLDSN
FT                   IPTDEPQSEYRHGGGVGGAYR"
FT   gene            49383..49505
FT                   /locus_tag="TPASS_0041"
FT   CDS_pept        49383..49505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJM1"
FT                   /protein_id="ACD70468.1"
FT                   /translation="MNRMLSLSVQSQRAPASPSPYGLKIDKRVSPDYARAGVRS"
FT   gene            49502..50434
FT                   /locus_tag="TPASS_0042"
FT   CDS_pept        49502..50434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70469"
FT                   /db_xref="GOA:A0A0H3BI36"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI36"
FT                   /protein_id="ACD70469.1"
FT                   /translation="MSQEIGIKLADGSFFPLFTAEGAQRTTLELVTANDQQSRALLSFF
FT                   KRVSPGDGEASVTSAELEPMGALSIDTLSVAAAGGATIRLEVECDGSRCRARATDVGSG
FT                   AFQETSFSVLERSSGDATPDEQPAAQIEHVSSFPEDEGGDGSTLTRRRRILLAVCAFLI
FT                   LLGGVLVGWVLYMHGASRPAVVPSQKVELPRSSAHVAARELERTAVEARVVDLPSETAL
FT                   PETHKEKDVPPASPGAETATSAAAEPVEESGSGSVKVVRYTVKRGDTLWDLARSYYKTP
FT                   WRYMRIAEFNRLKNPDHIVAGTSIEIPSR"
FT   gene            50415..52547
FT                   /locus_tag="TPASS_0043"
FT   CDS_pept        50415..52547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0043"
FT                   /product="possible soluble lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70470"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHE2"
FT                   /protein_id="ACD70470.1"
FT                   /translation="MKFRHGKHLVWGGGFFSLLREGRLCLRVWCVVCVLVSWEGTVCAR
FT                   GAREVDIPQFLRDKNYTPFLKPTDEFLEQVAAREGASYFIGLHLKRAKFSEEAHEYFVR
FT                   GAAQAAPYRQLCAHEAHNTGSPLQRLAFIEKQLHVLNAGSDARTKTQQQTLRLLRSRVL
FT                   FELERYYSLRTVVESWYNDRALAPHTSAQFAALIAALPDLPRIFKEVHGARVDVFHRNY
FT                   KRGWERVRLLLRSSAWHTRYATNSVLSDFGKAALYGSENSVKAAQVFLDHLAHLSRSTL
FT                   SNAELEARLRFYCYFYAARLYSRSASHKKQALPLFKKAEKVATRRQDADNALWYYLDVL
FT                   RALDFDSFFKVLVESAPRWRSDSWFSDLVDYAIVQLTTQQDWGRLATLQEVLTHRALPE
FT                   RSARVTYVLARSGTLSEESARRAYRTIFETAHSSLYYRVLAACALGIPLEEALYKVRSK
FT                   RTPHPFLTPDESRAILQGYVDYHLDDMFYQAMVQFYPDIPLHLAEHFANAHIQRSRWSD
FT                   AVRIQSYAIRSHGARYSVEHLKIAYPRPWLDVIQGYAGKYHIEEYLLFALIRSESLFQP
FT                   QVISRAGAVGLAQLMRPTASDIARKLNIDTYDLTDPDINVRFGSLFFSDLIRRFDGSVF
FT                   CALFSYNAGPSRVRKWKKQRGSLPDDLFLETLPLAEPREYGRKILSAAVMYGYLYYQKQ
FT                   ASDVVCALLPEFCRAS"
FT   gene            52587..54479
FT                   /gene="gidA"
FT                   /locus_tag="TPASS_0044"
FT   CDS_pept        52587..54479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="TPASS_0044"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70471"
FT                   /db_xref="GOA:B2S1Z2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1Z2"
FT                   /protein_id="ACD70471.1"
FT                   /translation="MGFRFSDYDVIVVGGGHAGAEAALAAARMGEHTLLITQTIDSIGR
FT                   LSCNPSIGGISKGNIVREIDALGGEMGKFADACMIQYRLLNKSRGPAVQAPRIQADKFL
FT                   YAQKVKYTLECTQHLHLYQDTVVDVVCSNTTDAGYVAYGAAHAVVTARGRRISARAVVL
FT                   TTGTFMEGRVYIGEYEAPEGRLGEHAAEGLGAALRKKGFQMGRLKTGTPARVLRKSVDL
FT                   SVMEKQEADAIMRPFSFAHVEINRPHADCYINYTNERTHQLIRENFHRSPFFSGRIKAV
FT                   GTRYCPSIEDKVRKFPDRIRHQLYIEPEGLDTEELYINGLSSCLPEDIQDEMIRTIPGM
FT                   ERAVITRPAYAVDYAVLFPVQLGIDLQTKRVSGLFSAGQINGTSGYEEAGGQGIIAGIN
FT                   AALYARSTKTKEEYHPFVLKRDEAYIGVMIDDLVTQGIDEPYRMFTARAEYRLKLRHDT
FT                   ADERLTEKAYAIGLQKKSAVETLQKKMRTKHEILHLLQTNKVSLTHANAYVQLKPHIGK
FT                   SFAATLRDPVIPLGLIASLNEQIAQFPLEVFQSVGVEIRYEHYIAAQDQRIAQVEKMEG
FT                   IKIPAHFDYARISGLSVESRTRLEHVRPDTIGQVGRMRGIRPSDVMLLLAHLKR"
FT   gene            complement(54535..55434)
FT                   /locus_tag="TPASS_0045"
FT   CDS_pept        complement(54535..55434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0045"
FT                   /product="possible adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70472"
FT                   /db_xref="GOA:B2S1Z3"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1Z3"
FT                   /protein_id="ACD70472.1"
FT                   /translation="MKSLEYYRSQPKADVHTHLNLSMKYERYKQWSGVVIPNFPRKMRG
FT                   LDEMHEIIGEYTRPQCKTAQDVLNLFTMSIEDAIADNVVVMETSVDIGFITHYEENLDH
FT                   FLCDLSDLHRRYKRNVTLHFELGISKIRERSFVEQWAEPMMRSGIFENIDLYGPEISEG
FT                   IEDFIYIFKLAEKYHLKKKAHVGEFSDAQSVRHFVEIFNLDEVQHGIGAATDENVLRFL
FT                   AERKVRCNVCPTSNVMLNAVECLEKHPIKKMMDAGVRVGLGTDDLLFFGKTNSEQLFDM
FT                   VSCGLITELHAEALLAVR"
FT   gene            complement(55796..56497)
FT                   /locus_tag="TPASS_0046"
FT   CDS_pept        complement(55796..56497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70473"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI79"
FT                   /protein_id="ACD70473.1"
FT                   /translation="MIPKLSPNADPCTACASTPAFPPQPMEEEGEFLYQLRLEYSREVL
FT                   YARFHAALRVHTFVVVPTRYGNDIARCVGRIRTPVQTDIASVVRVASDQDLCTWHIHRE
FT                   KERAAEMIFRDRIEHYQLEMKCICCHYPLEEARVVFLYSAPARVDFRELVRDLGATFGT
FT                   RVELRQINEREEARIVGGIDCCGRALCCCSVFSRLRPVSVKMVKEKNLLFRSTQMMGRC
FT                   GRLRCCLTFEE"
FT   gene            complement(56515..57036)
FT                   /locus_tag="TPASS_0047"
FT   CDS_pept        complement(56515..57036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70474"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJJ5"
FT                   /protein_id="ACD70474.1"
FT                   /translation="MGYRVGNSDSTSLLSAFAPPERAKKKSKEKRPLQAARFLSLLYPK
FT                   TDPHSAVQDPSLVHEEHQTRLAYLQDRLCSTGDILKNTRTLETIAAYKQAVKEFVQYAI
FT                   KHNYTTESKSSIRIDRGTGMPDTVIFTKIKVIDQKLASFVRELMSHQVDQLTVLQKTEE
FT                   IYGMLVDLLI"
FT   gene            complement(57042..57473)
FT                   /locus_tag="TPASS_0048"
FT   CDS_pept        complement(57042..57473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70475"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJM6"
FT                   /protein_id="ACD70475.1"
FT                   /translation="MAKIERRSMNTLIGAGSRISGNVVVPGSVRIEGDVDGDVITTGHV
FT                   VIGKRARVRGVIRVGSIIVGGMVEGDIVASEAVQVLPSGVILGAVLTRKIVVDEQAFLD
FT                   GFCYAVADQEGFNKVLKAYLGRKSIHTSAFGYNKYSKSG"
FT   gene            complement(57495..58523)
FT                   /locus_tag="TPASS_0049"
FT   CDS_pept        complement(57495..58523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70476"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI41"
FT                   /protein_id="ACD70476.1"
FT                   /translation="MYALCAACTRSRSAPGRRRPCRTHRHVSTTLSVCGPDFLYYRSHA
FT                   LVRSSVRCWRVGFFFLVCPSVCHLRTFLAAVRAEVDRTQVHLALLRQEAAELIRTSKAF
FT                   QTSLSQTFSQVGLSGLQSGAEKPVRSVSDTNQSNEPDDASAKDGAQKGNVGVTEQHGKN
FT                   AQGVGSEPEELRRIAAYFQNSVQPVREIGKLLNSQTALFSDIPSLWPIKGGVGHISMAF
FT                   GKNRHPFTGQWYVHKGIDLSTHRSGDPIVATADGHVVTVEYDSGWGNYVIIKHKHGFYT
FT                   RYAHMQSYTVTRGQHIRQGQIIGYIGATGVATGPHLHYEIHIGSDVVDPGKYLNVKTAG
FT                   AG"
FT   gene            complement(58816..59424)
FT                   /locus_tag="TPASS_0050"
FT   CDS_pept        complement(58816..59424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70477"
FT                   /db_xref="GOA:A0A0H3BHE7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHE7"
FT                   /protein_id="ACD70477.1"
FT                   /translation="MKKRFIPYNVIRDEGFGMARRIVADRFVPTVMYVPIRGGVYLGNV
FT                   LNEYLTIAYKAEPPILYAAVVAHSHCDLRKRRVISVDGWTYPPEYLRVGDKVLIVDDIF
FT                   DSGATINYIASLLMQKGLARGDIRVAVFNYKVFVGEKQPPVLPDYWCIKHEVRSEADNE
FT                   WFHYMSHELSGLTAAELEQYYYAQNPALRKTLADINNQL"
FT   gene            59575..60630
FT                   /gene="prfA"
FT                   /locus_tag="TPASS_0051"
FT   CDS_pept        59575..60630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="TPASS_0051"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70478"
FT                   /db_xref="GOA:B2S1Z9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S1Z9"
FT                   /protein_id="ACD70478.1"
FT                   /translation="MIEKLEELRAQWRKLQQEVENPSLFSSTQSYRERMRDHAYLSRLM
FT                   EEYDRYLLTEKQLEDAHVLIQDESDADFKDVIRQEIRTLEAALHTSQKRLKTLLIPPDP
FT                   LQEKNIIMEIRGGTGGDEAALFAADLFRMYTHYAESKQWRYEVLAVSETELGGFKEITF
FT                   SISGRDVYGSLRYESGVHRVQRVPSTEASGRIHTSAVTVAVLPEMEETEVDIRAEDVRV
FT                   DVMRASGPGGQCVNTTDSAVRLTHLPTGIVVVCQDEKSQIKNKAKAMRVLRSRVYDLEE
FT                   SKRQVARARERKSQVGSGDRSERIRTYNFPQNRVTDHRVRVTLYKLDAVMQGALDDIIE
FT                   PLCIASRESVI"
FT   gene            60600..61646
FT                   /gene="hemK"
FT                   /locus_tag="TPASS_0052"
FT   CDS_pept        60600..61646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="TPASS_0052"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70479"
FT                   /db_xref="GOA:A0A0H3BI85"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI85"
FT                   /protein_id="ACD70479.1"
FT                   /translation="MYCVSRECNLVQELCTIRQARMYARALFQDAPCLRGQNTPLLDAD
FT                   LILSKLLAKPRAWILAHQQDEIASVAHEFKRLVHLRCRGRALAYLTREKEFFGLRFRVT
FT                   RATLIPKPDTELLVESVLAHVASQMMKPRSVSVHKDTSALPVLKIFEACTGCGCIAIAL
FT                   MHMLRARGTPPLYVIASDICMRALAVARYNARRLLDVSANSRVRFVHADVRAPIPFFSP
FT                   SEGTDVVQERGVCVPYDVICANPPYVPSAQARALLQDGRGEPLGALDGGADGLDLVRAF
FT                   AHHSAAALKEGGCVFCEVGSNHAQRAARIFQAAGFATVKISKDLSGKERLISGILRSQS
FT                   RAVTAPSG"
FT   gene            complement(61735..62790)
FT                   /gene="nrdB"
FT                   /locus_tag="TPASS_0053"
FT   CDS_pept        complement(61735..62790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="TPASS_0053"
FT                   /product="ribonucleoside-diphosphate reductase, subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70480"
FT                   /db_xref="GOA:A0A0H3BJK0"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK0"
FT                   /protein_id="ACD70480.1"
FT                   /translation="MMESSTILQRRALFNEAGDIELHKRRMVGGNTTNLNDFNNMKYPW
FT                   VSKWYRQAMNNFWIPEEINMSSDVQDYRNLSAIEKTAYDKILSFLIFLDSIQTANLPNI
FT                   GQYITANEINLCLTIQAFQEAVHSQSYSYMLDTICSPEERNDILYQWKDDEHLLARNKF
FT                   IGNLYNEFQDDKSVLALLKVAIANYVLEGIYFYSGFMFFYNLGRNNKMPGSVQEIRYIN
FT                   RDENTHLWLFRSIIQELQKEEPQVFTARNVRLFRDMIREGCEQEIKWGDYVIGDQIPGL
FT                   NRHMVADYIRYLGNLRCENLGFEPLYEGHRVEPESMSWVSQYSNANLIKTDFFEAKSTA
FT                   YAKSSAMVDDL"
FT   gene            62961..63920
FT                   /locus_tag="TPASS_0054"
FT   CDS_pept        62961..63920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70481"
FT                   /db_xref="GOA:A0A0H3BJN1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN1"
FT                   /protein_id="ACD70481.1"
FT                   /translation="MLEHMKREQARSQLSHEPPKRRRASLTVCGLRAVETLGSIHPEKI
FT                   HRFFFTPVRAKRFGPLCAYLAARKRLYRSANTQELERLTQSVHHQGVAATIDEPRFPAV
FT                   THSQVEFWVQRREFVVLLDRVGDAHNLGAIIRSAAFFGVHSLVVSDCRQQAQVTSATYR
FT                   VAQGGMEFVQLLRCTNAQEVLEMCAGKMTRVGASPHAFRSLTRLSNILSPEEAVILVLG
FT                   NEETGLSEHLTAHCDHLCRIAGSGQVESLNVAQAGALFLSTIVQLRQSPQDYTQGHRAT
FT                   PRAQERVHRCGQLEEKGQKNGARVLIPRSGARANSRES"
FT   gene            64127..64363
FT                   /locus_tag="TPASS_0055"
FT   CDS_pept        64127..64363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70482"
FT                   /db_xref="GOA:A0A0H3BI45"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI45"
FT                   /protein_id="ACD70482.1"
FT                   /translation="MNQIRLFAQSALVSVMGMGMVFAFLLLLICVVRCVGALVSSFGWD
FT                   RGPDEGVGAAVPAGGALAAAIAVAVHEKARSTS"
FT   gene            64360..66141
FT                   /gene="oadA"
FT                   /locus_tag="TPASS_0056"
FT   CDS_pept        64360..66141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="TPASS_0056"
FT                   /product="oxaloacetate decarboxylase, subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70483"
FT                   /db_xref="GOA:A0A0H3BHF2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHF2"
FT                   /protein_id="ACD70483.1"
FT                   /translation="MSTPVRISEMVLRDAHQSLHATRMTTEDMLPICDKLDRVGYWSLE
FT                   AWGGATYDACIRFLNEDPWERLRALKSRLPKTPIMMLLRGQNLLGYRHYADDVVDAFVE
FT                   AAARNGVDVFRIFDALNDPRNLSQAARAAKKTGKHVQMAISYATTPYHTAEKYVELAKE
FT                   YARFGADSICIKDMSGLLTPYGAYDLVSAIKKSVDLPVELHTHATTGMSVATLVKAAEA
FT                   GVDVIDTAIASMSMGTSHSPTETLVEILRHTGRDSGLDINLLLEIAAYFRQVRKCYAQF
FT                   ESSFLGADTRILVSQVPGGMLSNLENQLREQGALDKMDQVLKEIPLVQKDCGYIPLVTP
FT                   TSQIVGTQSVLNVLFGRYHRLTAETRRLLTGQYGRTPASCDAGLVERALKEEKLSQSLV
FT                   CRPADALPHELDRMRSEARAAGAQDTIEDVLTYAMFPKIAPTFFASRAQGPISFRGKGQ
FT                   GQKQKGESAGSVASYVATVNGTAYTVVQEGAVLRVNGTPYTVRVEAGPSVASGTSQGTV
FT                   TTAKVGACTTLPAPVAGSVVKHTVQDGATVNSGETVLMVESMKMELEVKATAAGTIHFL
FT                   IAPGAHVSAGQVLAEIR"
FT   gene            66153..67562
FT                   /gene="oadB"
FT                   /locus_tag="TPASS_0057"
FT   CDS_pept        66153..67562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="TPASS_0057"
FT                   /product="oxaloacetate decarboxylase, subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70484"
FT                   /db_xref="GOA:A0A0H3BI91"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI91"
FT                   /protein_id="ACD70484.1"
FT                   /translation="MNTRLPLRVLQCVLVGLLVCGPLCAATRRPVRASAPVPMVQSCKD
FT                   TGARCAPASSMREDMRASHGAAPLLSVRKFLLNTWHSTGLYAFFHGVTQVPDLANPQRT
FT                   HSVFGYQQALLLVVGLLIIYLGAAKGFEPLLLIPIGFGTVFVNIPGAGMYSEHGMLKLI
FT                   YDAGVGNEFFPMLIFMGIGALTDFGPLIANPKMAVLGAAAQLGVFLTLFGVAALNFVPG
FT                   IRYSILDACAIAIIGGADGPTSIYVSAKLAPELMAVIAVAAYSYMALVPIIQPPLMRLL
FT                   TTRKERLIRMKQLRPVSRIERVLFPLVLLLLSVLLIPAASPLIGMIAFGNFVKECGVVE
FT                   RLSKTMANELLNIVSILLSLGVGSQMTPDKIMNPNALGIIVLGLVAFSVATAGGVFMAK
FT                   LMNLFLSEKINPLIGSAGVSAVPMAARVSNKVGLEEDPSNFLLMHAMGPNVAGVIGTAI
FT                   AAGVFISAYGG"
FT   gene            complement(67637..68953)
FT                   /gene="dnaB"
FT                   /locus_tag="TPASS_0058"
FT   CDS_pept        complement(67637..68953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="TPASS_0058"
FT                   /product="replicative DNA helicase DnaB"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70485"
FT                   /db_xref="GOA:A0A0H3BJK4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK4"
FT                   /protein_id="ACD70485.1"
FT                   /translation="MPGMPNPTQELKGKIPPHNLEAERAVLGAVLLDDSALSTATEQLS
FT                   ASSFYSAAHQRIFQALVELSDLGQRPDILVLSEHLRSCEALDFVGGSAYVASLTDAVPS
FT                   AANVEYYTRIVCDAAMRRSLLKVARIITAEAFNDTVSGNIVLETAQREIYDLTNARRVA
FT                   TFKLLKNLIPDLVNTIETRYRNQSDLVGIATGLTALDNLTGGFQNSELIVIGARPSMGK
FT                   TALAMTMASNIAIRQRIPTAFFSLEMSNLLLMQRLIAAESGVSATNLRKGLLQLSDFGR
FT                   IQNAAGEMYDAPLYIVDVPNMKLLDLRAVARRLCVQEKIQIIFVDYLGLIVADNPFAPR
FT                   YEQFAAISQSLKSLARELDIPIVALSQVGRPAEGSAPNLADIRGSGAIEQDADVVMFLH
FT                   RDRNETETQLILAKQRNGPIGTVELEFQASFTRFVCKSP"
FT   gene            complement(68937..69164)
FT                   /locus_tag="TPASS_0059"
FT   CDS_pept        complement(68937..69164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70486"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN6"
FT                   /protein_id="ACD70486.1"
FT                   /translation="MRKYLSARSMCCSFFSCAKNCATLGLDSTEGRQFLAVGPQPFASL
FT                   EGFHGEGGDCLFTTFPPLSIPRRRFCAGHA"
FT   gene            complement(69170..69640)
FT                   /gene="rplI"
FT                   /locus_tag="TPASS_0060"
FT   CDS_pept        complement(69170..69640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="TPASS_0060"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70487"
FT                   /db_xref="GOA:B2S208"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S208"
FT                   /protein_id="ACD70487.1"
FT                   /translation="MKIILNQDVKILGEEGDVKEVAAGYFRNYLYPRNLAVPHNRFTVA
FT                   RFKQRQQDIEMRKSLKRQDAANLKARLEAQPVVIAMPAGTNGKLYGAVTSHTVAEQLAC
FT                   MGFEVERKRVEVPGLTLKCVGNYHVTIRLYEEICAVVPVTIKNQSEADSVSE"
FT   gene            complement(69746..70045)
FT                   /gene="rpsR"
FT                   /locus_tag="TPASS_0061"
FT   CDS_pept        complement(69746..70045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="TPASS_0061"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70488"
FT                   /db_xref="GOA:B2S209"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S209"
FT                   /protein_id="ACD70488.1"
FT                   /translation="MAEDHPSVDLDTHLSSPRESEESAPKKNRQFYRKKVCRFCTQKLL
FT                   ADYKDPDTLRRFITERGKILPRRITGTCAKHQRRVALEVKRSRAVALLPFVLTE"
FT   gene            complement(70162..70692)
FT                   /gene="ssb"
FT                   /locus_tag="TPASS_0062"
FT   CDS_pept        complement(70162..70692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="TPASS_0062"
FT                   /product="single-strand DNA binding protein Ssb"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70489"
FT                   /db_xref="GOA:A0A0H3BI50"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI50"
FT                   /protein_id="ACD70489.1"
FT                   /translation="MADVNHVVLVGRLTRDAELKYTSAGGALCRFSVAINRRRKSGDDW
FT                   VEEVNFFDIVLWGRQGEVISQYLIKGKQVAVEGELRQSRWEQEGQSRSKVEISATNVQL
FT                   LGSVLGGAARAEDGEFSSSRVAAESTAGRVRGTSSDSRSPTGDILGEKRGLDATSSLDE
FT                   ADFSSSDLDTVPF"
FT   gene            complement(70701..70982)
FT                   /gene="rpsF"
FT                   /locus_tag="TPASS_0063"
FT   CDS_pept        complement(70701..70982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="TPASS_0063"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70490"
FT                   /db_xref="GOA:B2S211"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S211"
FT                   /protein_id="ACD70490.1"
FT                   /translation="MRTYELMAVFSAHEDLFLQGSTAVRALLQENDAVIAREDHIGERE
FT                   LAYPLKKQKRGRYLLFIVQCEPGKVRELDHKLRLRHDLLTHLFVRVDS"
FT   gene            71124..71699
FT                   /locus_tag="TPASS_0064"
FT   CDS_pept        71124..71699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHF8"
FT                   /protein_id="ACD70491.1"
FT                   /translation="MLPTAQRRLRGYIRACAPYGRRGEEPVRRRCAFLCARVGHVCVGR
FT                   SVVQNFVFQDNIYHLARSIDVLYEGLQLNLDECLYAEKVVYDVRFFDHALQKLCAHIDR
FT                   QSHFPDYLPILHCLFSCGARFLNLLNFLIHRASPVTAQVEFTRMLPFIEKRHSALHENL
FT                   ARSIQEVDTSADASHVVSQDEIDELLEH"
FT   gene            71773..72360
FT                   /locus_tag="TPASS_0065"
FT   CDS_pept        71773..72360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70492"
FT                   /db_xref="GOA:A0A0H3BI96"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI96"
FT                   /protein_id="ACD70492.1"
FT                   /translation="MLKNHVLRCPDGPIRPAMDRMRESLFAILGDMRGCSFLDLFAGSG
FT                   VCGLEAYSRGAYPVVFVEWNVRSFSVLLQNVQVALCRLECRCMAVERYIARARTLFHFV
FT                   YLDPPFPYRFHAELLQRLSRASLCREGSVVMVHRPREKKLADKIDSLVRTDQRVYGRSV
FT                   VDFYRRIKPVLRRTETRCRILLFFVRGDAEGA"
FT   gene            72344..72658
FT                   /locus_tag="TPASS_0066"
FT   CDS_pept        72344..72658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70493"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK8"
FT                   /protein_id="ACD70493.1"
FT                   /translation="MQRVLESDTPYFVKGIQRPVSTLSDRDRALLNRRGNAYLNEGKLQ
FT                   EAARVFITTGYHDGLTRIGDVYMRKADVLTALRFYYFARNEQKMRPIVSALSVLIRCLI
FT                   "
FT   gene            72646..73827
FT                   /locus_tag="TPASS_0067"
FT   CDS_pept        72646..73827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70494"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP0"
FT                   /protein_id="ACD70494.1"
FT                   /translation="MSYIILTPGGGMGLMGCECSVPPFETVETGKRSVDADRIMRLSRD
FT                   GYAFLKVNDLERAESEFGKILQIEADNNYALVGLGDAARKRRAYQEASDYYTRCLQHYP
FT                   RNSYALFGLADCYKNMRRYVKAVEVWQQYLEQDSHNIAVLTRMADAYRKIHDFQNSRNL
FT                   YSQVVALDEHNSYALIGLAHLHYDFKKYREALIYWKKLLECAEHSVDIRVLTSIGNCYR
FT                   KMKLFSQGLPYFQEALKRDPGNFYGFFGMADCYRGMNMQERSIQYWEKILEKDTQNRVI
FT                   LTRIADAYRHIGEYEKAHQTYKRALDIDYDAYATLGLAVLCKLQGRYEEAVVSLDRLVQ
FT                   LDRKNYRVYVELADCYRKLGQKQKALETLRPFQQFGVKNRVVSELMSELEGAS"
FT   gene            74008..75030
FT                   /locus_tag="TPASS_0068"
FT   CDS_pept        74008..75030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70495"
FT                   /db_xref="GOA:B2S216"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S216"
FT                   /protein_id="ACD70495.1"
FT                   /translation="MEWCCALSGLLPEEIQKVCAFAERFRGVQVFRWIAAGCTDFHAMS
FT                   DLSSETRARLARACVISDTRVYTTLRDVDGTLKLGIELKDKRRVEAVLLVDQVSRKTAC
FT                   LSCQVGCPMACAFCQTGQLGFARNLSASEIVEQFLHLERCVGTLDNVVFMGMGEPMLNL
FT                   DAVCRAIEILSHPQGRDLSEKRITISTSGHCRGIYSLADRALQVRLAVSLTTANAPLRA
FT                   RLMPRAAHDSLAKLKSAIRYFNEKSGKRVTLELALMRGVNTSERHAQEVIDFAHGLNVH
FT                   VNLIPWNPVASIHFETPREVEVAHFEALLMRARIPVTRRYQRGNGIGGACGQLGKTAGV
FT                   "
FT   gene            complement(75086..75616)
FT                   /locus_tag="TPASS_0069"
FT   CDS_pept        complement(75086..75616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI52"
FT                   /protein_id="ACD70496.1"
FT                   /translation="MCSFSTSVLCGPFQAVTYSAHAGAVCQTLGIVFSRSEHSTPSVCA
FT                   DAFSMKVRGIPVLQRRTWALVLLVLSSTSACVRKNSLEDVRFPSSSPIGEARRFAVITK
FT                   AYVLLRDKPGVTGIVIAYARRKDIFPVLGIDLLSKDKESALWVNVERGWLPWDCVQLYS
FT                   SKAKALAASKKLS"
FT   gene            complement(75466..75852)
FT                   /locus_tag="TPASS_0070"
FT   CDS_pept        complement(75466..75852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70497"
FT                   /db_xref="GOA:A0A0H3BHG1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHG1"
FT                   /protein_id="ACD70497.1"
FT                   /translation="MLPFYFLSVATNAAIGFILTVLDSQEESAHDCPFLYDATFSLVLA
FT                   LLSGIAAVCKCVNPIGAQLPVLGDLIPTLAGGTGCALFLHRYCVALSKPSPIPRTLVQY
FT                   AKPLGLFSLAASILHLLFAPTLFL"
FT   gene            complement(75903..78539)
FT                   /gene="clpB"
FT                   /locus_tag="TPASS_0071"
FT   CDS_pept        complement(75903..78539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="TPASS_0071"
FT                   /product="ATP-dependent Clp protease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70498"
FT                   /db_xref="GOA:A0A0H3BIA3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIA3"
FT                   /protein_id="ACD70498.1"
FT                   /translation="MNTDRYTVKASEALNDAISLAEAENHGQVEEEHLLHALLSQKDGI
FT                   ISPLIEKIGAKPDFLYDELLQCLRRKPRVTGPAAQTRCAPTLSKACARAERLALKNQDE
FT                   YVSCEHLLLAISETDSNTARLLHSQGITSKTISAALKDIRGSKRVTSQDPESTFQCLEK
FT                   YCRDLTTLAREEKIDPVIGRDEEIRRVMQVLSRRTKNNPVLIGEPGVGKTAIVEGLARR
FT                   IVSGDVPESLKGKRLLSLDLGALVAGAKFRGEFEERLKAVIEAVQKSDGGVILFIDELH
FT                   TLVGAGASEGSMDASNLLKPALARGELRSIGATTLNEYRKYIEKDAALERRFQQVYCVQ
FT                   PTVEDTIAILRGLQEKYEVHHGVRIKDEALVAATVLSDRYITNRFLPDKAIDLVDEAAS
FT                   RLKMEIESQPVELDQVERKILQLNIEKASLLKESDPASKERLEKLEKELAGFLERRAAM
FT                   QVQWQNEKGRIEESRRYKEELERLRIEETMFSREGDLNKAAELRYGKIPELEKKIMLLT
FT                   AEVEKKSGLEGQLLREEVCEEDIAKIISMWTGIPVSKMMASEQQKYLQLESVLMQRVVG
FT                   QDEAVRVISDAIRRNKAGLSDTRRPLGSFLCVGPTGVGKTELARTLADFLFNDERALTR
FT                   IDMSEYMEKHAISRLIGAPPGYVGYDEGGQLTEAVRRRPYSVLLFDEVEKAHQDVFNIF
FT                   LQILDDGRLTDGQGRVVDFRNTIIIMTSNIGSEHILSARESRTHTSDLPVPETQSTEEQ
FT                   TLPEQIRGLLHTYFRPEFLNRIDEVLIFKRLTRKHIRLITDIQLQMVVERLESRHIKLR
FT                   VRDAAKAYLAERGYDDTFGARPLKRAIQTELENALAREILSGRFRGGSTIVVDMCKDAL
FT                   CFTEQTS"
FT   gene            78743..79015
FT                   /locus_tag="TPASS_0072"
FT   CDS_pept        78743..79015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70499"
FT                   /db_xref="GOA:A0A0H3BJL6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR017167"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJL6"
FT                   /protein_id="ACD70499.1"
FT                   /translation="MEKTLTLFGSNHCGQCATALEYLRSNHINFEYVDITGSGKNLKRF
FT                   LKMRDSMPLFDDVKKEGRIGIPCLSVNDGEQVFLGVEGLDLSAFR"
FT   gene            complement(79085..80626)
FT                   /locus_tag="TPASS_0073"
FT   CDS_pept        complement(79085..80626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70500"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP4"
FT                   /protein_id="ACD70500.1"
FT                   /translation="MHFARVVKSIHSVYSLPMCDTQIVVDTEKIRKAIELQLPIAITTY
FT                   TLPRDMDIYIGQVAKTILDLIGQPHVKDYLTYCISELTTNAKKANTKRIYFREKGLDIF
FT                   DPQDYKRGMKSFKEESLENINHYLKLQQQEGLYVKVTMQVLSHALVIEVINNCKMTPME
FT                   FKRVFDKRVRARRYSGLEEALAHILDNSEGAGLGLVIMMLMLKKLGLEEDVYRLVVEED
FT                   RTVSRMVVPRNIEIQTQTTKLAASIADRIDDIPQLPSKLLEIQRAIENPDVQLSDIVAL
FT                   ISQDVALVTDLLKLVNSARFGMNKRCLDISEAVKRVGLRGLQNLLYSVGAGRVLQSTDD
FT                   ERKQLWNQAYRTGYFALGLAKATGDQALIADSYICGLLHNLGEVVFTSAYPEMLIKLTE
FT                   IQAERNIPPHVLDTIMSDVGHAEIGAALAQRWNLPEPVINTIRFHHNLPHAPEEYKPLI
FT                   STVAFANMTIRFLDGETPYEQIPRSLLSFFRIQSEQQLRTTAQTLQSSFEAEQTA"
FT   gene            80931..82340
FT                   /gene="y4oP"
FT                   /locus_tag="TPASS_0074"
FT   CDS_pept        80931..82340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="y4oP"
FT                   /locus_tag="TPASS_0074"
FT                   /product="sugar ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70501"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI57"
FT                   /protein_id="ACD70501.1"
FT                   /translation="MCFARSRLFSRGAVGTVCCTVLFLACRVRTPSSVPLRSGSVRAAV
FT                   PEATSFHWRRYAGTRLRVCFPYHASYRALKAIVPEFESLTGIAVEIDWLQYARMHDKQV
FT                   LELSKPRGDYDLIAMLCTWKTEYASRGLLRSLDSFFQNPSLCMPHYDFEDLIPVYVETI
FT                   GYVGGRKPWLGGPGAFLCAVPFGAETSILAYRKDIFHKYRIKVPENYDELLDACKRLRE
FT                   RAQLYGLASRGASGQQALHAYLLHAAPFGAKVLDDSLVPAFHRSRSIATLRWMQEMFAY
FT                   GPPGMASFAQNEALQAFLQGQTGMYLDTNMIGPLVRDPTRSAIRPHHVGFALHPMAQVR
FT                   AGEVGGFGLAIPHNSAAPEAAFLLLQWITAPQTGRRVVEQGALPFRQSQLADRALRARF
FT                   AEFEVLERQLAHCDPDWRPIVPTWGELGTLLGIGINEVLTGVSEPEEAMSALVLPARRI
FT                   LRRHAHARYVP"
FT   gene            82459..83349
FT                   /gene="y4oQ"
FT                   /locus_tag="TPASS_0075"
FT   CDS_pept        82459..83349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="y4oQ"
FT                   /locus_tag="TPASS_0075"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70502"
FT                   /db_xref="GOA:A0A0H3BHG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHG7"
FT                   /protein_id="ACD70502.1"
FT                   /translation="MGKSMSKPRDTVSAYCFSAPALVLLMFVLVLPAFLGLRMSFFQWQ
FT                   LSALRTQPVFVGFENYRELFSSIHFWASVRTTLVFTLSVVVLEVVLGLALALVLEHGVP
FT                   GLRFFRTVFVLPMMIAPVVVGVLWGFLYHPQFGKINYALQAFELGPVLWLANPRLALLS
FT                   VILTDVWQWTPFVFLVLLAGLQGIPQHLLYAAKVDGANYMQTLLHIKIPHIAPVLGIAT
FT                   VLRLIDSFRGLVVIMTLTNGGPGVATEILPLHLQRIAFEDHRLGKASAVAVLLFLLTSL
FT                   LTCIFILLTMRRQAR"
FT   gene            83389..84210
FT                   /gene="y4oR"
FT                   /locus_tag="TPASS_0076"
FT   CDS_pept        83389..84210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="y4oR"
FT                   /locus_tag="TPASS_0076"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70503"
FT                   /db_xref="GOA:A0A0H3BIB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIB0"
FT                   /protein_id="ACD70503.1"
FT                   /translation="MNMIFLKWRTALVLCLLSCIALVSMFPLYEMVATSLKRDADAFRL
FT                   PPAWFFIPTIENYRQLLQEHHFGRALYNSLVVTLSSTVVSVSAGAAAAYAMQRFRYRGK
FT                   KAITVALLLLRVIPPVVLVIPIFVWWTALGLVNSLAGLALVYGALNVPFNVWVITTFVA
FT                   EIPPSLDESAKLDGCSHWMIFTRIVMPLITPALAVVSIFTFRFAWNEYMLGFALTNRKT
FT                   RTLPVALSLFLTDSGVEWGRITAAATLIAIPACVFTFAAAKYLVVGLTAVR"
FT   gene            84251..85867
FT                   /gene="cap"
FT                   /locus_tag="TPASS_0077"
FT   CDS_pept        84251..85867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cap"
FT                   /locus_tag="TPASS_0077"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70504"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJM2"
FT                   /protein_id="ACD70504.1"
FT                   /translation="MCGASLGDCVGSCARVNALYVGRDGVGAENVWGCGRSAVRESAHR
FT                   DGIYIVGAGFAGSVLAREIQTKKVLGTVIAFLDDDPCKIGSNLHGVPVLGPIFEVARIV
FT                   RITPHDHALIAIPSISIERLRDIYLTLRAAGFTVIKLLPALAQIIDGTAHLVQTREIDP
FT                   QDLLTRTPVTINLKKSLAYLCGKRVLVTGAGGSIGSELACQLLSGDVERLYLFGHGENS
FT                   IYQIDKKIRRLQEEGVGSRTVIVPVIGDLKDAAYVRYLIEQLRCDAVFHAAAYKHVPMM
FT                   ELNPVSVIENNVFGTKFLLDACIACRVKRFVLLSTDKAVDPVSIYGVSKMLNEKNVLYA
FT                   AERVRDFGHDAAYMFVRFGNVLGSRGSIMPLFIEQIKKGGPVTVTDPAMTRFFMTIPEA
FT                   CSLVLQVGGVGVNGASYLLDMGEPVSIMETAQQLIRYFGYEPDRDIPIHVVGLRPGERL
FT                   SEPLVSKDERIEPTVYPKVLRLREREPLDFAHLERLWDQLYPYCFPSGEKVRYRHKEGL
FT                   VRVLCDSCATLKQRYMPNSEA"
FT   gene            85872..87110
FT                   /gene="spsC"
FT                   /locus_tag="TPASS_0078"
FT   CDS_pept        85872..87110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsC"
FT                   /locus_tag="TPASS_0078"
FT                   /product="spore coat polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70505"
FT                   /db_xref="GOA:A0A0H3BJP8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP8"
FT                   /protein_id="ACD70505.1"
FT                   /translation="MEGTVKKKKEGVRDDNAQHAVFNKQVPFFVPSFSEAEERAVCDVL
FT                   RSGWITTGTQALAFEKEFAAYVGAPYACAVNSATSGLLLTFDAMGIGPDSKILTSPYTF
FT                   VSTASSALHLGAQVVYADIERDSYNISAECVEACLKKDARIRAIVPIHIAGNVCNMRDL
FT                   NALARKYQVAVVEDAAHAFPSKTACGYAGTLSHAGVFSFYATKPLTTGEGGMVCTNDAK
FT                   LAARIACLRSHGIDRAIWDRYTNGTAPWRYDVTSLGWKCNLPDILAAIGRVQLQKAAHL
FT                   FAQRARIAAAFTRAFSRYEFFCTPPDGDGNAWHLYLLRLVPGTLSVSRDEFVRLLQERG
FT                   LGVSMHFIPHFEMTFFKKSLCVRAEDFPECAHKYQHTLTLPLWPGMDDSCVAYVIETVV
FT                   RTAQECAKGRAYI"
FT   gene            87038..89260
FT                   /locus_tag="TPASS_0079"
FT   CDS_pept        87038..89260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70506"
FT                   /db_xref="GOA:A0A0H3BI61"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI61"
FT                   /protein_id="ACD70506.1"
FT                   /translation="MRGVCDRDRGAHRTRMCKGKSIYMSVFVSDGARTGSVYAQLVRAP
FT                   RVAGLLLNIDIPSLPDGYSFYTAAHIPGCNAVRCGENTVPVFAHGEVVYAGEPVGILIG
FT                   PDEHVVRNLVQDVVVHTCAERACASEILCGISEGEPLAQKVAVQGDAETAFKRASHTVC
FT                   SSCTFEPRVHYFAEMPEVQALPDAHGLHVYAATQWPAHMRKTIAQVLNISEHAVHVHPQ
FT                   QEALSCDGRIWFPSVMASQAALAAYCAKKPVRLSFSFQEYVQYCPKTPKITIAHRTALN
FT                   AAHAVEGMFVFISLDAGAGNLLIDRMVAHMVHTALGNYAIPRYRIECTAFRSNVGLTDV
FT                   FNGWADAYTSNALEMHINQLCAELHIFPDEWRVAHMKDTRETQRFARLLAYLCEEGDFR
FT                   RKHAAFSMVNAVRKAHDTHAWRGIGLALGFQYDPSAMLARSGFSYVLQMTLHTDARIVV
FT                   HSVPLSDSFKRVVVAFLIREFACLEDAIFFKSSDEAYGVDLLGPSVESVGMRVFARLVR
FT                   KCVRAIQRQRFRKPLPITVQGSFNTAKKGQVYQVVTVAKSDVSVPDAQSEQCASKVPVT
FT                   ADTSGKCEDMNGFTKMHGMSTHTPAACIIELELDALCVQPKIVRLWFVCDPGYVFCEKD
FT                   VYRTVSRSITRALSHVSVEKIWERARTPEYVIIDPSDTPPYHVTLLSSNAAARAVGTVA
FT                   EGIVPAAYYAALRQILPISQNATHKVPFVARDIFYEMFSLSADDSL"
FT   gene            89257..89724
FT                   /locus_tag="TPASS_0080"
FT   CDS_pept        89257..89724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0080"
FT                   /product="quinoline 2-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70507"
FT                   /db_xref="GOA:A0A0H3BHH3"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHH3"
FT                   /protein_id="ACD70507.1"
FT                   /translation="MNIRFTLNTEQVHVDAMPHERLSTVLRRCFHLPSIKGSHGHGENG
FT                   ASTILFNGEAVSAYIIPFFLAHETQIVTLDFFQKTKRGRWIVACFAQHHISFCGYCDAG
FT                   KILTAESLLQRNSVPNEEEVRHAFSGMQCRCTDINALIRALQRMPACHEFS"
FT   gene            89731..90579
FT                   /locus_tag="TPASS_0081"
FT   CDS_pept        89731..90579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70508"
FT                   /db_xref="GOA:A0A0H3BIB4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIB4"
FT                   /protein_id="ACD70508.1"
FT                   /translation="MHLYKNSESSVIYYVKSLGQLCAVLRNVAQVQPVGGGTGLVQYQI
FT                   TPVLTLPSHLVVLNGVPELKDISKTEHFLEFGGAVSLQAIVRLGRKNIPVALHEALSHA
FT                   ANPGIRTLATIGGNIAGTRPHASALAPLIALDAKMEVRTGHENFWISVAHYAHARSDTL
FT                   RHRSHVITRIRLPTDYWDFSYYRRIGSRALFGERADFVFLAQQQKNALSEMRMVFFSDV
FT                   VMRNREFDNLLLGRAIPLSAGDIAAIVYRSREFFAPESFKSAYIAHCFFHLLEDCLRRL
FT                   R"
FT   gene            complement(90626..92428)
FT                   /gene="fhlA"
FT                   /locus_tag="TPASS_0082"
FT   CDS_pept        complement(90626..92428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhlA"
FT                   /locus_tag="TPASS_0082"
FT                   /product="formate hydrogenlyase transcriptional activator
FT                   FhlA"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70509"
FT                   /db_xref="GOA:A0A0H3BJM8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJM8"
FT                   /protein_id="ACD70509.1"
FT                   /translation="MHRLREILPAHLPIRKETSEHLSTRVSCARLYPIXNARKRIRKTN
FT                   TIPCTRHAHRLHAENCTDMPFSSILGPHELFGLSCTRALPPAAEKSLEMILDALYEIAR
FT                   YELAVVLSFESSQILRVRKARGPLYTPRLQHHTIDLTKRQDLARILSQKSPYLFDPTLA
FT                   HTDTYTELIPMPQNHSCLIAPLYIDDTPIGMLTLDHRLCEQFTPDVVRFITTLSKLISL
FT                   AVAQTDASETLSQKSHALLTERNALLAPQSPAFKNMIGTSPAWTRTLDAIKLVAASDLP
FT                   VLVCGETGTGKELVARTVHQLSTRSDKPFVPVNCSALVHSLAESELFGHEKGAFSGAVG
FT                   THRGRFELAHGGTLFLDEVGDLPLELQPKLLRVLQDGVFERVGGERSVSVSVRIIAATN
FT                   INLSEAVTQGKFREDLLYRLDVFPLSLPPLRERAEDVALLAEHFIQKIKTRPGFERTQL
FT                   SPSAFKKIFSLTFPGNVRELRNLLERAALLARGDTIGAEHLVCRTPESGTQTTVYPREH
FT                   TEVSESVQPAIPLCIRDSSCMVRCTQGKKEETTLVVNFHQAQRAAIQAALDASNGKIYG
FT                   ANGAAEILGLKPSTLQSKMKKLGL"
FT   gene            93174..94454
FT                   /locus_tag="TPASS_0083"
FT   CDS_pept        93174..94454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70510"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJQ2"
FT                   /protein_id="ACD70510.1"
FT                   /translation="MPRPFDLARLEQDLRRIPDQILCAWVPRHVSQTGDALSLSELWLL
FT                   HDRSSLAKEGRFARADLKKGIYVPAHHIKDPKLRAMHFKTIADNKLNMLVYDMKDELGM
FT                   VRYQSQDPFVRSVGAVRPFVDMKTFVKQAKEKKLYLIARIVVFKDKYLFRWNGFELAVK
FT                   AGGKPWQGYKNGALRKEEIHEHWVDPYNEKVWRYNVAIAKEAIEFGFDEVQFDYIRFPT
FT                   DGDNLHQAEYPARESGMDRESALMSFLAYARERIDAPISIDIYGANGWYRTGARTGQDV
FT                   ELLAEYVDVICPMFYPSHFSQSFLAYAPAQERPYRIYYYGGTATGCWPATGWSSDPGCR
FT                   PSTYRSLTTGRTTARITCSARWLASANQSMKDTRTGTTQGVTQTSGPTARASVSRQGNP
FT                   ASGRPLLGRFPTQDRKSASVLSGEELL"
FT   gene            complement(94434..94667)
FT                   /locus_tag="TPASS_0084"
FT   CDS_pept        complement(94434..94667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70511"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI65"
FT                   /protein_id="ACD70511.1"
FT                   /translation="MVVNAVVGADEASARLREYCSGLPDVEKKIAESTSPEGAKLVSDF
FT                   GIGSVPMVVILDEDSSELFRTADIGELEKFFS"
FT   gene            complement(94781..95227)
FT                   /gene="ptsN1"
FT                   /locus_tag="TPASS_0085"
FT   CDS_pept        complement(94781..95227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN1"
FT                   /locus_tag="TPASS_0085"
FT                   /product="PTS system, nitrogen regulatory IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70512"
FT                   /db_xref="GOA:A0A0H3BHH8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHH8"
FT                   /protein_id="ACD70512.1"
FT                   /translation="MNLETVLTPETVSLHLKGSTKEEIIDEMLEMFVRAGRVSDKVAAR
FT                   ECVLDRERKMSTGMKHGIAIPHGKTNSVSSLVAGVGVSDSPVDFDSLDQEPCRIFIMTL
FT                   SPLDVTGPHLQFLAEISLLFKSSEKRREILDATSKAEVIKILTE"
FT   gene            95308..96252
FT                   /locus_tag="TPASS_0086"
FT   CDS_pept        95308..96252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70513"
FT                   /db_xref="GOA:A0A0H3BIB7"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIB7"
FT                   /protein_id="ACD70513.1"
FT                   /translation="MTFCLLGLYHARVEFATREQLNRYYDLYKDVDVTFSKDVMQALCF
FT                   NARQVCVRSAGGQCSCVMNSVSMVGAKVILSRKSSLLESIQVEGASVSIRFSFFESDAR
FT                   DAVSFFVTARVLGVEDYAQSTELVVLSVAYTQRIPDMLIERLGLLVEANISSKKRKSER
FT                   IAVNKESMRRIGLMRAETIVFIQAIPRRCVLRDVSFGGAKFIMMGVAPFLKGKETVLKL
FT                   DFEEPSTSMSIRGHVVRADQVEGRKDLVAVAMEYDFDVVPVAYRMCLNRYASDRCRRFP
FT                   GTDEDCSAASAGDPGRSSAGAEGIDLSVPFSLS"
FT   gene            complement(96255..96794)
FT                   /locus_tag="TPASS_0087"
FT   CDS_pept        complement(96255..96794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70514"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN2"
FT                   /protein_id="ACD70514.1"
FT                   /translation="MYKAFEEHVSFYLHRTPAALSLLLLGLLSCVACRTNSLETAQIAF
FT                   CTGGQYVPVVVELALTEEAQRRGYMGRTRIPDGTGMLFVYKQDTRLSFWMKDTPHPLSL
FT                   AFLDAQGAIVQIEDLVPLSTHSVRSNRSVRYALEVPRGWFVRSKLLVGARLSARSLARI
FT                   RRHADPPKGQSGDKRH"
FT   gene            complement(96778..97392)
FT                   /locus_tag="TPASS_0088"
FT   CDS_pept        complement(96778..97392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJQ7"
FT                   /protein_id="ACD70515.1"
FT                   /translation="MNYAKNCMALALGGVLHMQSYLCSSPSPSRGAGGARMLATVTPLS
FT                   QTHSLEKIPAVYRALSLGMGVTEVKEALKKDSIFGYRGERDVSLLMSENRILIETTGPH
FT                   FIARSWFQFYRDRLYAMTFKLNTDAIDYYSVYENLCKKYGEPHKLSPRVALWEDASTRL
FT                   VLERPLIIKYIDIRAFNEQLSARDTQKSNAEKDRKRFVQGF"
FT   gene            complement(97422..98657)
FT                   /locus_tag="TPASS_0089"
FT   CDS_pept        complement(97422..98657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0089"
FT                   /product="cyclic nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70516"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI69"
FT                   /protein_id="ACD70516.1"
FT                   /translation="MLQLTFVNFKKGSYILVEGKADADLFYIIHSGQVCIAKQVEIVAE
FT                   EEGNVLTAGNFLGVVACMSRHNQIETAVALTDVVLIAIRYEQFPQLIEKNAAIAMKIIL
FT                   SFTKKMRYLNEALTQLTLKKHTDVDVSHLFAIGEYYVKMTKFELALYAYYHYLKESPKG
FT                   TYAEEARKRFVAIKSTGVKVPVEILEPNILEATRCYDREAMVFCECQLGNEFYIIQKGH
FT                   VKITKIVDNNEVVLAILKEGDMFGEMALLENKPRSASAIVMSDGCQLLAVNRKNFQQLV
FT                   ATQPQLTARLTTTLADRIWSMYRQLANTLLPEPTEKMYDMLAIQLEKIRYIPSTGKAYD
FT                   FEFGPIELAHMCGFPKDIVSQVTEDFLREPIVRCVDNKISVTDDLELVKRVAYFKKKRT
FT                   LAKARKDPHNRQ"
FT   gene            complement(98740..99804)
FT                   /gene="murB"
FT                   /locus_tag="TPASS_0090"
FT   CDS_pept        complement(98740..99804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="TPASS_0090"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70517"
FT                   /db_xref="GOA:A0A0H3BHI3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHI3"
FT                   /protein_id="ACD70517.1"
FT                   /translation="MSAHRIRARRITRRNVPLAERCSFRIGGAAQFWAEPRSCTQLRAL
FT                   IEEAQRARIPLSLIGGGSNVLIADEGVPGLMLSLRRFRSLHTQTQRDGSVLVHAGAGLP
FT                   VAALLAFCAHHALRGLETFAGLPGSVGGAAYMNARCYGRAIADCFHSARTLVLHPVRSR
FT                   AKELPEVRKNAQDKRGECLGLDGGPFTCSSFQTVFARAGDWGYKRSPFQSPHGVELHAG
FT                   RRLILSLCVRLTPGNPAQIRKHMQEKIADRISKGQFRFPSAGSAFKNNPAFGKPSGILI
FT                   EEAGLRGTSCGAAQVAPWHGNLIINTGNATAHQVRTLLRVVRQRVFETHGVWLEREIIF
FT                   SGESVRMTSSSRDS"
FT   gene            99986..101548
FT                   /gene="cysS"
FT                   /locus_tag="TPASS_0091"
FT   CDS_pept        99986..101548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="TPASS_0091"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70518"
FT                   /db_xref="GOA:B2S239"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S239"
FT                   /protein_id="ACD70518.1"
FT                   /translation="MALRVYNTLTRQQEHFQPWEHGHVRLYGCGPTVYNYPHLGNLRAY
FT                   VFQDTVRRTLHFLGYRVTYVMNITDVGHLESDADSGEDKLVRSAQAHGHSVLQVAAHYR
FT                   AAFFRDTALLGIEEPSIVCNASDCIQDMIAFIEQLLARGHAYCAGGNVYFDVRSFPSYE
FT                   SFGSAAVEDVQEGEDAARARVAHDTHKRDARDFVLWFTRSKFVRHALTWDSPWGRGYPG
FT                   WHIGCSAMSMKFLGPRCDIHIGGVDHIRVHHRNERAQCEAITGAPWVRYWLHHEFLLMQ
FT                   LQKRAVHADMGSSVVSSFSKMSKSCGQFLTLSSLQERGFQPADFRFFLLSGQYRTQLAF
FT                   SWDALKTARAARRSFVRRVARVVDAARATTGSVRGTSAECAAERVCESRASESELLLTD
FT                   FRAALEDDFSTPRALSALQKLVRDTSVPPSLCVSALQVADTVLGLGIIQEATASLSAQV
FT                   PAGDTLPQRPLPSEEWIGQLVRARAHARQTRDFPRADEIRRQLKAEGIELEDTHLGTIW
FT                   KRV"
FT   gene            101619..102107
FT                   /gene="rpoE"
FT                   /locus_tag="TPASS_0092"
FT   CDS_pept        101619..102107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="TPASS_0092"
FT                   /product="RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70519"
FT                   /db_xref="GOA:A0A0H3BIC2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIC2"
FT                   /protein_id="ACD70519.1"
FT                   /translation="MYEQLVPVLYRVAYNVVREEDIAEGLCHDAFIAMTEKRMEFPSLS
FT                   DAKYWLIRVVKNASLNYAKRRVRERHSCEQASREHVCEPDTGELRLLRIETIEQVRAAL
FT                   DRLPEHLRVVLQLREYGDLNYKEIGRILGISEGNVKVRVFRARERLAKYLGETDAYLS"
FT   gene            102091..102738
FT                   /locus_tag="TPASS_0093"
FT   CDS_pept        102091..102738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN7"
FT                   /protein_id="ACD70520.1"
FT                   /translation="MRTCPDCAAWCAYVDGEGSQLQRREMCAHLQGCTHCATCVAHYRA
FT                   MRSLVKHADRVSSRDFTMAFPYLRVRHRVASCMPRPWWQARSSPLSAAGPVRAAALAVA
FT                   VASLCVCTLLLTHIVERRPVSRAGEASFTPIVPMRVRAPVGYARGVKVFGPAVSANSNV
FT                   LRKPAAVFTVCAFAQLYGSDPAYEMETVPVRLSVIPVPSYVLNASKAQFFSP"
FT   gene            102876..103886
FT                   /gene="pta"
FT                   /locus_tag="TPASS_0094"
FT   CDS_pept        102876..103886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="TPASS_0094"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70521"
FT                   /db_xref="GOA:A0A0H3BJR2"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJR2"
FT                   /protein_id="ACD70521.1"
FT                   /translation="MTFVESMQRRAVLAQKRLVLPEACEQRTLEAARLIVFRNIAAKVF
FT                   LVGCERDIKNTADRCGIDLTDMVVIDPSVSKHRDQFAERYFQKRKHKGISLAQAAEDMR
FT                   DPLRFAAMMLDQGHADAMVAGAENTTARVLRAGLTIIGTLPSVKTASSCFVMDTNNPRL
FT                   GGTRGLFIFSDCAVIPTPTAEQLADIACSAAESCRTFIGEEPTVALLSYSTKGSGGDSD
FT                   ENILRVREAVRILHERRVDFTFDGELQLDAALVPKITEKKAPHSPITGKVNTLVFPDLS
FT                   SGNIGYKLVQRLSDADAYGPFLQGFAKPLSDLSRGCSVEDIVAACAVTLVQSNGR"
FT   gene            103886..105832
FT                   /locus_tag="TPASS_0095"
FT   CDS_pept        103886..105832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70522"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI72"
FT                   /protein_id="ACD70522.1"
FT                   /translation="MTSTQARIREAVRAGSVRDYARAIRILEELAASGKAEGCHHPDGG
FT                   AVYERGAQEEWNEGSSESHAHGGDGTQDAYPEIYLYLARAYHAQRQYARAVAYATVYSR
FT                   RVPRDGAGWFFLGRSYLALHQGGYAVAALRRSVRENPASLGAQALLGLAYLRSKKPRAA
FT                   RMVFEQALAQYPDNKRLNAGYLNSLFVEAVQHLKRGSADLARQMFTFLINQDVDGVAPR
FT                   LYLAHAFRSLKHFPEALTQYRAASAFAPHDPALKWYEAAMLVEMGCLSQAAALLSTLGV
FT                   SIERDQISDRFLVMGAVRKHMEEGAWARAASAAHLYLKTFGGSVEIHLLMAEVHRRAGR
FT                   VNVALNHYTRAMKIEPKNCYPHYGLMVCLQEARRWQELAKAIRRAEGAGCDAQDCYYYR
FT                   VITAAHLSNPPEEVLPHLQELARGGKADQLLFNALGVTYVRLGMADLALRWYEKTLLLD
FT                   AEDEEACVGLIACYEALCDDARAYTQYGAYLSRWRDNRVIRKDFIAFLERTERWSEAAD
FT                   HIELLASGERGGFWGTRLAFARKKAGQYRQAAIIYRALLRQRPDERVLLHNLVYCLDKM
FT                   GQADAGLRLLRAACNAFGTSVESRLIEGVLCLHTRRINAAIRTLRAVLEQQPGYTAASE
FT                   LLAKAYALASSRA"
FT   gene            complement(105906..106268)
FT                   /locus_tag="TPASS_0096"
FT   CDS_pept        complement(105906..106268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0096"
FT                   /product="possible dnaK suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70523"
FT                   /db_xref="GOA:A0A0H3BHI9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHI9"
FT                   /protein_id="ACD70523.1"
FT                   /translation="MDQSFVEEMKVSLVERKRSLARSLTTNNEDFQAIVAGVDPKDSAD
FT                   IASDDMDRKMLESLSAKDLRCLQQIESALLRIEQGRYGKCADCGESIPEDRLRAIPYSL
FT                   MCIECQSARESKRRAF"
FT   gene            106438..106656
FT                   /gene="infA"
FT                   /locus_tag="TPASS_0097"
FT   CDS_pept        106438..106656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="TPASS_0097"
FT                   /product="translation initiation factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70524"
FT                   /db_xref="GOA:A0A0H3BIC7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIC7"
FT                   /protein_id="ACD70524.1"
FT                   /translation="MTKEEAIEVDGVVKEALPNTTFRVQLQNGHEILAYLSGRMRKHYI
FT                   RIVPGDSVKVALSPYDLSRGRIMFRER"
FT   gene            complement(106716..107366)
FT                   /locus_tag="TPASS_0098"
FT   CDS_pept        complement(106716..107366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0098"
FT                   /product="possible heat-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70525"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP1"
FT                   /protein_id="ACD70525.1"
FT                   /translation="MSERTVPDHYAILGVAADASEEHIKKAFRAQALKYHPDKNPGDAC
FT                   AEDQFKRINAAYAVLSDRASRARYDAERAGGAFWSSRAGRDASEGFGAWTSRYGRQGRS
FT                   AHPLHTHARSLERARAGNRTLRGMVHFLRWFSWKWVELLEQCRRSARSGGSYRAHGLQE
FT                   RRGAPSHSGSGARPPGSIRATLLFSIWLLRDRIQRVLPGARSAHPEGRTLNPP"
FT   gene            complement(107370..108125)
FT                   /gene="smbA"
FT                   /locus_tag="TPASS_0099"
FT   CDS_pept        complement(107370..108125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smbA"
FT                   /locus_tag="TPASS_0099"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70526"
FT                   /db_xref="GOA:A0A0H3BJR8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJR8"
FT                   /protein_id="ACD70526.1"
FT                   /translation="MVTVLSLGGSIVAPETPDIELLGRFVRSVQRYLYEDASRKLIVVS
FT                   GGGAPARTYQNAYRALRRSLSSPACAKPAHEGDNQEDRELYATAEHVELDWIGIMATRL
FT                   NAQLLKSLFGILCPNPVVYDPTAANVFSGQVLVAAGWKPGFSTDTDAVLLAERYSAKTV
FT                   INLSDVAHVYTGDPRSDKDAKALTSLSWDDFLLLVDKEWVPGSHVPFDPVASVRAKKSG
FT                   IQVICATGRDLPNLERILNRQEFVGTTIG"
FT   gene            108320..108922
FT                   /locus_tag="TPASS_0100"
FT   CDS_pept        108320..108922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0100"
FT                   /product="possible thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70527"
FT                   /db_xref="GOA:A0A0H3BI75"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI75"
FT                   /protein_id="ACD70527.1"
FT                   /translation="MSCSRTTGALRAVPLVFRSVLVLAVWGVSCVQAADVAHNADVPSR
FT                   SLKALERFRFFVYPKPLDLSSDFHAKALKGEALVPSLFKGKVTLLNFWATWCPPCRAEM
FT                   PSMDRMQALMRGNDFQIVAVNVGDSRKQVESFIARGKHTFPIYLDEEGSLGSVFASRGL
FT                   PTTYVVDKAGRIVAVVVGSVEYDQPELVALFKELARD"
FT   gene            108915..109709
FT                   /gene="ccdA"
FT                   /locus_tag="TPASS_0101"
FT   CDS_pept        108915..109709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="TPASS_0101"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70528"
FT                   /db_xref="GOA:A0A0H3BHJ4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHJ4"
FT                   /protein_id="ACD70528.1"
FT                   /translation="MTSVPGVVGSFLAGLLSFLSPCVLPLIPAYVSFISGESLGSIRAG
FT                   AARLQVFLSSVFFVLGLTTVFVLFSIVFSGGVQLAGAGVLTVLTRVAGVGVILLGLNTI
FT                   FDVVPFLRVERRMHTTVRRVGVFRAYLFGLLFATGWTPCVGPILSSLLFYAASSGQLLH
FT                   AAGLLTVYALGLGLPFVFAGIFFGRAERVFAWVKSHMHAVKLASGMLIVFFGLLMLTSG
FT                   LQALSRLFLRAGFALEEYSTRGITPLRQIAALLAQWFLYQGV"
FT   gene            complement(109747..111720)
FT                   /gene="rep"
FT                   /locus_tag="TPASS_0102"
FT   CDS_pept        complement(109747..111720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="TPASS_0102"
FT                   /product="Rep helicase, single-stranded DNA-dependent
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70529"
FT                   /db_xref="GOA:A0A0H3BID3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID3"
FT                   /protein_id="ACD70529.1"
FT                   /translation="MLSTLNPEQRRAVTTLEGPLLIIAGAGSGKTRVITARIAYMLECG
FT                   ILQSRILALTFTNKAAHEMSERIKALTGKPLRNTTVSTFHAFGVTILREHIHVLGWRKN
FT                   FSIYDENDKRALIREAAKEVHLLPEVLDTNCVSTLFSAIKMQRKNLKELQHKERALWHE
FT                   YHTALKLFNAVDFDDLIVLPIQIFSEYPDILASYKSRYHYILVDEFQDTSAQQYRLMKM
FT                   LATQNICVVGDDDQSIYSWRGAHHDNILSFEKDFPYATEITLEQNYRSTGTILAAANGV
FT                   IAHNTQRKEKALWSGNDSGKPIEIFNPETERDEAIFIANTILAEQIRASYSFSSFGVLL
FT                   RTNSFMRIIEDVFLQENIPYRVSGGMSFFQRKEIKDVLSYLRVISNPDDDVNLLRIINT
FT                   PRRGIGKKTLHLVSDIANTQQCSVFNALNQIINKTHAVDLKESHRTAVENFLQLITQAR
FT                   THLLSGKNLAYKVRKFVEDIQYFNYLIQEFQKNEHAARFKFLQIEHLVESIEHWEQSSE
FT                   HGSLYDYLNRVTLLARDNVQKETEGAVSLMTIHASKGLEFPVVFIAGVEAGTIPHERSI
FT                   EEVHSIEEERRLFYVAITRAKEKLYLTHCRTRKRGGKREERTASPFLDEIPKHLVRAHA
FT                   PEGKISEEEVTRAFTRIKKLFT"
FT   gene            111785..113608
FT                   /locus_tag="TPASS_0103"
FT   CDS_pept        111785..113608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0103"
FT                   /product="possible ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70530"
FT                   /db_xref="GOA:A0A0H3BJP5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP5"
FT                   /protein_id="ACD70530.1"
FT                   /translation="MGNTSDWVEMDGLRYVYAAQGAAPMPAPTDNPACDAHMSHDVIAR
FT                   TAQAVFGIRALFPWQRLVIANILDAAHACTHTTPFAAAGSSQTDATRVTHVDDAQPEDN
FT                   FVGAMQDTRFDQDGVSRAHQVVLLPTGAGKSLCFQVPALFLEGPTLVVYPLLSLMRDQC
FT                   RRMQAVGFSVILLRGGLNAQERAYMYAQLDRCAEAYGRMRGVTPPAHQTAEFSLADSIS
FT                   FDASLFSDDVSTFSKVVHVDERLAQKRTESRRGVCIIASPEILTQPALRARVRACRVAH
FT                   LVIDEAHCVSEWGDSFRPDYVRLGELVQDLAPQVVTAFTATASQTVLARIMEVLFGGRA
FT                   HVLQGTVDRPNIRYTVRTVLCKQTALTQLVARCVRPAVIFCARRVQVERVAHHLRTCLS
FT                   DTQIRFYHAGLQREEKETVERWFHTHDSAVLVTTCAWGMGVDKPNVRTVIHVDAPLTVE
FT                   AYVQEVGRAGRDGMRADAFLLWSPRDARSIETLPHAQRVRAHVLRHFAESGRCRRAVLL
FT                   ESLGEQNVCAGCDVCAGTARFVCEDVEALLQFLKKNARRFTVSSLVQHLALHQKVLSVA
FT                   DVRALLYYALETGRVKKKHSLLWGDVLYVAR"
FT   gene            113855..115636
FT                   /gene="ushA"
FT                   /locus_tag="TPASS_0104"
FT   CDS_pept        113855..115636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="TPASS_0104"
FT                   /product="5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70531"
FT                   /db_xref="GOA:A0A0H3BJS5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006420"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJS5"
FT                   /protein_id="ACD70531.1"
FT                   /translation="MKRFIPHRVIHAVCIGLALVGCRKLDSRAGDFELTIIHINDHHSH
FT                   LEPEPLELAVAGERLRAAVGGYAALVHEIQRLRAESKNALVLHAGDALIGTLYSTLFRG
FT                   RADAVLMNHAGFDFFTLGNHEFDNGNEGLKEFLHYLEVPVLSANVVPNAASTLHGLWKP
FT                   SAIVERAGERIGVIGLDTVKKTVESSSPGKDINFIDEIEAVRRATVEMQQQGVNKIILL
FT                   SHAGFEKNCEIAQNISGIDVIVSGDTHYLLGDESLGRLGLPVVGEYPRKIMSPAGEPVY
FT                   VVEAWEYGKCLGELNVVFDRTGVITSAVGMPRFLLHTNTLQKKGADRKNYPLEEAEREA
FT                   LLVALRMTPEIIFAQENDQIISVLEEFKKEKEALGAQAIGVITGASMRGGSVHRVPDAQ
FT                   NPQGSVATRFVAETMLSDIQSFGAGKVDCVIQNAGGARSNIQPGEITYNDAYTLLPFSN
FT                   TLVLVDVSGAELKQIIEDALQFALGDGSTGAFPYGAGVRYEARQEPDEHGKRVIKLEVQ
FT                   KKDGAWVPVDERAPYRLGVNSYIARGKDGYKTLGEIVSTRGAEDTYLRDAESLIKFLRA
FT                   HKNFRAYTDSNVIFRLK"
FT   gene            115803..118796
FT                   /gene="polA"
FT                   /locus_tag="TPASS_0105"
FT   CDS_pept        115803..118796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="TPASS_0105"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70532"
FT                   /db_xref="GOA:A0A0H3BI78"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI78"
FT                   /protein_id="ACD70532.1"
FT                   /translation="MQEKKTLYLLDAYGLIYRSYHAFARAPLINDSGANVSAVYGFFRS
FT                   LHTLLCHYRPRYFVAVFDSLTPTFRHVQYPAYKAKRDKTSAELYAQIPLIEEILCALGI
FT                   TVLRHDGFEADDLIATLAKRVAAEHCHVVIISSDKDVLQLVCDTVQVLRLDIDHKWTCC
FT                   DAAYVQQRWTVMPTQLLDLFSLMGDSSDNVPGVRGIGPKTAAHLLHCFGTLDGIYRHTY
FT                   SLKEALRTKIVCGKKDAFFSRSLIELRDDVPCVFSLEDSCCIPLDVTSAARIFVREGLH
FT                   ALAQQYRACVQEIDTEATNDTLQMTESSVLTSGRCANECFLSQVEGRASTPEVNSVLKS
FT                   ELKTSAVSGAIPIENRDLRQDVMLARSAGHYRGVTDPVELKRIIDCACANGVVAFDCET
FT                   DGLHPHDTRLVGFSICFQEAEAFYVPLIVPDVSLHTESTQCTCARSTNVETEKECTEQH
FT                   GVSASAVQDPAYVQAVMHQLRRLWNDETLTLVMHNGKFDYHVMHRAGVFEHCACNIFDT
FT                   MVAAWLLDPDRGTYGMDVLAASFFQIRTITFEEVVAKGQTFAHVPYECAVRYAAEDADI
FT                   TFRLYHYLKLRLETAGLLSVFETIEMPLLPILARMEEVGIFLRKDVVQQLTRSFSDLIQ
FT                   QYEHDIFSLAGHEFNIGSPKQLQTVLFQELHLPPGKKNTQGYSTDHSVLKKLARKHPIA
FT                   EKILLFRDLSKLRSTYTESLAKLADQTGRVHTSFVQIGTATGRLSSRNPNLQNIPIKST
FT                   EGRKIRQAFQATVGHELISADYTQIELVVLAHLSQDRNLLNAFRQHIDIHALTAAYIFN
FT                   VSIDDVQPAMRRIAKTINFGIVYGMSAFRLSDELKISQKEAQSFIYRYFETYPGVYAFS
FT                   TQVAEQTRKTGYVTSLAGRRRYIRTIDSRNTLERARAERMALNTQIQSSAADIVKIAMI
FT                   AIQRAFARRPLRAQLLLQVHDELIFEAPAAETAIVKEILFAEMEHAVELSIPLRIHVES
FT                   GNSWGDFH"
FT   gene            complement(118828..120360)
FT                   /locus_tag="TPASS_0106"
FT   CDS_pept        complement(118828..120360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0106"
FT                   /product="possible carnitine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70533"
FT                   /db_xref="GOA:A0A0H3BHJ9"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHJ9"
FT                   /protein_id="ACD70533.1"
FT                   /translation="MQKEKCDFSVSLIPLGIVISCALLFISFPDISHRVIGTLLNILVN
FT                   KLGFFYILTGLFFLGTTLTIAFSRYGAVYLGTTRTARYSNFTWGSMIFTSTMAADILYW
FT                   SLIEWAHYFTQAPFIAEHSPPTERQEWAAAYPLFHWGIIPWSFYVLLAVAFGYMLHVKK
FT                   RHTHKISEACRPLLGAYVDGIIGEAIDICSVVGLLLGVATTFSLATPLLSLMVSLLFGI
FT                   SNTQLLALALLCVIALVYTTAVLLGTQGISKLSRAAVYCFSTVLVFFLCAGPTVYLIET
FT                   GITAIGKMLQNFFLMATWMDPSRISLQETDGTLGFPQRWTIFYWAYWITWSVATPFFIG
FT                   AISEGRTIRNTIVGGLCWGIAGTYGSFIVLGNYGLYLQTHHLLPAAYFVRAGNTPAEVI
FT                   IAIIQTLPCAYIVMALLAATMIAFYASTFDALTLIIASYSQKSVAPGEEPRQIMKSFWA
FT                   VACILLPASLIFSQSTLMHLKSLAIIAAFPLALIMLCVVASFFKELRAEVTS"
FT   gene            complement(120341..121918)
FT                   /gene="licC"
FT                   /locus_tag="TPASS_0107"
FT   CDS_pept        complement(120341..121918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="licC"
FT                   /locus_tag="TPASS_0107"
FT                   /product="protein LicC"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70534"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017190"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID7"
FT                   /protein_id="ACD70534.1"
FT                   /translation="MAAGFGSRCVPLTYATPKGLLKVFGEPMIERQIRQLHEVGITDIT
FT                   VVVGYLKEAFEYLVDKHDVTLTYNPDYETANNLSTLYHARHLLRNTYILSSDNWLRENI
FT                   YHSHEWDSWYTAVKTQGKTKEWVLKTGLYDKITAVKIGGRSGWIMYGPAYFSASFSKKI
FT                   IPLIEAAYMRPENRAWFWEDVFMRNTKSLTMFANKQADNLIYEFESLDELRKFDFAYMV
FT                   SSDNEWMRVISHVFNQPEMTIGKLRPLKAGMTNKSFIFELNDKPYLFRIPGEGTELLVN
FT                   RFQEAAVYEAIKPLNICDTLVHLEPARGIKITVFHKDCRSANPSDPADLDLCMRIARKL
FT                   HQSGICVAHRFDFRSRIAYYEKLALDQYSILYADYRSVREKMNTLLAIVDSVDKPCVLT
FT                   HVDLTPDNFLLCDGSAQLIDWEYAGMCDPLVDIAMFSLYAHFNTAQIEDLMYRYFQRNP
FT                   HGEERLRVFCYIALGGFLWSLWTSYKQALGISFGDYGLKMYRYAKEYYEAVQTLLKTHR
FT                   ADHAERKM"
FT   gene            complement(122272..123657)
FT                   /gene="pfk"
FT                   /locus_tag="TPASS_0108"
FT   CDS_pept        complement(122272..123657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /locus_tag="TPASS_0108"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70535"
FT                   /db_xref="GOA:A0A0H3BJP9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP9"
FT                   /protein_id="ACD70535.1"
FT                   /translation="MAHLPKEYDFSIESLGESKIPSPIYLSHTLGDFIPNYVSDNEYIS
FT                   HELSARLGETVGPFTHKNLMERAGPRQKIFFNPHHVHAGIVTCGGLCPGLNDVIRAIVR
FT                   CLWGRYGVKRISGIRFGYKGLLPDYNFDILPLTPEVIDNCHKTGGSLLGTSRGGGNRVV
FT                   DIVDGIERLNLHILFIIGGDGSQKGAKEIADEIKHRNLKISIIGIPKTVDNDISFVQKS
FT                   FGFDTAIVKATEAVAAAHMEARSQINGIGLVKLMGRESGFIATYTAIASHETNFVLIPE
FT                   VSFDLDGPNGLLAHLEKRIALRKHAVLVVAEGAGQDLMVNADGVPSGDSQGGSLRVSSG
FT                   TDASGNKRLADIGLFLKEKIGVYFKEKRIHINLKYIDPSYLIRSAVAAPIDSIYCERLG
FT                   NNAVHAAMCGKTKMIIGLVHNKFVHLPIDVVVCQRKHVNPEGSLWRDALDATGQPIVMK
FT                   NII"
FT   gene            complement(123759..124637)
FT                   /locus_tag="TPASS_0109"
FT   CDS_pept        complement(123759..124637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0109"
FT                   /product="possible rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70536"
FT                   /db_xref="GOA:A0A0H3BJS7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJS7"
FT                   /protein_id="ACD70536.1"
FT                   /translation="MVISGLRAIEEFLRAQPAALEGLHAGGKNSKTQQSCVRVLTLYYA
FT                   AENARIKRLLGMAAARGIRITHTTCAVLDKLARSLPPALRDHRGILAVLSSPSATPQGS
FT                   HTRKKRPAVDSSQERTLLHALATHTHALVLVLDAITDPHNVGAIVRSADQFSVDAVLLP
FT                   HHHGAGGTETITRVSAGAVAWVPLVRVRNLVRTAGILKRSGFWLYGADVAGEAIGARTF
FT                   PPKTALVLGNEGHGVSPLLRTHCDALISIPTQGNVDSLNVSVAAGILLYEIRRSQQSPY
FT                   SVQRQNEMNAQ"
FT   gene            124897..124967
FT                   /locus_tag="TPASS_t0006"
FT   tRNA            124897..124967
FT                   /locus_tag="TPASS_t0006"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA-Gln1; codon recognized: CAG"
FT   gene            124977..125048
FT                   /locus_tag="TPASS_t0007"
FT   tRNA            124977..125048
FT                   /locus_tag="TPASS_t0007"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA-Glu2; codon recognized: GAA"
FT   gene            125085..125156
FT                   /locus_tag="TPASS_t0008"
FT   tRNA            125085..125156
FT                   /locus_tag="TPASS_t0008"
FT                   /product="tRNA-Glu"
FT                   /note="tRNA-Glu1; codon recognized: GAG"
FT   gene            125178..126911
FT                   /locus_tag="TPASS_0110"
FT   CDS_pept        125178..126911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70537"
FT                   /db_xref="InterPro:IPR035196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI80"
FT                   /protein_id="ACD70537.1"
FT                   /translation="MRGYGDAMNEQLSTFDKLVETLSTEDAQRMLAGIGKALRTSEANA
FT                   ETPAKVKKKRAFARWDTREDSLAGETFFFRFWIGVKSFFRSSSVEALYEETLLQRLGND
FT                   LKAHYAQYIDVKEKTFTKVFYDKMGELRKTQVFFDSLLACYNSDKGDFYLLLSSFITPV
FT                   VYEQLMACSDPFAAQGDGTPSGLRASLLKRMDVALATLSGPHKTELYQAARAIEWMKVF
FT                   CEVPVDRILLRFTVISPASAVCPITILQSELEKLACVIHDSKHIPDAVLQGLFVLKSKT
FT                   SLHDAQVDNAAHAAAFLKEASAALVVIKDLSHSIPIEDFVRFAGRNIRWQPRAIAGGED
FT                   WFVLFKKAWKKRFNEKWALWSTAQKRLVLKEQMLSLLGREQFSELTHRPWEGFWYQLVF
FT                   RREMSFVFLKNLFEGAYARVVSPPLNVILAEGSFYRRDELIEYTDAVNVLEQMGAKIRN
FT                   FEVRLSPVGEWGVAFSAQRKEHTVTMKSKGILEALIKVIDSEATVLLDATLKAFHCIGA
FT                   MLASMIGASKTSAYATLTNWSDIRGSDNASFREQASQARAYVQTASRALVEMENLETTH
FT                   L"
FT   gene            126971..128398
FT                   /gene="rpoN"
FT                   /locus_tag="TPASS_0111"
FT   CDS_pept        126971..128398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="TPASS_0111"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70538"
FT                   /db_xref="GOA:A0A0H3BHK4"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHK4"
FT                   /protein_id="ACD70538.1"
FT                   /translation="MQQLVQQQRLVLNQRLVHGLCLLQLSRGDLKTEVLRAVQRNPLLE
FT                   IRPSSARRTGKACYLSLGDRRERMRARDRFQQLLENQPDKQVDNIRAVLREQVFYQKHE
FT                   AIVLDLACAFIQMLDDHGFFSISPAIFQNMCGSMPTALQEKIPQAIALIQRLEPQGCAV
FT                   FNFKESLAVQARLRFERFSDPLYRCVINLLTHHSELLFCSDNMCDGRVSVHALTTQINS
FT                   MGLCVQKVSSNDVKDILLLIKELHPFPGKCVSNAQRADTNMLLEPDVLITKTAHGFVTQ
FT                   INCTGIPTVVFRNDYCMHSKAAEKNHALKACMHDALSLVSMLSYRERTLLDIAKTIVHY
FT                   QCGFFDHGPAKLTPLRMTDVAHRTGLSVSTVSRIVRDKWLQYGSQHFSLRYFFSPRVLS
FT                   TEEYRDRSSLGQNYPSSPHSKVSVKYRISRLIQEVRTQRISLSDRRIAQLLGEQGIKCA
FT                   RRTVNKYRSELRTCSSS"
FT   gene            complement(128395..129747)
FT                   /gene="pepC"
FT                   /locus_tag="TPASS_0112"
FT   CDS_pept        complement(128395..129747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="TPASS_0112"
FT                   /product="aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70539"
FT                   /db_xref="GOA:A0A0H3BIE3"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE3"
FT                   /protein_id="ACD70539.1"
FT                   /translation="MYLTKELLDTFAHEVAADPIHKAVAGAVARVGLEEAALNTEVARQ
FT                   HTHIFSTETKRGEMTNQKMSGRCWIFAALNAARVNTMKKLDIETVEFSQNYLFFWDKLE
FT                   KANFFLENILETLDEPLTSRLMAHLLANPVQDGGQWDMFSGLLEKYGLVPKECMPETFH
FT                   SSNSRVLLAVLTRRLRKHAQLLRSAHEEGVALHTLREKKEAFLSSIYSILVKALGRPPE
FT                   KFDFVYKDKEKKFHKVRDLTPQKFFCDFVGWDLKNKVSLIHAPTADKPFGRAYTVKFLG
FT                   TVKEAPCICYVNTPIEVLKEATASAIRAGEPVWFGCDVGQMMTRKDGIMDTEIFGYESM
FT                   LGTTPEFNKAERLDYGESLLTHAMVITGFDEDAQGNPVRWQVENSWGDDTGKKGMFSMS
FT                   DRWFDEYLYQITIDKKFVPQVWLDALEKPIIALEPWDPMGALADTPLYLKN"
FT   gene            129889..130875
FT                   /gene="hflK"
FT                   /locus_tag="TPASS_0113"
FT   CDS_pept        129889..130875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="TPASS_0113"
FT                   /product="Lambda CII stability-governing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70540"
FT                   /db_xref="GOA:A0A0H3BJQ3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJQ3"
FT                   /protein_id="ACD70540.1"
FT                   /translation="MRIPKWTPATWSVVAGCIGGVLGIVIVGIASPIRIISPTDNGVVT
FT                   RFGKYHRTLEPGLHYLIPFVEWVYKVPVTKVQKEEFGFRTSKSSEQSHYVNNISHESLM
FT                   LTGDLNIVDVEWVVQYRIVDPRAWVFNVESQERRQTIRDISKAVVNSLIGDRAILDIMG
FT                   PERSAIQMRAKDMMNVLLKRIGLGVLVSSVQLQNVVPPQEVQQAFEDVNIAIQDMNRLI
FT                   NEGKESYNREIPKARGDADKLIQEAMGYANERVNRAKGDVARFDSIYAEYVKAPHVTKT
FT                   RLYLEGLGAILEKTENVLLIDKKLENLLTLKDISKVSKKVVAGTREE"
FT   gene            130880..131875
FT                   /gene="hflC"
FT                   /locus_tag="TPASS_0114"
FT   CDS_pept        130880..131875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="TPASS_0114"
FT                   /product="Lambda CII stability-governing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70541"
FT                   /db_xref="GOA:A0A0H3BJT5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJT5"
FT                   /protein_id="ACD70541.1"
FT                   /translation="MRKRGLQVHARVRPVLNIGIVVGVLLGGVVLLQPFYLIQEGQVAL
FT                   ITQFGEIIKTNNTAGLYVRAPFLHHVHKYTAKLLRVDGDPQKIPTKEKQFIEVDTTSRW
FT                   RIEDVKKFYQSLGTYEAAYSRISDIIDSSVRDIITVNGLDDVVRSTNAINESNHSEQFD
FT                   VPVSQLAFDRGAEKTAHMTIEKGRESLAREISQAANDQLKDFGIVVVDVIFKGIKYSDE
FT                   LQASVFNRMVKERNQIAQMFRSTGEGKKAEWLGKLDNEKRSLLSKAYEEAERIKGEADA
FT                   RAAAVYAQSYGKSPEFYGFWKSLEVYKKSLPDTEKILSTDLEYFKHLYQH"
FT   gene            complement(131900..132709)
FT                   /gene="thiD"
FT                   /locus_tag="TPASS_0115"
FT   CDS_pept        complement(131900..132709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="TPASS_0115"
FT                   /product="phosphomethypyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70542"
FT                   /db_xref="GOA:A0A0H3BI84"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI84"
FT                   /protein_id="ACD70542.1"
FT                   /translation="MVKLLSIGGSDASGGAGIEADLKTFQEYGAFGVATLTAIVTMDPS
FT                   RNWSHRVHSLEEDCVRDQLETAFAGVGVSAVKSGMLASVHAIECVAEYLERFAVAAYVF
FT                   DPVMVCKGSGDALHRELNELMIQKLLPRATVVTPNLFETAQIADISVPRTVDEMKEGAR
FT                   LIHERGASHVFVKGGGRLPGCKHALDVFYDGKTFHLVEDELVQSGWNHGAGCTVSAAIT
FT                   AGLGRGLTAYDAILSAKRFVTTGLRHGFQVNQWVGTGNLSKWRDRFH"
FT   gene            132860..134866
FT                   /gene="uvrB"
FT                   /locus_tag="TPASS_0116"
FT   CDS_pept        132860..134866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="TPASS_0116"
FT                   /product="excinuclease ABC, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70543"
FT                   /db_xref="GOA:B2S264"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S264"
FT                   /protein_id="ACD70543.1"
FT                   /translation="MKEFKLHASFQPAGDQIAAIDALVRGLHAGARFQTLKGVTGSGKT
FT                   FTVANVIARVQKPTLVISHNKTLSAQLYREFKGFFPDNAVEYFVSYYDYYQPESYVPAR
FT                   DLYIEKDASINAEINRMRLSATFSLMERRDVIVVATVSCIYGLGLPESWRDLRIHVEVN
FT                   QCLDLEDLKRQLVSLQYERNDAVLECGRFRVRGDVIEIFPAYLEEFYRIECDWDRVVRI
FT                   RRIHPVSGAVLREFEELTVYPAKHFVLKEDAIPRAMDRIRQELDERLVQLTQENKLAEA
FT                   ARLKTRTEYDLEMLGEMGYCHGIENYSAPIAGRKSGEPPVTLLHYFPKDFVLFVDESHV
FT                   TLPQLGAMYEGDRVRKQNLIDFGFRLPCARDNRPLKDSEFEALLNQAVFISATPGVKER
FT                   TQSVQIVEQLIRPTGLLDPCIEVRKTDGQIEDICQRVKACSARNERSLVLTLTKKMAED
FT                   LTDYFNGLGIRTKYVHSEIETIERVEILTSLRAGECEVLVGINLLREGIDLPEVAFIAI
FT                   LDANIVGFLRSTTSLIQIIGRAARNARGTVVMYADAISDAMREAIEETARRRKIQMAYN
FT                   RAHGITPRTIKKSIEDILVREQEVKKDAARVQVAPLLRAADADVRTHAARKKMVQALRL
FT                   HMKVCARELRFEEAALIRDKILQLQRQDEQNGV"
FT   gene            complement(134898..136694)
FT                   /gene="tprC"
FT                   /locus_tag="TPASS_0117"
FT   CDS_pept        complement(134898..136694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprC"
FT                   /locus_tag="TPASS_0117"
FT                   /product="protein TprC"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70544"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHL0"
FT                   /protein_id="ACD70544.1"
FT                   /translation="MGRQVMQAGVLAGMVCAASGYAGVLTPQVSGTAQLQWGIAFQKNP
FT                   RTGPGKHTHGFRTTNSLTISLPLVSKHTHTRRGEARSGVWAQLQLKDLAVELASSKSST
FT                   ALSFTKPTASFQATLHCYGAYLTVGTSPSCVVNFAQLWKPFVTRAYSEKDTRYAPGFSG
FT                   SGAKLGYQAHNVGNSGVDVDIGFLSFLSNGAWDSTDTTHSKYGFGADATLSYGVDRQRL
FT                   LTLELAGNATLDQNYVKGTEDSKNENKTALLWGVGGRLTLEPGAGFRFSFALDAGNQHQ
FT                   SNAHAQTQERAILKAREVFRRVEGKLVQNLPNIMMPPGITEQTTLIEMVGLAALIAEGT
FT                   LGSAIQTVLAAGALAALVSQLVPNIEQGVRDVFRSSDPRVVTAKLLAFLERAPMNALNI
FT                   DALLRMQWKWLSSGIYFATAGTNIFGKRVFATTRAHYFDFAGFLKLETKSGDPYTHLLT
FT                   GLNAGVEARVYIPLTYVFYRNNGGYELNGAVPPGTINMPILGKAWCSYRIPLGSHAWLA
FT                   PHTSVLGTTNRFNIINPAGNLLNERALQYQVGLTFSPFEKVELSAQWEQGVLADAPYMG
FT                   ITQSIGSDRHFGTLVCGMKVTW"
FT   gene            complement(136774..138039)
FT                   /locus_tag="TPASS_0118"
FT   CDS_pept        complement(136774..138039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE8"
FT                   /protein_id="ACD70545.1"
FT                   /translation="MFADKSLSALNAACQRAQQDLQSHCCSLGEHIVRGGAACDISGLG
FT                   VQDTDISRCHALQRQRDQVAESILDIKSILQRQEELAALGKRVSKVLHRHARQERDVLR
FT                   SFVAQYYATYAHVGLPALEPIYARTAELESTLQDLRAKRDQLLETCTFGSILERVGLQA
FT                   KSAVVQRRIRVLEAKIQKIITLCTPDVIAHPDVERMYHAGELSSALSAAYARLISDRGV
FT                   YASNLQHSQELMDEQEALDARLRALDCGAKPLKRVAAFTAQVSELDEDINALCARIGAA
FT                   YASCFFTEEGFAQPPLSQKTRPTVPDELSTLLRTVAEARMRVARAGYQVECAKLRQKLQ
FT                   SEQRVCESFCRSIEEYRRGIKEYEAMIESAQQNVALSKATVARLAQSLEEASERLTLFE
FT                   TSPEPIVLSSEVLSVPQEKASV"
FT   gene            complement(138137..138796)
FT                   /gene="yaeE"
FT                   /locus_tag="TPASS_0119"
FT   CDS_pept        complement(138137..138796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="TPASS_0119"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70546"
FT                   /db_xref="GOA:A0A0H3BJQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJQ8"
FT                   /protein_id="ACD70546.1"
FT                   /translation="MANQTLWLLVARATGQTSLMVCASASIALAAGTPLGILLCVMSPG
FT                   HVWAHPAWHRVLSSSMNVLRAFPFVILLVVLLPLSRMLTGRTVGTAAAILPLAIAALPF
FT                   VARVIESALLEVEPGIIQAAVAMGSSMRQLVLKIMLPEAAPACVSGVALMVINLIGYSA
FT                   MAGAIGGGGLGDVAIRYGYQRFQPEVMTMAVLAILAQVALTQWIGRIICTRIRARR"
FT   gene            complement(138796..139605)
FT                   /locus_tag="TPASS_0120"
FT   CDS_pept        complement(138796..139605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0120"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70547"
FT                   /db_xref="GOA:A0A0H3BJU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJU0"
FT                   /protein_id="ACD70547.1"
FT                   /translation="MVRLERLKKTYAGVPILRDISLEIPAHGMYGIIGKSGAGKSTLLR
FT                   IMSLLEKPDEGAVFYHTTRVDLLRGAALRAQRRRIGLIFQQFHLFSSRTVFGNVAYPLE
FT                   IARYARKDAYARVLHLLHLVGLADKAQARISTLSGGQKQRVAIARALAAEPAILFCDEA
FT                   TSALDPQTTQSILTLLKNVQCSLRLTVVLITHQMEVVRDLCDRAAVLHEGEIVEEGRVT
FT                   QLFAAPRRLITQQLLSGCSFASFAKSEPFHRMSSGACAVHAIDKAHW"
FT   gene            139735..140802
FT                   /locus_tag="TPASS_0121"
FT   CDS_pept        139735..140802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70548"
FT                   /db_xref="GOA:A0A0H3BI87"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI87"
FT                   /protein_id="ACD70548.1"
FT                   /translation="MSMAECTREQRKRRGAGRADEHWRTLSPASCAADALTEHISPAYA
FT                   HLIAQAQGADAQALKRQVCFAPQERVVHACECADPLGEDRYCVTPFLVHQYANRVLMLA
FT                   TGRCFSHCRYCFRRGFIAQRAGWIPNEEREKIITYLRATPSVKEILVSGGDPLTGSFAQ
FT                   VTSLFRALRSVAPDLIIRLCTRAVTFAPQAFTPELIAFLQEMKPVWIIPHINHPAELGS
FT                   TQRAVLEACVGAGLPVQSQSVLLRGVNDSVETLCTLFHALTCLGVKPGYLFQLDLAPGT
FT                   GDFRVPLSDTLALWRTLKERLSGLSLPTLAVDLPGGGGKFPLVALALQQDVTWHQEREA
FT                   FSARGIDGAWYTYPF"
FT   gene            complement(141022..142878)
FT                   /gene="pckA"
FT                   /locus_tag="TPASS_0122"
FT   CDS_pept        complement(141022..142878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="TPASS_0122"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70549"
FT                   /db_xref="GOA:B2S270"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S270"
FT                   /protein_id="ACD70549.1"
FT                   /translation="MELHEIAHARAKAWIEEMVALCAPDTVYVCDGSKKEYDTIMQKMV
FT                   DAGLATPLKKRKNCFLFRSQPSDVARVEARTFIASKREDDAGPTNHWTDPAELKKTMTG
FT                   LYSQCMKGRTMYVIPFSMGPVGSPISKNGIEITDSEYVVCNMHIMTRVGTRVLEALGTD
FT                   GEFVPCLHSVGKPLGPGVTDAGQWPCADMERKYISHFPEERLVWSFGSGYGGNALLGKK
FT                   CFALRIASVLARDEGWLAEHMLILKITNPAGKTKYIGAAFPSACGKTNLAMMIPTLPGW
FT                   KVETVGDDIAWMKFGKDGRLYAINPEAGFFGVAPGTSDFSNKNAMDSIKENAIFTNCGL
FT                   TEDGDVWWEGIGYPAKGTIIDWHGVSRPAPTRDKSPKGEEIAHPNARFTAPARQCPAIA
FT                   SNWEDPEGVPIDAFLFGGRRPSTVPLVHQARDWNHGVFLGSIIGSEVTAAVISDQVGQI
FT                   RRDPFAMLPFCGYHMADYFSHWIKLGSQARAENLPKIFCVNWFRKDAEGNFLWPGYGDN
FT                   SRVLAWIFDRCDGVDNAVETAIGWMPKEGALNTEGLNVSTQAVKELLSVDIAGWKKEIK
FT                   DIRENHYPKFGARLPQQLRDALEVLEARINGSEGAACTRDMC"
FT   gene            142984..145554
FT                   /locus_tag="TPASS_0123"
FT   CDS_pept        142984..145554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70550"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHL5"
FT                   /protein_id="ACD70550.1"
FT                   /translation="MSLSPQGADMSGVLYLGRFTLCLLPVSCFSQKVMTCADTVRGAQE
FT                   VFMLCIYVELPYYYQLTRIFPADIESLCARMRRFAVHNGAALHEASSVRIFAFEAHSLG
FT                   SVYAAVRCVRALYQTLDTYEKQVKEFRILMDVVADDASPCLIEDRFHAYRSTLIPDRGF
FT                   FASFRAKQLLKHYLEFLPLPALNMYQVNGFLSLCAEKPFPQGVTTHCIVVRTTSSYMSA
FT                   LCNFMALHPLSEAVYSTLSEETRAFFFHLRAAVSFFKRRRYDSSFPQYLTDAFLQYVGL
FT                   YFKLYYEAAPNAAPPPIYVDPCAGHESQKQAEKVLIVSPHSPLMRLPASCADIEAIPQD
FT                   LAEVMYTLSLASRYIFADEIEEFFLFLKKHADFVGDLFDKMFCTQVTMVPHNAYAIPED
FT                   VHDSLEKRVRVKMPVIRECISSFLWKKYQEGSLCASTDLLRTFQELQYKYTSDCVLHSL
FT                   FHTYSDVQIAHLQVEEYTGTDVGAVLKVYQHTLLVGMREDAEAAFREAKACLTTLQARR
FT                   FVSAEYRTFSLLGFLTIGQSKFEDALVYFGYALDDAEQLRDGDFLCSALFHLSITYFLQ
FT                   HNFTQARLFLSKLSDAISTYFEQRWKTVSLFMQGRISLSLGEYAQARRCFDEAADFALQ
FT                   YFEHQEPLCRVWAAHARLLADKSYAAHALFQDMCDQYPDAYLFLVESYVRAECFDDPTL
FT                   FQSFPEETTSREPCVPSFSLDTPIYSGFSCAEDLVWGRQCAFAVSAQHSTVFAHYYHCR
FT                   VHLHRAEDMQTFHHHKQKLEAIARRAFQIGDPSAALFLYLCYDVSYRVHGAEAAVTTAH
FT                   LSRAFKVMQRSVAYMSENTVRAQFMQDNFWNAKLFAAAQANKLI"
FT   gene            145568..146674
FT                   /locus_tag="TPASS_0124"
FT   CDS_pept        145568..146674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0124"
FT                   /product="possible GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70551"
FT                   /db_xref="GOA:A0A0H3BIF3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF3"
FT                   /protein_id="ACD70551.1"
FT                   /translation="MAVNCGIIGLPNVGKSTIFSALTANVVEAANYPFCTIEPNVGMVT
FT                   VPDVRLEALAGHFRPKKTVYASIECVDIAGLVKGASQGEGLGNRFLAHVREVGVLAHVV
FT                   RCFEHTDIVHVHNKVDPLSDIETVHIELALADLASVEKRAVRAQKESRMGKSLQKESTL
FT                   VLRALDTLREYLEMGKAACMAPLSDEERNAVRDMRLLTMKPHLYVCNTDESGMQYGNDF
FT                   VRAVQEHARVHNTQAIVMCGKFEAELAQLSDVAEQNAFLQELGLRESGRAALARAVYSL
FT                   MGLRTFFTAGPEECRAWTIRAGLRAPHAAGVIHSDLERGFIRAETYSFDDLASCGSVAK
FT                   VREANRVRQEGKEYEVQDGDVIFFKFNV"
FT   gene            146751..147545
FT                   /gene="exoA"
FT                   /locus_tag="TPASS_0125"
FT   CDS_pept        146751..147545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="TPASS_0125"
FT                   /product="exodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70552"
FT                   /db_xref="GOA:A0A0H3BJR3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJR3"
FT                   /protein_id="ACD70552.1"
FT                   /translation="MRPVQRIISWNVNGIRAIERKDFLSWLAREAPDVLCLQEIKAHES
FT                   QLSAALRAPVWSAGAGGTYYTYFHSAQRPGYSGTALFSKRAPDAVRFFGVPAFDCEGRM
FT                   LAARFGELTVVSAYFPNAQEGGKRLAYKLDFCAAFRAFCDEERTAGQHVILCGDYNIAH
FT                   KEIDLAHPQENEGNPGFLPQERAWMDTFTEAGYADSFRAFCTEGQQYTWWSYRARARAR
FT                   NIGWRIDYQCVDQAFLARVTSSQILSEVTGSDHCPVCLTYAD"
FT   gene            complement(147609..148484)
FT                   /locus_tag="TPASS_0126"
FT   CDS_pept        complement(147609..148484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70553"
FT                   /db_xref="GOA:A0A0H3BJU5"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJU5"
FT                   /protein_id="ACD70553.1"
FT                   /translation="MRTHDIPRSPLVGHKKNAAPDGIGASRACCPARENEPFKKGSTNS
FT                   RGGGVEWSRSSTRRVRGSALERGMKQLKWWAVGPVLGICAGVWGAAHPVHADPWDTTAA
FT                   GRSTIRLSAMGAVPLFQVDWCNSGRGDDRNANAQTNGHKYIYPAFSAALGFEHFVCRGL
FT                   SLGIDASVQYHCSYPNNTYSPTTPYYYLAIPVALTAGYTVAFWRIRLPLTVGAGFNYQH
FT                   YYTSTYYGLVLKAAAGCYFQLTEHWSLGVSATYSGVPRSCEKIIEEDRQQTNTRTAQFI
FT                   AAGVDVRYHL"
FT   gene            149847..150227
FT                   /locus_tag="TPASS_0127"
FT   CDS_pept        149847..150227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70554"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI90"
FT                   /protein_id="ACD70554.1"
FT                   /translation="MLGWGMDMSKSVMLCCLLSVQPCYAGYVFVSPKLGVYGEALGGPD
FT                   TVGKAVKQADGTKIAPKIWYYAPRTPLFGVDIGYQADNGLLFRVNLDAALTRLMFRSQC
FT                   VVGYSLRFGWGGVRLYRFGNRV"
FT   gene            150729..151076
FT                   /locus_tag="TPASS_0128"
FT   CDS_pept        150729..151076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHM0"
FT                   /protein_id="ACD70555.1"
FT                   /translation="MEFLRATASREVDVNSGWGYGSGVERGFLCEGDVRACLVPASHFV
FT                   RAGTAPGTTPGTAAACLFVPPYVLGVTPAGTLPFGLPSQSVLGGLRLAPVHASSLLEGL
FT                   GATIFFRCNAP"
FT   gene            151061..151537
FT                   /locus_tag="TPASS_0129"
FT   CDS_pept        151061..151537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF7"
FT                   /protein_id="ACD70556.1"
FT                   /translation="MQCPVRFAQSCSRMAMFLARNTPSNTLLAFDAGGRPTPGSGCRLG
FT                   LGRGLLGLCNGQACTPASYKMSSAAAGTAAPARARAWNEVFCVKGMCARVLFLCSTSYQ
FT                   EQGLQQQLFCSYRRTCCGLLLLGRRPCCLCPPSAHLPCLMAPPSDAMPPTRLRS"
FT   gene            complement(151866..152285)
FT                   /locus_tag="TPASS_0130"
FT   CDS_pept        complement(151866..152285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJS1"
FT                   /protein_id="ACD70557.1"
FT                   /translation="MGRPPASKASNVFKDVFLTNAMDMQTHDCARSMGHKKNGANGDIG
FT                   ADCVSVETRSASQAMPWALHLKLVAPEPSGKEAHIKGQTRPASYRLGGQRQSGQGPSRN
FT                   SQHVRRYEQKGHAPCCSCCSYEVEGRILLSMPARK"
FT   gene            complement(152357..154153)
FT                   /gene="tprD"
FT                   /locus_tag="TPASS_0131"
FT   CDS_pept        complement(152357..154153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprD"
FT                   /locus_tag="TPASS_0131"
FT                   /product="protein TprD"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70558"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJV1"
FT                   /protein_id="ACD70558.1"
FT                   /translation="MGRQVMQAGVLAGMVCAASGYAGVLTPQVSGTAQLQWGIAFQKNP
FT                   RTGPGKHTHGFRTTNSLTISLPLVSKHTHTRRGEARSGVWAQLQLKDLAVELASSKSST
FT                   ALSFTKPTASFQATLHCYGAYLTVGTSPSCVVNFAQLWKPFVTRAYSEKDTRYAPGFSG
FT                   SGAKLGYQAHNVGNSGVDVDIGFLSFLSNGAWDSTDTTHSKYGFGADATLSYGVDRQRL
FT                   LTLELAGNATLDQNYVKGTEDSKNENKTALLWGVGGRLTLEPGAGFRFSFALDAGNQHQ
FT                   SNAHAQTQERAILKAREVFRRVEGKLVQNLPNIMMPPGITEQTTLIEMVGLAALIAEGT
FT                   LGSAIQTVLAAGALAALVSQLVPNIEQGVRDVFRSSDPRVVTAKLLAFLERAPMNALNI
FT                   DALLRMQWKWLSSGIYFATAGTNIFGKRVFATTRAHYFDFAGFLKLETKSGDPYTHLLT
FT                   GLNAGVEARVYIPLTYVFYRNNGGYELNRVVPPGTINMPILGKAWCSYRIPLGSHAWLA
FT                   PHTSVLGTTNRFNIINPAGNLLNERALQYQVGLTFSPFEKVELSAQWEQGVLADAPYMG
FT                   IAESIWSERHFGTLVCGMKVTW"
FT   gene            complement(154331..154408)
FT                   /locus_tag="TPASS_0132"
FT   CDS_pept        complement(154331..154408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI93"
FT                   /protein_id="ACD70559.1"
FT                   /translation="MEPRMSGSNPTLPLLPRVRRGRRRA"
FT   gene            complement(154393..155625)
FT                   /locus_tag="TPASS_0133"
FT   CDS_pept        complement(154393..155625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70560"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHM6"
FT                   /protein_id="ACD70560.1"
FT                   /translation="MMARSRCVHRVVHQAACIGVIGLSTSALTTCDFTGIFVAIQSEVP
FT                   IKTPSIPGAIYGLVKAGSKLYATNGQLWKKNVAEEGKDWERESCFDSVIGDSRITSLAA
FT                   DNGENGVLVACILGKGAYKWSQGSADQTSGNPSALSGTEKALSVVGTGTSCVYLNHTDD
FT                   KVGETSSSESGGMTASGETNEFCLHAGNGFLVTTKKVCVGSDGSPVAKSDGEEPVPPIL
FT                   AATDDGSGHVYILTKDKVYCKKVNQSEGKIQDCPQSAAAAPEPTGAHSVAHKVADAHSI
FT                   AFFKNGSDEFLLIGGRQGYGEIKLERGSGSNGNGAQCVHLKEENVHDQTGWHEKGSTPK
FT                   GSAEQYRSTIGRWAVSGIYVIKKSTSGGRGKRSTSTDCERPDLYVAVGDTNDTYTGLWR
FT                   FDSAAQKWNRE"
FT   gene            complement(155622..156752)
FT                   /locus_tag="TPASS_0134"
FT   CDS_pept        complement(155622..156752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG3"
FT                   /protein_id="ACD70561.1"
FT                   /translation="MCKPRVWRIAHTIVHVGALLLGTSQLTTCDFSGIFATIQQEVAIK
FT                   SPSIPGAIYGLVKAGDKLYATNGRLWEKELNGIKWKPVPFLDGQDKRIDSLAASNTCVF
FT                   ACVSGDGVYKYTAGTTSSQKESNTDKAQAVVQMSDGKVVLQCALGDEKTTPSDADERLL
FT                   GGGQGYLVTSKGFYTLPGSASCEVISETKDVTCKAEAPILASACDGSNTYILTKDKVYC
FT                   RYTNGSGSTPTTWCDVEHKVSEPLALAVFKNKGETFLLVGGQQGYGEIKIATASGSSSS
FT                   SSCVPLTAENVHATTGWGTNCSTPEGSAEQYRSTIGRWAVSGIYVIKKDTSGGRKKRST
FT                   STDCERPDLYVAVGDASDTYTGLWKFDTATNTWNRE"
FT   gene            complement(156704..157645)
FT                   /locus_tag="TPASS_0135"
FT   CDS_pept        complement(156704..157645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJS6"
FT                   /protein_id="ACD70562.1"
FT                   /translation="MRASEVIADIYPGGDKLRSARVSLLSLFFNHFFARPGYAAICSTG
FT                   TQGPALCQLKVTAGPCFEQKTVVRRRVVVLVAEAGPHRQRQTDAPEGERVTCIQRYRNG
FT                   KVGTQPLLLVIERITAGVLRARINPERQAAIHKILVSKRHPKRGVNFLIPVGCNAPRSP
FT                   RAVLHQSTWKRGTAPINETRAIPRPAAVTSHDAAGATSCAYAAPAATPTPQRRPAESVS
FT                   RVPRTVLAVSYVFSLHTFQKAAGNPHSLPKFYPPPANICRVLFLQEGRAPRTTAAYPVR
FT                   ACNILTGEVFSHTGEVLCANRACGASPTPSSM"
FT   gene            157789..157861
FT                   /locus_tag="TPASS_t0009"
FT   tRNA            157789..157861
FT                   /locus_tag="TPASS_t0009"
FT                   /product="tRNA-Val"
FT                   /note="tRNA-Val2; codon recognized: GUA"
FT   gene            157985..159463
FT                   /locus_tag="TPASS_0136"
FT   CDS_pept        157985..159463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70563"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJV5"
FT                   /protein_id="ACD70563.1"
FT                   /translation="MGRSTMDTQYMRRRVCTVVRAVVCLLSTSLLTTCDFTGIFAAIQS
FT                   EVPIKTPSIPGAIYGLVKAGSKLYATNGRLWEKELNGTESWQKVSSSSVPTDSDKKVMS
FT                   IATDGTNFVLACVPGTGVYKHCVNGAVGSSSTAASGSTETCSNHATLVGGTSTPFWIVP
FT                   GGTGSNGNCGCGAGGGGSSSSSSSCIHIWLVPAGTGSNGNCGCGAGGGGSSSSSSSCIH
FT                   IKKEDTGEQFLDRGEGYVVTTKHLYTKNGSSSAGPAPCPGGGGGSSGGGGSSQYTKDSC
FT                   FFSTPILASVSDGCYHYILTKEKVYCRKQNAASSAASSPASCPSSPSSSSSSSTNAGCE
FT                   VEHGVDDPLCLAIFKHNGCEYLLIGGSRGYGEIKLEASSSGTNGTCMRLKESNVHKSPD
FT                   QWDESSPTPKASAEQYRGTVGRFAVQKIYVVEKNGGGNGVAAGGAGCPASASSTNGTAG
FT                   STQRPDLYAAVGESSDSYTGLWKFDTTTCSWNRE"
FT   gene            159442..159579
FT                   /locus_tag="TPASS_0137"
FT   CDS_pept        159442..159579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI97"
FT                   /protein_id="ACD70564.1"
FT                   /translation="MLLEPRVTGCFLSSSEQALPPAIYFPLLLLVRSGARNIVGITSVG
FT                   "
FT   gene            complement(159716..160453)
FT                   /locus_tag="TPASS_0138"
FT   CDS_pept        complement(159716..160453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70565"
FT                   /db_xref="GOA:A0A0H3BHN2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHN2"
FT                   /protein_id="ACD70565.1"
FT                   /translation="MQPPRPACQDEGTHGKEVCMLLIQKKRLLVVLIVSFLSILFSAGY
FT                   AFRIGMLHAHKGSAETILFYGFVAAAFHFILSLYLMLHAHHKKKELLKLADMLRYGGSI
FT                   GESHFKKFGVLGTQIQFLLKELLALSAQKSLKIAALSGLQRALTELIPTPVIIIDLNGT
FT                   ILDMTKGARKRVQRADKTLTIEHIFPATDSTRAVQEAEKTHTPVEQEGGIVFIPVFSAV
FT                   GNISHFLVDISKQPASDEPLSLA"
FT   gene            complement(160461..161153)
FT                   /locus_tag="TPASS_0139"
FT   CDS_pept        complement(160461..161153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70566"
FT                   /db_xref="GOA:A0A0H3BIG8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG8"
FT                   /protein_id="ACD70566.1"
FT                   /translation="MAVKRNFAVVGLGAFGYRVCEVLVQGGGSVVAIDNNAQTVEKVKK
FT                   VVSVAILIDTTSETELMKAPLDDVDVAIVAIGTNLQASILTTALLKQRDIPYILARATS
FT                   PIHETILRKIGANEILNIEVASATTIAKRLVAPDVTDAIAMTDDISLREIVAPRFFTDK
FT                   TLEELELREKFNVKIVAVVRTDMDIDPTGNSLPKKNIYYPDNAFTFRRADRMFVLGHNR
FT                   DLRELTQI"
FT   gene            complement(161193..162920)
FT                   /gene="ntpJ"
FT                   /locus_tag="TPASS_0140"
FT   CDS_pept        complement(161193..162920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntpJ"
FT                   /locus_tag="TPASS_0140"
FT                   /product="K+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70567"
FT                   /db_xref="GOA:A0A0H3BJT1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJT1"
FT                   /protein_id="ACD70567.1"
FT                   /translation="MRPMHIGNLTHLTMLVLCLAIRLCDQFLPFSVQFFTIVGDVGILV
FT                   LVWSSLASSLNKEKYVRTFLRQYTVPVFLGLLITLLTFVRASVTLTTASGDLYTTLTHI
FT                   QNITLGIFALIAFKAQKKFAERAVSNPSQTLIVSFLVVIFIGTHLLMFPGATPHSQPLP
FT                   MLTALFTATSAVCVTGLSVIDVATQLSTWGKAILAALIQIGGLGFMVFSFFGMITIKKK
FT                   MSLESRLVASHLVSDSDMGSLSHNLKLIIFSTFFIEALSALFLFVGFSQTEGYTIQSLG
FT                   NAYFHAISAFCNAGFSLYPNSLESFVSNPWITFPIAFTIILGGISFVVIDEVLCRVHGS
FT                   IKNIFFKGKNILGSLSLNTFVVLKATVLLLAVSFVGIYLLEHTHSMKVYQVGTQYLAAF
FT                   FQAVTLRTAGFSTIPFSNLRTATLFFMTFIMFVGGASGSTAGGIKLNTAAAIIASFRSF
FT                   IHHDPKPRIRNLVIQGKQVERSFLILGFGICTVCLAGFCLSLTDNIPFIYLLFESVSAF
FT                   ATVGLSVGITANLSTAGLMILLILMFTGRVGTLTILTAASKEEQDMSVEYACGDLAIG"
FT   gene            163092..163625
FT                   /gene="dat"
FT                   /locus_tag="TPASS_0141"
FT   CDS_pept        163092..163625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dat"
FT                   /locus_tag="TPASS_0141"
FT                   /product="methylated-DNA-protein-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70568"
FT                   /db_xref="GOA:A0A0H3BJV9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJV9"
FT                   /protein_id="ACD70568.1"
FT                   /translation="MSVHQGGIRFPLLYLEMETPLGRMCIAERAHTIVYVWFHRVGPRG
FT                   SPVSGVCAQHVCPGKTALLRETQSQIHAYFCGALREFSVPVTVEGTPFMQRVWGATRNI
FT                   AYGTTKSYAQLSQDIGCPRAARAVGQALHRNPLLLLIPCHRVISARASIGGFAYGSALK
FT                   HFLLQQEAAVCACE"
FT   gene            complement(163576..164238)
FT                   /locus_tag="TPASS_0142"
FT   CDS_pept        complement(163576..164238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0142"
FT                   /product="possible thiamine ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70569"
FT                   /db_xref="GOA:A0A0H3BI99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI99"
FT                   /protein_id="ACD70569.1"
FT                   /translation="MDNRPYVVVQELTKVWEEKRISLSFSLRQGTSLALLGASGCGKST
FT                   ILKMIAGLITPDHGSVFIAGTNVTHWAPARRRIGMICQDFALFPHLSLEDNIGYGLVSQ
FT                   GLTKKTARVHAREWMARFGLQNMETRSVTTLSHGEKQRVALARSLAVRPALILFDEALS
FT                   AIDADLRTTLQGELRALQRSLGYTAVYVTHDSTEAAALADTVIHMRTQPPLAAAKNA"
FT   gene            complement(164231..166012)
FT                   /locus_tag="TPASS_0143"
FT   CDS_pept        complement(164231..166012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0143"
FT                   /product="possible thiamine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70570"
FT                   /db_xref="GOA:A0A0H3BHN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHN7"
FT                   /protein_id="ACD70570.1"
FT                   /translation="MPRCSSGITRINPMTTLLHPCRRSCASGALYLTRGRDARNYCVAL
FT                   ICALCFSLSIGTFLIPVFTAGSAFFSKPRLENTAAHPSPGTLQTGSPITPFFLPPGTPG
FT                   AARFGALFAQSVFQALCSAVLACAVGFGAAFFFVKRSLRARALFPALCAIPLAIPPLTM
FT                   ALAFLLSFGKNGLCTRTLGTLWGVSTPRTFLYSASGVVIAHAWYNFPLALAIIARAWNT
FT                   ISADAEDAARLLGARAYRVFYTITLPALAGALRSSFLVIFLYCFFSLMMVLLLGGTTFT
FT                   TLEVELYRSIRTQAAHPYASTLALSQTFYALLMIWGVSTEESQQAQSCVARTRPLPTQS
FT                   IQGNIERIGFFALLCGILFFLILPLFSLVLHSITRHRAGRTVSFTLTAWHTLFSAPSFW
FT                   HALRSTIWIGFWSFCVTVGSVLCYGYMVLMRHVSRWKTRLPFLPLAVSPMVLAFGWSLM
FT                   PRCASRILLVCAQSALAFPFAWLSLYSTLMRIPTPVIFTGQMLSRNRLDFFLRTICPLC
FT                   KKGIVSAGVYAFALSAADAAFPLVLEIPDFQSVALLLYRLSSTYRFAESSALALVLSLA
FT                   SSVLLIGVHRCKEYSYG"
FT   gene            complement(165970..166977)
FT                   /locus_tag="TPASS_0144"
FT   CDS_pept        complement(165970..166977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0144"
FT                   /product="possible thiamine ABC transporter,
FT                   thiamine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70571"
FT                   /db_xref="GOA:A0A0H3BIH4"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH4"
FT                   /protein_id="ACD70571.1"
FT                   /translation="MAHRMRVVFCCAAALSLCCCSRSRTDAPSLVIYVYDSFASEWGPG
FT                   PELARRFYAKTGYSVQYVVFEDVTRAIHRAIRDQHTPSSRGADLIIGVDQYTLPLAREA
FT                   DLFSPYQPALPLPHALRIDPHNLAVPYDWGYVAFMFNTDAALPEPQRLSDLANPVYAKS
FT                   IALADPHTNVLGTIFIGWAHTSLGAAWPAFWNTLYRANLLALAPSWSAAYGLFTAGEAA
FT                   LVLSYTTSAAYHLHHDNHTRFKPLLFPEGHPMHIEGISLVKRTKHARVATQFIDFLLST
FT                   EAQELLPLTQWMYPANPDVPLPAAFSAVPQPAACVSLSPQMCRAAAAALHASTP"
FT   gene            167087..169057
FT                   /locus_tag="TPASS_0145"
FT   CDS_pept        167087..169057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0145"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70572"
FT                   /db_xref="GOA:A0A0H3BJT7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJT7"
FT                   /protein_id="ACD70572.1"
FT                   /translation="MSVCCTSSEERIERSKNLVHLVAQVAGAYAQLPAQYAKSSSGVFE
FT                   ITSFSSFYEHVCLFAAGLASIGCGRGDCIGLISDNRVEWLHASFGIQALGAADVPRGSD
FT                   ATERDLVQILGAVEARTVIVENDAQLKKLARCFDALPSVSQIVLLDAGGAYQAMKDEFV
FT                   QNEDGSARKCSFFTYQDILAHGTQFRVHHPGRIEDEIGRTTRADVATIIFTSGTTGTPK
FT                   GVVLSHENFLCQLIDISRRLTVCPGDIALSVLPVWHVFERISEYVVLSHAGGVAYSKPV
FT                   GSVMLADLAKLNPHFLPSVPRIWEAIHDGIFKNVRKKGGVAAALFHFFLAAGKAYAYFY
FT                   RSVFGLRTHTTRRAQFCAPLFACVPWLLLVPLHFLGNVLVFRKVRKKFGTSFKTAISGG
FT                   GALPPNVDEFLYAIGVRVLEGYGLTETAPVIAMRSERRPVFGSVGTPCAYNEVKIVDDT
FT                   GAQLPVGYKGIVLVRGKNIMQGYYKNPELTAQVLDADGWFNTGDIGYRCVGGQIVLRGR
FT                   KKDTVVLRGGENVEPVPLEMSMQESRFIARAVVVGQDERYLAALIVPDEAELRLWAEAQ
FT                   ELRTECMEELLVNPAVVKFFEQEIAKRISLENGFKIFERINRFVLLPKVFEVGVELSAK
FT                   QEVMRHRVADLYAKEIAQLFS"
FT   gene            169086..170452
FT                   /pseudo
FT                   /locus_tag="TPASS_0146"
FT                   /note="chromate resistance protein A; frameshift"
FT   gene            complement(169132..169213)
FT                   /locus_tag="TPASS_t0010"
FT   tRNA            complement(169132..169213)
FT                   /locus_tag="TPASS_t0010"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA-Leu2; codon recognized: CUC"
FT   gene            complement(170462..172321)
FT                   /locus_tag="TPASS_0147"
FT   CDS_pept        complement(170462..172321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0147"
FT                   /product="possible alpha-amylase 1"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70573"
FT                   /db_xref="GOA:A0A0H3BJW4"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJW4"
FT                   /protein_id="ACD70573.1"
FT                   /translation="MKKGDNTKIRIAFAAKLTEACVQSLHAEHDPSQYQAFFSGLCRHE
FT                   QLPLTVHMTGSFFQFIQKKNSPYPYLINNLLGSKRLELLSGGFYQPYLPLLPQADVISQ
FT                   IELLTSTLREHVIKRPRGCFLEASAWSAALIPSLVKAGMEYCLLDYRLFEASDMPATKP
FT                   AVLEDSSKCLVALPYRELTIDTPAETFYAQLVARYGDTPGTVLIFMLPLDCYQKLFFTH
FT                   DNASTWFKTFIQYVQKPNSPFRLTHTGEIYKEPPVCLGYIASNMVRNDVLLHKTAKQLI
FT                   ICSTHARLLYAKMMYVHNIAMQIKGDKQRKHHALSELWKAEQGVFFISSDRGYASAGSA
FT                   QRTAYKYLLTAEKVARTPGVFNNSLITFDFNFDGVREFLSQRELMNMYVQLPGGLIFEF
FT                   DIFSSYKNYAAVPRQPGGIFIDYVLSEQDVVHLRENPGHAVPTVFSHTPYQEIGFDPIK
FT                   HELTLRAEGIFEEFNQPVSLKKQYFFKSEGVQVQYILKNESPLNLSAFFAVEMNLAVHG
FT                   TDDAAPELVVFSENEKYTAAITRDHFPCISWMRLTDPEGKTVFTIEGNENPDVAITPLC
FT                   ESTSNQYANTEGIKCLFYWKVDLNAGYETEKMLFLKAFSTKKR"
FT   gene            complement(172318..172896)
FT                   /locus_tag="TPASS_0148"
FT   CDS_pept        complement(172318..172896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70574"
FT                   /db_xref="GOA:A0A0H3BIA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIA2"
FT                   /protein_id="ACD70574.1"
FT                   /translation="MVTMVPPLFFVCALFFAEGIGLDRLCIAALSPRCTLFHTCRFLFL
FT                   GGILITGNWVCIHYVYDPLALRFLTPLGVGASAFCLSTCSGKLSRTCTSHRAQSEWGLL
FT                   YALVFYITYTALNLFEALVMWGVSCVGFLCFSTILRAIHQRITQGNGTAVEKTAALLLA
FT                   SMGFIALSLYGTDELWLFPIPAAGMRTRL"
FT   gene            complement(172890..173483)
FT                   /locus_tag="TPASS_0149"
FT   CDS_pept        complement(172890..173483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70575"
FT                   /db_xref="GOA:A0A0H3BHP2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHP2"
FT                   /protein_id="ACD70575.1"
FT                   /translation="MSKYTVKRASVLCIFGIGLFVPATGTFACGLLLVLGFWVLFFSSL
FT                   LARFLSQFFMRTRSAPLFEVCLTLSATIMYDNLIQGFFPLVRMMLCPYLFITALSRTLD
FT                   LCLTAYDADAESLECVGVFGIMIAGISLVRELVAFGCVSLPAPSGFLRIISFPPSNVIR
FT                   FAATGAGTLISCGIVLWIFRSAGNDHTPSLRSEW"
FT   gene            complement(173476..173943)
FT                   /locus_tag="TPASS_0150"
FT   CDS_pept        complement(173476..173943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70576"
FT                   /db_xref="GOA:A0A0H3BIH8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH8"
FT                   /protein_id="ACD70576.1"
FT                   /translation="MTYNTNTSLSSYAGLSAFALSVFCILWGTARTGSFLKEKALITCA
FT                   ADILARQAPELGVTSRTLRMVPSSPIPQAEVLRGKKNTGEEIFLYFFPLRGMYGSFPTL
FT                   FLYDKKDGARFCHLIGNHPTPRDARFYGISSARIALQCRKIEHLHQTVAYE"
FT   gene            complement(173927..174946)
FT                   /locus_tag="TPASS_0151"
FT   CDS_pept        complement(173927..174946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0151"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70577"
FT                   /db_xref="GOA:A0A0H3BJU2"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJU2"
FT                   /protein_id="ACD70577.1"
FT                   /translation="MRTAEYKHAPFLYTGLSAGQNNSVLLALLVAHVFVVAAMRDTVAL
FT                   FSIVSTELGALSAALVQTLRTPHVPLSDSLVLGLLIGAVLPAHNSFLNTFCVAFCAVFF
FT                   TRVLFGGKIGNWLNPIALAPVLLRLCTEGTSLPTSGRVSVVQGAMSYPLFYSALVEWDA
FT                   AVRTWCNTQVFQPLGLTLPEGALSACVFTQAAAPGFRYPVLTLLAALCVYAVRARRYIC
FT                   SCAFLVVYSTLFFLPAHAHPATLVSLIKSGALFTAFFVLPEPDTSMRTNGGAWISGGLC
FT                   AMCAFFLAKKNSSAPDMWGAHDMHLWSAILLTNIVQPLILRAESWYYYVRRRRYDVQH"
FT   gene            complement(174933..176477)
FT                   /gene="rnfC"
FT                   /locus_tag="TPASS_0152"
FT   CDS_pept        complement(174933..176477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnfC"
FT                   /locus_tag="TPASS_0152"
FT                   /product="nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70578"
FT                   /db_xref="GOA:A0A0H3BJW8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJW8"
FT                   /protein_id="ACD70578.1"
FT                   /translation="MCPCRVGRRRPFLYRTEGTPMIERLRSSRGKLTLTHQIFPLSFGG
FT                   NAFLPARALVPFSVDAGEPAAVAVVKVGDTVREGQLIARAAHAGAAHAHASVPGVVTRL
FT                   VSANFLAGSALRAVEIRTRGSFEHLGKVQPNRPWQHSTASELLRLVTDAGVVATRLHPH
FT                   AQITSTATGTHAGAQHTYAKDYGQKRRAEAHTLRLMRAAWESGNALATHLHLHVRKGVR
FT                   KLTLYLCDDDATCPLSSFLAQEFPEPVATGTAIIARILDATYTACLHTLPKRSPGLARM
FT                   RAVFPFNEMHDAYRRHYPFSNLCAPRYRAGCTIDALTAVHVYEAVVLSQPQISSYIALT
FT                   GAGLKSPQVLRARIGTPLGALIEECGGFRTRPGHLIINGLLKGSVLESLDLPFSKGIKS
FT                   LHVTGKALSSSASCTSCQNCGDCARICPVYLDPIKIARAAHRNQFTEEVLQSLRICHQC
FT                   GLCSAACTARIPLAKLLHDAQERALHLSRAPVTKIEPHSTQSVGKTIREAPANAHR"
FT   gene            complement(176553..177044)
FT                   /locus_tag="TPASS_0153"
FT   CDS_pept        complement(176553..177044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70579"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIA6"
FT                   /protein_id="ACD70579.1"
FT                   /translation="MDGGYFLGQLHAVFSGEVFLSATCSWLASQVIKVAIACRRSAIRS
FT                   VHGFFDFAVWRTGGMPSSHSALVSALTLSFALKCGLHSDLFIFSFFSAIIVVRDALGVR
FT                   RSSGLQAEALNSLGARVSEKLDFSFRPVREIHGHKPLEVVVGVAVGIVTSALFYSSMSP
FT                   "
FT   gene            177269..178306
FT                   /locus_tag="TPASS_0154"
FT   CDS_pept        177269..178306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70580"
FT                   /db_xref="GOA:A0A0H3BHP9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHP9"
FT                   /protein_id="ACD70580.1"
FT                   /translation="MDVVPPVSTVRPHGGAAVECFRCTKNDAGRRVDRVLRILLPACPR
FT                   VGVYARVRRTAIRLNGRPVQPAKRVQVGDVLSLPESLCRARAASSRLSKMPGTPKLRVL
FT                   PSVVFKTQDLLFFHKPAGLCVHGPRSLDAWVRGQGRAHVPPALSFRPGPLHRLDRGTEG
FT                   LIAFSRSLRGAQWFSAALQQHTLRKFYLAITAAPARTAAAARTLVRPGEVTHVQTVLHS
FT                   CDSALVLRVIVPVTGKKHQIRRYCAAQGFPLVGDRTYGGASQHGNARYTRFFLLAWCVR
FT                   FPSSRLQALPAQVWTTPSPAFMRVLTSFPPDSLARARACVDALDGALGTDATCPQDTAV
FT                   CTPEG"
FT   gene            178312..179427
FT                   /locus_tag="TPASS_0155"
FT   CDS_pept        178312..179427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0155"
FT                   /product="fibronectin binding protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70581"
FT                   /db_xref="GOA:A0A0H3BII2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BII2"
FT                   /protein_id="ACD70581.1"
FT                   /translation="MSVYCRSSKQTVREPCRPVPVGALLLFVTLLLLALALAYFGAQVE
FT                   PLTPALTLTEQEPRQASGYVSSLLRARIVQEDAEPALYYTVYEVREGDVVGRIAQRYDI
FT                   SQDAIISLNKLRSTRALQVGQLLKIPSVDGILYTVKNGDTFSSIAAAHQISLERLVLLN
FT                   TPSSSKESPPSVRTLVSPFYNSAARESCVPFPFSSAKQWRENTSFDAVQPLQPARVLFL
FT                   PGAHLSARALQEINGDLFRAPLRSRYYVSSRYGWRSDPFTGARSFHNGLDMVSRRGTPV
FT                   YSALGGIVRTVGYSAVYGNYLIVGHHAGYQTLYGHLQTVLVSAGTRVTSATKIGLLGKT
FT                   GRSTGPHLHFTIYKNGSAINPTSLLRMRTLP"
FT   gene            complement(179468..179872)
FT                   /locus_tag="TPASS_0156"
FT   CDS_pept        complement(179468..179872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70582"
FT                   /db_xref="GOA:A0A0H3BJU7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJU7"
FT                   /protein_id="ACD70582.1"
FT                   /translation="MNFSLEFPVRSYELDGYGHVNNAVYLQYFEYARAAFLLHIGFDLK
FT                   QLHEAGYAFYVTQAHIHYRTAVHLFDTLRARVKPLKLGKASGVFSQTLENQHHVLCADA
FT                   EITWVCVSRTSGKPTKIPPEYLVPALYPNY"
FT   gene            complement(179869..180771)
FT                   /locus_tag="TPASS_0157"
FT   CDS_pept        complement(179869..180771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70583"
FT                   /db_xref="GOA:A0A0H3BJZ4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJZ4"
FT                   /protein_id="ACD70583.1"
FT                   /translation="MSIHSLQQTFSDIVPLLEQYTRADRFMREDNLLHERNEPIRRIVE
FT                   SLVARILLPGSTMRGNEQIASFLHKTNEGKRGLILAEHYSNFDLPCLLYLMEQGSSAGR
FT                   MLSEKIVSIAGIKLREENRILAMLTEGYDHLVIYPSRSLATITDAHCLARETKRSRALN
FT                   RAAMKYLEELRNAGKVILVFPAGTRYRPGRPETKRGVREVYSYIKHAEVLLLISINGNC
FT                   LRVAERSTDMTEDAVHPDVVLLEARTVDDCALFREKALDWHRTHNVAAPSEDKKQIVVD
FT                   YVMHLLEEMHEHNERERLS"
FT   gene            complement(180768..181454)
FT                   /locus_tag="TPASS_0158"
FT   CDS_pept        complement(180768..181454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70584"
FT                   /db_xref="GOA:A0A0H3BIC5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIC5"
FT                   /protein_id="ACD70584.1"
FT                   /translation="MLNWSIPVIRHILFDIDNTLYSCTNPIEMAITQRIHTFVAHFLHV
FT                   SCEEARALRQRTKHLYATTFEWLKAEHNLIHDEHYFRAVYPPTEIQELQYDPMLRPFLQ
FT                   SLHMPLTALTNAPRVHAQRVLDFFHLSDLFLDVFDITYHAGKGKPHHSCFVRTLEAVHK
FT                   TVQETLFVDDCLMHVRAFIALGGHAVLVDERDCHAELPPSARMTRVKTIYELPAHLARL
FT                   AQGDNQ"
FT   gene            complement(181458..182486)
FT                   /locus_tag="TPASS_0159"
FT   CDS_pept        complement(181458..182486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHT3"
FT                   /protein_id="ACD70585.1"
FT                   /translation="MYIKVALVCLFSMGARCLLATEPAPVSGDYVLYRDYSWKSPTWVG
FT                   FLCYDAHTYGALLCTPAESRRITILFTGTEKHGRFELTGQRITSPVRTEDLTGINYLMD
FT                   LFPQLQRWKHFPRDTHTLVARHTDRSKKSTQFSGAVELQFASFVPLFHLEILRDKQQRV
FT                   MLQLSEIGKIDHTSDAAFFQFTPMPPSTPTDAPPATLNQTLTRTEYVIDDVCIALDPQW
FT                   KRIAENSFLSDFAFLTVHQVPAPRAHDYSALRALLQLFLYSGPQGKNILEQLHINDTHA
FT                   RLTLSYAVFDLPSKTVKKTWKIFIRHSDTHYSILSLTADQRTAQRYARYFDTLIETIRT
FT                   KN"
FT   gene            complement(182602..184455)
FT                   /gene="proS"
FT                   /locus_tag="TPASS_0160"
FT   CDS_pept        complement(182602..184455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="TPASS_0160"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70586"
FT                   /db_xref="GOA:B2S2A7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2A7"
FT                   /protein_id="ACD70586.1"
FT                   /translation="MSAFFAPTLRSAPADATIASHQLLMRAGYVRKIANGLFAYLPLGL
FT                   RVRHKIEAIIREELEAIGCLECTAPVVTPAELWKESGRWYRMGAELLRAKNRLDHELLF
FT                   SPTAEESFTALVRGDCTSYKHFPLSLYQINAKYRDEIRPRYGLMRAREFTMADAYSFHT
FT                   DCACLARTYEKFAHAYRAIFRRIGLSVIAVHAHLGAMGGQESEEFMVESAVGDNTLLLC
FT                   PHCTYAANCEKAVGQRPLPDTHDTHLKDEHEGSDLKTPAAMREVHTPHVKTIEELEHFL
FT                   HVPAHRCIKTLIYRIDTVPQAAGHFVAVCIRGDLELNESKLEALLRVPSVVLATEQEVY
FT                   ALSGTPVGFIGPVGLAQRAAAAYAARTPAFFPSAAEPASVTSDIPFFSLVADQSVMAMH
FT                   NAITGALKVDTHLVQVEPGRDFVPDAVADLMLVRAGDRCIHCGAPLYEKKGNELGHLFK
FT                   LGDKYTRSMHLTFTDEQGVRQFPLMGCYGIGLDRTLASVVENHHDTRGISWPLAISPYA
FT                   VVLIPIPHTQAPYAAAEALYVQLRTRGVEVLFDDRAERPGVKFADADLIGIPLRVVLSA
FT                   KTLPRVECTTRCGAHTYFFTQEEASEHIARLLEQLASPESS"
FT   gene            complement(184458..184550)
FT                   /locus_tag="TPASS_0161"
FT   CDS_pept        complement(184458..184550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIL3"
FT                   /protein_id="ACD70587.1"
FT                   /translation="MSELSAAPLRPGKTQESEKGIYYAREGCVS"
FT   gene            complement(184567..185619)
FT                   /gene="ruvB"
FT                   /locus_tag="TPASS_0162"
FT   CDS_pept        complement(184567..185619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="TPASS_0162"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70588"
FT                   /db_xref="GOA:A0A0H3BJX6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJX6"
FT                   /protein_id="ACD70588.1"
FT                   /translation="MDHTASLSPVRPEAQPTDDRERALRPRLLKDFLGQEKTKRNLRLF
FT                   IQAARDRNESLDHLFLIGPPGLGKTTLAHITACELGVECKVTGAPALDKPKDLAGILTA
FT                   LSERSVFFVDEIHRLKPAIEEMLYIAMEDYELDWVIGQGPSARTVRIPLPPFTLIGATT
FT                   RAGMVSSPLISRFGIVERFEFYTPEELAAIVQRSARLLDITLDARAALALARCSRGTPR
FT                   VANRLLRRIRDFAQVAGSAHISETIVRAGLAHLKIDELGLELHDIQLLRVMIEHFGGGP
FT                   VGAETLAISLGESPETLEDYYEPYLIQIGLMQRTPRGRMATARAYAHLGLPVPEARTLT
FT                   PHSPEQGTLL"
FT   gene            185794..186720
FT                   /gene="troA"
FT                   /locus_tag="TPASS_0163"
FT   CDS_pept        185794..186720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="troA"
FT                   /locus_tag="TPASS_0163"
FT                   /product="ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70589"
FT                   /db_xref="GOA:A0A0H3BJZ8"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJZ8"
FT                   /protein_id="ACD70589.1"
FT                   /translation="MIRERICACVLALGMLTGFTHAFGSKDAAADGKPLVVTTIGMIAD
FT                   AVKNIAQGDVHLKGLMGPGVDPHLYTATAGDVEWLGNADLILYNGLHLETKMGEVFSKL
FT                   RGSRLVVAVSETIPVSQRLSLEEAEFDPHVWFDVKLWSYSVKAVYESLCKLLPGKTREF
FT                   TQRYQAYQQQLDKLDAYVRRKAQSLPAERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTA
FT                   SEASAHDMQELAAFIAQRKLPAIFIESSIPHKNVEALRDAVQARGHVVQIGGELFSDAM
FT                   GDAGTSEGTYVGMVTHNIDTIVAALAR"
FT   gene            186868..187668
FT                   /gene="troB"
FT                   /locus_tag="TPASS_0164"
FT   CDS_pept        186868..187668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="troB"
FT                   /locus_tag="TPASS_0164"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70590"
FT                   /db_xref="GOA:A0A0H3BIC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIC8"
FT                   /protein_id="ACD70590.1"
FT                   /translation="MAEISATAYAVQVDDLTLAYRQKPVLWDVDVRIPEGVIEAIIGPN
FT                   GAGKSTLLKAIMGLLPLASGEVRVFGRPFSKERRRVAYVPQRSAVDWDFPTTVFDVVLM
FT                   GSYGSLGWILRPGKREKARAREAIEEVGMGAFLDRQISELSGGQQQRVFLARALVQDAD
FT                   LYFMDEPFQGVDAATEQAIVTLLKTLKGRGKTLLVVHHDLQTVAEYFDRVLLLNVRVIA
FT                   EGAVVSAFTEEYVQRAYGGRISSTLFPRGNKEDVHDARAHASVL"
FT   gene            187640..188536
FT                   /gene="troC"
FT                   /locus_tag="TPASS_0165"
FT   CDS_pept        187640..188536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="troC"
FT                   /locus_tag="TPASS_0165"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70591"
FT                   /db_xref="GOA:A0A0H3BHT8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHT8"
FT                   /protein_id="ACD70591.1"
FT                   /translation="MHALMRLFSDYTLQNVVLGTLFLGLGSGLVGSFAVLRRQSLFGDA
FT                   VSHATLPGIVIAFLLTGTKSTEILLLGAALSGLVGTVVMLMVMRTTKIDTDGAQGIVLG
FT                   VFLGFGFLLLTHVQKSPQAAKAGLNKFILGQAATILQRDVLLIIAMEVVIGLLVLLFWK
FT                   ELKLSTFDRDFSAVQGFSPQLMEFMLTALIVVAVVVGVQAVGVILMSALLTAPAVAARQ
FT                   WTNSLRVLCALAALFGGVSGVSGSVVSAQVPRLSTGPVIVLVLTGIALVSIMLGPQRGV
FT                   LYQLWRRRRVSLLQEEG"
FT   gene            188540..189643
FT                   /gene="troD"
FT                   /locus_tag="TPASS_0166"
FT   CDS_pept        188540..189643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="troD"
FT                   /locus_tag="TPASS_0166"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70592"
FT                   /db_xref="GOA:A0A0H3BIL9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIL9"
FT                   /protein_id="ACD70592.1"
FT                   /translation="MTMEVVLIAVVVSVACALCGVFLVLRRISLMSDAISHSVILGIVL
FT                   GYFLSRTLSSFVPFVGAVIAGICSVICAELLQKTGMVKSDAAVGLVFPAMFGLGVILVS
FT                   LYAGNVHLDTDAVLLGEIGLAPLDRVSFFAWSLPRSLVQMGSVLCGLLLLLALFFKELK
FT                   ISTFDPVLATSLGFSPTLINYGLMLAVSITCVGAFDSVGAVLVIALMITPPAAALLLTD
FT                   NLLLMLVLASLLASCASISGLFLAVKIDGSIAGAMATMAGVLFALVYLFSPKHGVVRRC
FT                   LVMRALKLDLDVVTLAVHLATHRYTVERSXECAEVHLTEHVSWSARRAARVVRTALRRG
FT                   MVERHGALLLLTAQGVSLAQARLDVSV"
FT   gene            189653..190114
FT                   /gene="troR"
FT                   /locus_tag="TPASS_0167"
FT   CDS_pept        189653..190114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="troR"
FT                   /locus_tag="TPASS_0167"
FT                   /product="cation-activated repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70593"
FT                   /db_xref="GOA:A0A0H3BJY1"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJY1"
FT                   /protein_id="ACD70593.1"
FT                   /translation="MSLVSDIAAENYLKTVVKALARSRRERVGTGELSRLLHVTPGTIS
FT                   TMVKRLEKGGYVQRTHRLGCTLTRKGAVFGSAVLRKHRLLESFLSQVLCLEAGVVHKEA
FT                   EMLEHACSDELIDVIDRYLQYPTRDPHGQPIPRKDTLLDLYVEDDVPGV"
FT   gene            190194..190949
FT                   /gene="pgm"
FT                   /locus_tag="TPASS_0168"
FT   CDS_pept        190194..190949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="TPASS_0168"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70594"
FT                   /db_xref="GOA:B2S2B5"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2B5"
FT                   /protein_id="ACD70594.1"
FT                   /translation="MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVLQEA
FT                   GFDFDLCYTSFLKRAIRTLNFVLQALDREWLPVHKSWKLNERHYGDLQGLNKTETAQKY
FT                   GEQQVRVWRRSFDVAPPPLTVGDARCPHTQASYRGVCASGRTPVLPFTESLKDTVARVV
FT                   PYFEEEIKPQMISGQRVLIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEAD
FT                   FTLCGKRFLGNEADVAARAQAVADQGKSN"
FT   gene            191075..191147
FT                   /locus_tag="TPASS_t0011"
FT   tRNA            191075..191147
FT                   /locus_tag="TPASS_t0011"
FT                   /product="tRNA-Met"
FT                   /note="tRNA-Met1; codon recognized: AUG"
FT   gene            191173..191271
FT                   /locus_tag="TPASS_0169"
FT   CDS_pept        191173..191271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK02"
FT                   /protein_id="ACD70595.1"
FT                   /translation="MWSGLFPDLQGTAFFRAWVASARFRVFHGEGA"
FT   gene            191268..192077
FT                   /gene="pfs"
FT                   /locus_tag="TPASS_0170"
FT   CDS_pept        191268..192077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="TPASS_0170"
FT                   /product="protein Pfs"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70596"
FT                   /db_xref="GOA:A0A0H3BID1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID1"
FT                   /protein_id="ACD70596.1"
FT                   /translation="MTVGVFAALGEEVARVRECLGGVGTERAGLTFYVVSVGALQVVYV
FT                   CGGVGKVNAALCTQLLISEFGARVLINTGIAGALDERLCVFDVLVSVDAVQHDVDVTAF
FT                   GYQKGRIPRMDSVEWTANTALRYLVREAFDLCTRDPEWTEGACALSGSGDPPSRVSRLV
FT                   EGRVASGDLFVSDAQTRARIIREFGAHGVEMEGAAFAHVASVNGVPFVIIRCISDGAGA
FT                   EQDVSMSYKEFSTRAARRSALLTLRVLERLSALRTSVVASLFPMVVV"
FT   gene            192177..192605
FT                   /gene="tpp15"
FT                   /locus_tag="TPASS_0171"
FT   CDS_pept        192177..192605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpp15"
FT                   /locus_tag="TPASS_0171"
FT                   /product="lipoprotein, 15 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70597"
FT                   /db_xref="GOA:A0A0H3BHU3"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR017058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHU3"
FT                   /protein_id="ACD70597.1"
FT                   /translation="MVKRGGAFALCLAVLLGACSFSSIPNGTYRATYQDFDENGWKDFL
FT                   EVTFDGGKMVQVVYDYQHKEGRFKSQDADYHRVMYASSGIGPEKAFRELADALLEKGNP
FT                   EMVDVVTGATVSSQSFRRLGAALLQSARRGEKEAIISR"
FT   gene            complement(192753..193280)
FT                   /locus_tag="TPASS_0172"
FT   CDS_pept        complement(192753..193280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIM4"
FT                   /protein_id="ACD70598.1"
FT                   /translation="MSDLEGLHLYNHSDEELFSIHDSVFQEHTGGEGRMSSSSGEEGCG
FT                   QTLLPVHEKKSTYGLFNPLTGVGWRAYLEERLEAELGRATASEQDLTLMIVQVEHPAHQ
FT                   TAVADAAKKLVEFFKFRDMLFEFEGSCCFAGIVQDASLEERWYSRGIYTRSCAAPLRAH
FT                   ASLSASRRVRPD"
FT   gene            complement(193315..193998)
FT                   /locus_tag="TPASS_0173"
FT   CDS_pept        complement(193315..193998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70599"
FT                   /db_xref="GOA:A0A0H3BJY4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJY4"
FT                   /protein_id="ACD70599.1"
FT                   /translation="MYFAILGTMSRTCVRAYAVFAIAIMVLTVAWFAFSISQAIQRNTV
FT                   GAQQRFAQVIRRIAPRVTSKRQLTDAEADFIQNLCKNDDLIMALNIFSNRVQLFSWTYD
FT                   DLMFVAGGGSELVPRSSSLFIKIFSGRVPYQAKDECLLFTAALRVLTPANIFFRGCVVF
FT                   LVMLTLTISSMVFLVIEYLSVRRFQCAQGDARPRPAGPQGTARSRTDEAQVSPGTPPEC
FT                   PVSVF"
FT   gene            complement(193967..194809)
FT                   /locus_tag="TPASS_0174"
FT   CDS_pept        complement(193967..194809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70600"
FT                   /db_xref="GOA:A0A0H3BK06"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK06"
FT                   /protein_id="ACD70600.1"
FT                   /translation="MQGQVLKKVLKKYVHIGMCTLFLHAILLFPCVAQAVLCQIFLSAL
FT                   IRNTSRMPHTMCSFPSQVTAIFDICACPCAVRSFYLNGNSLIFTGGGHPFSVYASRFSS
FT                   LPFLETSSGTVAGAAYSVASFLGFTRITSVGTDFSYTNGKPYARGTYLSKQFEQKILRI
FT                   SPLETQFCNLMFRTPTRQDNTQGGITYSNEILDQYKRNFDQITPGARPWHAADFRAFPY
FT                   KQFINFFHAQLRSKHAAALLAMLPFITWYKTKRTPQAPIFRILELVLEDVLRYTRYNE"
FT   gene            complement(194559..195191)
FT                   /locus_tag="TPASS_0175"
FT   CDS_pept        complement(194559..195191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70601"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID6"
FT                   /protein_id="ACD70601.1"
FT                   /translation="MNLITRVSVHSWSQVDLTHIIVQERVHFLHPLTHGSASQEIAQCY
FT                   MPIIHGNFFVHYLQPWKAFFPTSEQKIAELTSQAMKIIRADFSVQVHFGKLWMRNALLN
FT                   LRYAQIFTPKLPNINTQTEAIILGAGPSLEKGIEKIRSHRDVYTIFACDTAFPVCCTGG
FT                   LMPDFFISIDPQYISYATHYVFIPFTGNCNIRHMRVSMRSTQFLFEW"
FT   gene            complement(195222..195488)
FT                   /locus_tag="TPASS_0176"
FT   CDS_pept        complement(195222..195488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHU8"
FT                   /protein_id="ACD70602.1"
FT                   /translation="MTNVFKKNIRALRMRYQDIALTLERTHSNGIYAGTLTAHTGENIP
FT                   FFRNNRTLHSRYNPWIEAERTLPAQHASFFFVASGQVSTSVFS"
FT   gene            complement(195485..196795)
FT                   /locus_tag="TPASS_0177"
FT   CDS_pept        complement(195485..196795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70603"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIM9"
FT                   /protein_id="ACD70603.1"
FT                   /translation="MSRTPRSFCGHAFHMQSLSQFDTQTMRSLHPISSGTQSGDQTARS
FT                   LHSFLINHIPDELLGQTAFVPWEPANRIWRAQAQSTWQEITYTIKVIQSEIATRIYFGK
FT                   RWLLNTLRNVFFLERPVRVCLTAPEVLCVAAGFGLEQITRVGLPIVAVSSALQALLYRN
FT                   ISPDICMSTDGSFWAAEHFPPAPTLPVLFPLEACIPPRVFKYSPISLLNYHSHTEHFFL
FT                   QHLHIPSVSAQRHGSVMGTALEYLLQCGVHSIYLAGLDLHPGKGFQHARPHASFKRFNP
FT                   KRTEPLATCIAGNFDNRSLETYAHWFYSLPQEKIQKLTRLNTEHAPPSNVRTITYEDFS
FT                   QHAFAKKDTFTFSEGPPISRIHKKAVLRHYFERITRSAHHARIASSIASSGIEKEAFEF
FT                   LAYAELLHLRKNPSQGTQTLIHKVRHEIVQLRNKLSI"
FT   gene            complement(196889..197815)
FT                   /locus_tag="TPASS_0178"
FT   CDS_pept        complement(196889..197815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70604"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJY7"
FT                   /protein_id="ACD70604.1"
FT                   /translation="MGLIARASRIRRSSGVSCEYYRLELQFVQLVESLGIPRAGFLFLT
FT                   EERMFDLRFPFGIDTTTFYRMRVPTSLLSPGLPAEQWTTLFRQELTELQGYFSSHLFST
FT                   LRALHLYPFSAGSVRVYLVLFDTRTDVEEGALAADLHGDASGEERVRSFILAVQARFSF
FT                   IEASRPVYPRQPELAPSCSQLEFALNNQRMANLFTISINQSALPPAVLQEELSMVRRCC
FT                   ALSNQLLTLVGNDNLASCVASRELRVVVFSSFPVDPELYLNQLTRGVSAYFVNHAENSL
FT                   LITSSGTTRAQTDVLRFLQYETGETCR"
FT   gene            complement(197815..199698)
FT                   /locus_tag="TPASS_0179"
FT   CDS_pept        complement(197815..199698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK09"
FT                   /protein_id="ACD70605.1"
FT                   /translation="MTQALQVPSAPARCRHLRRKNGVLLRIVEKTDRTRYAHALRHGCR
FT                   HRMCEGVHGTEEDAMGSESAEMDSPHATARPQEQGEDRAWDACGVWVKVPPEAQEPPVS
FT                   SGGPEDPEAPAQHAPPGARVDAVRHHVYRALPVQSSAEDSRGFVDLSVEDEVLARGCSH
FT                   APGGESSSDQAADAPAGDAAYSEVPSFDDLVTRTAQSQDDRVDLSAAMSSVVTEEPPEP
FT                   RGCSMPCPSGSCDTTEFDDLLSSLSHDAPEYPVDSDPITYSASEPSSEGPVRGAPFSDV
FT                   DAVAQSLMGDAQVAAQGAQASTSGDASTDLLLKIAQEISSIRADLDQLKGTFSRQAGAE
FT                   PAQAPATAPAPEGTEAAYSGFFCDDDPDETIALTNDELNNILITSEFTEEDGKDSAADA
FT                   FGGELSGFESSHIESAAGDFSYLEKDDHAAARVAQEQWVQQGRATLGNEVFDVKEQGAH
FT                   ADRDAAAGPSPVAKDDASPEAQRAHVSSTGLDAAGTEQPLNTENVFDDDDTQREDTSFP
FT                   LPEEQELDVSVPSLEFSAPHAIETAASESSEVATPVAIESPPQSEAARPAQGDSANLAP
FT                   PLSKSLADEVRSVLGYMDRLLESLPEEKIEEFARSEYFHTYKHLFDELGIS"
FT   gene            complement(199640..199798)
FT                   /locus_tag="TPASS_0180"
FT   CDS_pept        complement(199640..199798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70606"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID8"
FT                   /protein_id="ACD70606.1"
FT                   /translation="MRIESSPLPLTACLHCLPHLHPCFCPYPPPPGGNDTGTAGAFRTR
FT                   ALPSFTA"
FT   gene            199791..200234
FT                   /locus_tag="TPASS_0181"
FT   CDS_pept        199791..200234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70607"
FT                   /db_xref="GOA:A0A0H3BHV2"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHV2"
FT                   /protein_id="ACD70607.1"
FT                   /translation="MRIYLRVVLPLSLALNSYGVLAFFWGERGVCAMRLLEREKKELVH
FT                   HIQTLAERGRDLAAVVDALSFDEETIGAYARQLGYVRAGDVLVRPVNFTVAHMHTLDSG
FT                   DARPLVAPACFSDTRCKVYALCVGFFVVLLQLLWGSARAYFKT"
FT   gene            200074..200853
FT                   /locus_tag="TPASS_0182"
FT   CDS_pept        200074..200853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70608"
FT                   /db_xref="GOA:A0A0H3BIN4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIN4"
FT                   /protein_id="ACD70608.1"
FT                   /translation="MRTCIPLILGMHVRLLHLHVLATRVARCTRCASASLSSCYSCCGV
FT                   ARVRILKHEAQSAHAAARALKAGALVALPTDTVYGFSGLVPHAVPDLICLKARGCTETE
FT                   GNRREGYPFIALLADPQDVVVYTGTRLPAEFRALWPGPYTFVLRMQDGATQAFRCPADL
FT                   WLRSVIRAVGGAIFSTSANRHGEPPLQDAQDIDHIFGKHLALTVDAGPLTGSPSAVIDL
FT                   THPVPRVLRAGAAPLPLAGLERRDSPSLPHVGEVCKE"
FT   gene            complement(200856..201701)
FT                   /locus_tag="TPASS_0183"
FT   CDS_pept        complement(200856..201701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJZ0"
FT                   /protein_id="ACD70609.1"
FT                   /translation="MKKGVRSSRLLILFVLFAHAVHAAPRVGVYRLEVSGVPAHTETTI
FT                   NDALFSFIRELRGYHVVDCREQAVPHRFPEKGNLDYIFCGAMDLTPEGIRLAVALKGKD
FT                   HNATRLLSKTYETAARILLDSRHLVRDVFDRSVPLTGNQTETSSMRHTRAGEESVSSLD
FT                   ALAGSWHSTEEGERIVIVSEGRGIAVLRSGLSVPLKLKISDGVLVVSQKGAVNARQFSH
FT                   FPPEIAQKLAQEARPLQWRFPKISGNNRLSGVRTAPVVRGAGHTASVEYEEVPEEWVRN
FT                   "
FT   gene            complement(201706..202170)
FT                   /gene="smpB"
FT                   /locus_tag="TPASS_0184"
FT   CDS_pept        complement(201706..202170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="TPASS_0184"
FT                   /product="small protein B"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70610"
FT                   /db_xref="GOA:B2S2D1"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2D1"
FT                   /protein_id="ACD70610.1"
FT                   /translation="MRGTGTHLIAKNRKAFFNYHVEDRLECGIALEGTEVKSVRAGHLS
FT                   FPDAFAEMRGGELWLKNVHIAEYVHACSFAPNPDRMRKLLAHRDQIARLKRKVEEKGYT
FT                   LVPLEFYLKAGRVKVALGICKGKKLFDKRAQIKARDNARELSRSLCERHH"
FT   gene            202258..202965
FT                   /gene="sip"
FT                   /locus_tag="TPASS_0185"
FT   CDS_pept        202258..202965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sip"
FT                   /locus_tag="TPASS_0185"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70611"
FT                   /db_xref="GOA:A0A0H3BK14"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK14"
FT                   /protein_id="ACD70611.1"
FT                   /translation="MFARWRRYSYLARREARRNATAVCSAGVGFFLFYLFITTHVVAAY
FT                   RIQADSMQPTLSAGDCVLASSLFRFARIKRGDLVLATPLEKEDIGLFKRAMNAVLGFAS
FT                   LQLYRPFGAADRMFSRPQMRRVVGLPGDTVYMRDFVLYVKPHGQQHFLTEFEVSAVSYD
FT                   VRKGVLPEHWSERLPFSGFMEEMQLDEHSYFVLCDNRIVSSDSRLWGAIDGSTQIKAKA
FT                   FMRYFPFGAFGVL"
FT   gene            203020..204201
FT                   /locus_tag="TPASS_0186"
FT   CDS_pept        203020..204201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0186"
FT                   /product="possible oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70612"
FT                   /db_xref="GOA:A0A0H3BIE1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE1"
FT                   /protein_id="ACD70612.1"
FT                   /translation="MSSEVGASLYVHIPFCAQRCAYCDFYSLVRSTYFRPHQPCPHFID
FT                   RLLQDVALQRECFGVQGWQTVYMGGGTPSLLAPQDIRHFCVALRAAQRYPIQEFTLEVN
FT                   PEDVTEEFLCACAEGGVNRLSLGVQSLRDEVLRAERRAASAECARTALRVMTANARFFS
FT                   GGVRISADLIAGLRGQTARMVREDIDELLSFGLRHVSLYGLCVPHPTETQEERIAALWA
FT                   HGSAYLVRAGFNRYELSNFARTAADESAHNRAYWRMAPHAGVGPGAVGTRFVNLSLSKE
FT                   GAWAIRSTVRKHLGQYLAEVCRENVYEHEFLTEHMCVQEALLMGLRLEQGLDVVTFRAR
FT                   FGKGIEAYIGKTIARWQCHGRMQRTATSLRLSAQARVFLDSFLREAFAELART"
FT   gene            204265..205752
FT                   /gene="tuf"
FT                   /locus_tag="TPASS_0187"
FT   CDS_pept        204265..205752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="TPASS_0187"
FT                   /product="translation elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70613"
FT                   /db_xref="GOA:A0A0H3BHV5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHV5"
FT                   /protein_id="ACD70613.1"
FT                   /translation="MTACVCLITIGRKIPDLRARGGTQEDAKPVIKCWFDGVQVGPLSS
FT                   VRNALGSRAGCARCLRGPFGCSAVDPSFRFFVPPCCVRACGVRRICATDLLRRIFMAKE
FT                   KFARTKVHMNVGTIGHVDHGKTTLSAAITSYCAKKFGDKQLKYDEIDNAPEEKARGITI
FT                   NTRHLEYQSDRRHYAHIDCPGHADYVKNMITGAAQMDGGILVVSAPDGVMPQTKEHLLL
FT                   ARQVGVPSIIVFLNKVDLVDDPELLELVEEEVRDALAGYGFSRETPIVKGSAFKALQDG
FT                   ASPEDAACIEELLAAMDSYFEDPVRDDARPFLLSIEDVYTISGRGTVVTGRIECGVISL
FT                   NEEVEIVGIKPTKKTVVTGIEMFNKLLDQGIAGDNVGLLLRGVDKKEVERGQVLSKPGS
FT                   IKPHTKFEAQIYVLSKEEGGRHSPFFQGYRPQFYFRTTDITGTISLPEGVDMVKPGDNT
FT                   KIIGELIHPIAMDKGLKLAIREGGRTIASGQVTEILL"
FT   gene            205824..206132
FT                   /gene="rpsJ"
FT                   /locus_tag="TPASS_0188"
FT   CDS_pept        205824..206132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="TPASS_0188"
FT                   /product="ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70614"
FT                   /db_xref="GOA:B2S2D5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2D5"
FT                   /protein_id="ACD70614.1"
FT                   /translation="MARERIRVKLCGFDVELVDQSSRAIVHAVQKAGAEVLGPIPLPTR
FT                   MHKFTVLRSPHVNKKSREQFEMRTHKRLIDIIEPSQEVMNALMGLELSAGVDVRIKQ"
FT   gene            206179..206805
FT                   /gene="rplC"
FT                   /locus_tag="TPASS_0189"
FT   CDS_pept        206179..206805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="TPASS_0189"
FT                   /product="ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70615"
FT                   /db_xref="GOA:B2S2D6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2D6"
FT                   /protein_id="ACD70615.1"
FT                   /translation="MVGLIGQKVGMTQIFDARGCVTPVTVIRVEHNVVVGLKDVERFGY
FT                   SAVILGTGCMKKSRISKPYAGQFAERIPPVRVMREFRGFTLDVSVGQVLDVRVLESVRY
FT                   LDVCALSKGKGFQGVVKRWGFSGGRSSHGSKFHREAGSTGQCTSPGRTFKNVKMPGRMG
FT                   AERVTVQNLRIERIDVGLGVVMVRGAVPGRNKATVFLRTAVKRER"
FT   gene            206819..207469
FT                   /gene="rplD"
FT                   /locus_tag="TPASS_0190"
FT   CDS_pept        206819..207469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="TPASS_0190"
FT                   /product="ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70616"
FT                   /db_xref="GOA:B2S2D7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2D7"
FT                   /protein_id="ACD70616.1"
FT                   /translation="MEKTVYSVEGVALRSVELDESVFGLSVNRGVIYYAINSELSNKRL
FT                   GTACTKGRSEVHGSNTKPYKQKGTGRARRGDKKSPLLVGGGTIFGPKPRDFHYALPKKV
FT                   KRLAMKSLLSLKAQGDALTVIEDFTVESGKTRDLIQVLRHFAQRERTVFILQNDDALLK
FT                   RAGRNIPTLSFLSYNRLRAHDLFYGRKVLVLETAVHKIADFYRSKDAAQDGTY"
FT   gene            207456..207740
FT                   /gene="rplW"
FT                   /locus_tag="TPASS_0191"
FT   CDS_pept        207456..207740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="TPASS_0191"
FT                   /product="ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70617"
FT                   /db_xref="GOA:B2S2D8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2D8"
FT                   /protein_id="ACD70617.1"
FT                   /translation="MEHTDVVIAPVLTEKSNALRQQGKYVFRVAARATKIQIKQAVTQL
FT                   FGVTVRRCTVMNVFGKKRRVRHRTGRTSGWKKAIVHVAAGQSIGVLERA"
FT   gene            207796..208617
FT                   /gene="rplB"
FT                   /locus_tag="TPASS_0192"
FT   CDS_pept        207796..208617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="TPASS_0192"
FT                   /product="ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70618"
FT                   /db_xref="GOA:B2S2D9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2D9"
FT                   /protein_id="ACD70618.1"
FT                   /translation="MALKMYRPMTAGLRGRVDLCRAELTARTPEKSLTRGKPAKAGRGA
FT                   GGRISVRHRGGGHKRRYRDIDFKRDLHDIPGTVKTIEYDPNRSVNIALVFYANGQKRYI
FT                   LAPKGLKVGQQVVSGEKVPLEPANALPLGVIPVGFTVHNVELTIGKGGQIARSAGTRAV
FT                   IAAKDGGYVMLRLPSGEARLVHRRCYATIGELGNEDHMNTALGKAGRARWRGVRPTVRG
FT                   MAMNPVDHPLGGGEGRGKGRNPVTPWGQPCRGYKTRKKRRVSDRFIVSKRK"
FT   gene            208627..208914
FT                   /gene="rpsS"
FT                   /locus_tag="TPASS_0193"
FT   CDS_pept        208627..208914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="TPASS_0193"
FT                   /product="ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70619"
FT                   /db_xref="GOA:B2S2E0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E0"
FT                   /protein_id="ACD70619.1"
FT                   /translation="MSRSVKKGPFVDKKLYKRVVEMNKAANQRNKKVIKSYSRCSTIIP
FT                   EMVGFTISVHNGKSWIPVYITEEFVGHKLGEFSPTRVFRGHSGSDKKVGR"
FT   gene            208923..209297
FT                   /gene="rplV"
FT                   /locus_tag="TPASS_0194"
FT   CDS_pept        208923..209297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="TPASS_0194"
FT                   /product="ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70620"
FT                   /db_xref="GOA:B2S2E1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E1"
FT                   /protein_id="ACD70620.1"
FT                   /translation="MTERVTYRAKTKFLVASPTKVRPVANVVKCKPYVRAMALLGHLPH
FT                   KGARLISKVMKSAASNAIDRDKRLDEERLFVRDIQIDEGPRLKRLWCRGRGRGDVQLKR
FT                   MCHITVVVEESVRTKDGSKG"
FT   gene            209281..210024
FT                   /gene="rpsC"
FT                   /locus_tag="TPASS_0195"
FT   CDS_pept        209281..210024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="TPASS_0195"
FT                   /product="ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70621"
FT                   /db_xref="GOA:B2S2E2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E2"
FT                   /protein_id="ACD70621.1"
FT                   /translation="MGQKVSPIGLRLGINKVWSSRWYAGPREYAALLHEDLRIRSMIRS
FT                   FPECKNADIAEVEIVRHPQRVTVVMHTARPGVVIGAKGVNIEKIGAEVQKRLNKKVQIK
FT                   VKEIKRMELNAYLVAQNVARQLTARVSFRKCLRQACAGTMKSGAQGVKIRVSGRLGGAE
FT                   MSRTEEIKEGRTPLHTLRADIDYGFAEAHTTYGSIGVKVWLYSGMMYGNECRKDVGSLL
FT                   RRSRRESGQKSDELVRDERTHAERG"
FT   gene            210028..210447
FT                   /gene="rplP"
FT                   /locus_tag="TPASS_0196"
FT   CDS_pept        210028..210447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="TPASS_0196"
FT                   /product="ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70622"
FT                   /db_xref="GOA:B2S2E3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E3"
FT                   /protein_id="ACD70622.1"
FT                   /translation="MALSPKRVKYRKVQRGRVKGDATRCNAVDFGAYALVCLEPFWLTS
FT                   RQIEAARVALNRRIKRGGKLWIRVFPDKPYSKKPAETRMGKGKGSPEYWVAVVKPGTVL
FT                   FELMGVERALAEQAMLLAGSKLPIKTRFAERVQEI"
FT   gene            210462..210680
FT                   /gene="rpmC"
FT                   /locus_tag="TPASS_0197"
FT   CDS_pept        210462..210680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="TPASS_0197"
FT                   /product="ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70623"
FT                   /db_xref="GOA:B2S2E4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E4"
FT                   /protein_id="ACD70623.1"
FT                   /translation="MGRGGCAQLSYSELLSRRRELERKYLDLRFQLVVEHVDNKLMKRI
FT                   LRRQIAAVNTFLRHKELTELEKRGVRE"
FT   gene            210695..210949
FT                   /gene="rpsQ"
FT                   /locus_tag="TPASS_0198"
FT   CDS_pept        210695..210949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="TPASS_0198"
FT                   /product="ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70624"
FT                   /db_xref="GOA:B2S2E5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E5"
FT                   /protein_id="ACD70624.1"
FT                   /translation="MKRPERRTLVGLVTSDKMHKTVTVRITTKKLHALYKKYVSRSKKY
FT                   QAHDEENTARAGDVVRIAESRPLSRRKRWRLVEIVERAK"
FT   gene            210962..211330
FT                   /gene="rplN"
FT                   /locus_tag="TPASS_0199"
FT   CDS_pept        210962..211330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="TPASS_0199"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70625"
FT                   /db_xref="GOA:B2S2E6"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E6"
FT                   /protein_id="ACD70625.1"
FT                   /translation="MIQVQSRLNVADNSGARLVQCIKVVGGSRRRYASVGDIIVVAVKD
FT                   ALPTSVIKKGSVEKAVIVRVSKEYRRVDGTYIRFDDNACVVIDANGNPKGKRIFGPVAR
FT                   ELRDMDFTKIVSLAPEVL"
FT   gene            211342..211653
FT                   /gene="rplX"
FT                   /locus_tag="TPASS_0200"
FT   CDS_pept        211342..211653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="TPASS_0200"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70626"
FT                   /db_xref="GOA:B2S2E7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E7"
FT                   /protein_id="ACD70626.1"
FT                   /translation="MGKTVKIRKDDMVLVIAGKDRGKRGAVLRVLRDVDRVLVQGLNMR
FT                   KKTIRRKSAQDEGGIMEVEAPIHISNVMIMGKKGPTRVGYRMENGKKVRVCRKTGEVL"
FT   gene            211650..212207
FT                   /gene="rplE"
FT                   /locus_tag="TPASS_0201"
FT   CDS_pept        211650..212207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="TPASS_0201"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70627"
FT                   /db_xref="GOA:B2S2E8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E8"
FT                   /protein_id="ACD70627.1"
FT                   /translation="MTDHSCIPELKVRYVQQIVPDMMRDFGYSTVMQVPKLLKIVLSMG
FT                   LGEALANRKLLDASVADLGVISGQHAVKTRARKSIANFKLREGNEIGVMVTLRRSRMYE
FT                   FLHRLINVALPRVKDFRGVSPXGFDGHGNYSMGITEQIIFPEIDFDKIERISGLNVNVV
FT                   TSAQTDQEARTLLTKLGMPFRK"
FT   gene            212219..212404
FT                   /gene="rpsN"
FT                   /locus_tag="TPASS_0202"
FT   CDS_pept        212219..212404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="TPASS_0202"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70628"
FT                   /db_xref="GOA:B2S2E9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2E9"
FT                   /protein_id="ACD70628.1"
FT                   /translation="MATVAMINKAKATPKYATRRYNRCGVCGRPRGYMRRFQLCRLCFR
FT                   KLASEGQIPGVTKSSW"
FT   gene            212420..212818
FT                   /gene="rpsH"
FT                   /locus_tag="TPASS_0203"
FT   CDS_pept        212420..212818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="TPASS_0203"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70629"
FT                   /db_xref="GOA:B2S2F0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F0"
FT                   /protein_id="ACD70629.1"
FT                   /translation="MGVSDPVADMLTKIRNAARAGHEKVDVPSSKLKVEVVKILKTEGY
FT                   IRNFRKVEEDGSGCIRVFLKYDDNETSVIHGIERISTPGRRVYSGYKTLRRVYNGYGTL
FT                   IVSTSLGVTTGRHAREQRVGGELICKVW"
FT   gene            212828..213367
FT                   /gene="rplF"
FT                   /locus_tag="TPASS_0204"
FT   CDS_pept        212828..213367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="TPASS_0204"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70630"
FT                   /db_xref="GOA:B2S2F1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F1"
FT                   /protein_id="ACD70630.1"
FT                   /translation="MSRIGKVPVSVPGGVHVRVSSGVVEVEGPKGVLSCAFLPVVTVRV
FT                   EQEYVIVARCDDSKRARACHGLYRKLLSNMVVGVSEGFSKTLVITGIGYRAEVQGRVLV
FT                   MALGYSNDFTVLIPSGIEVRVESSTRVIVSGVSKERVGEFAAQLRRLRLPEAYKGKGIR
FT                   YDYETIVRKVGKSGVK"
FT   gene            213376..213738
FT                   /gene="rplR"
FT                   /locus_tag="TPASS_0205"
FT   CDS_pept        213376..213738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="TPASS_0205"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70631"
FT                   /db_xref="GOA:B2S2F2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F2"
FT                   /protein_id="ACD70631.1"
FT                   /translation="MLRKCSDKQRKRMKRKVHIRKRVYGTAVRPRMTVFRSNRNISVQV
FT                   IDDDARSTLASVSTLEKDFVLLRANVSSGLQIGEEIGRRLLEKHIDTVIFDRNGYLYHG
FT                   VVAAVADGARKAGVKF"
FT   gene            213747..214265
FT                   /gene="rpsE"
FT                   /locus_tag="TPASS_0206a"
FT   CDS_pept        213747..214265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="TPASS_0206a"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0206a"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70632"
FT                   /db_xref="GOA:B2S2F3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F3"
FT                   /protein_id="ACD70632.1"
FT                   /translation="MDRHRDFGKDRLRDKEFTEKLIKLNRTAKVVKGGRRFSFSALTVV
FT                   GDQKGRVGFGFGKAGDVSEAIRKSVERAKRSMVLFPLKDGTIPHEVQAKFKGSLVLLRP
FT                   ACSGTGIIAGGTVRAIMEVAGATDVLSKSLGSNSAINVVRATFGAVAQLMDARKLARER
FT                   GKALVDMWG"
FT   gene            214268..214453
FT                   /gene="rpmD"
FT                   /locus_tag="TPASS_0206b"
FT   CDS_pept        214268..214453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="TPASS_0206b"
FT                   /product="ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0206b"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70633"
FT                   /db_xref="GOA:B2S2F4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F4"
FT                   /protein_id="ACD70633.1"
FT                   /translation="MTKRVRITLVRSTIGQREPVRRTVRSLGLRKLHSMVEKDGSPAVL
FT                   GMVRAVSHLVRVEELG"
FT   gene            214453..214914
FT                   /gene="rplO"
FT                   /locus_tag="TPASS_0207"
FT   CDS_pept        214453..214914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="TPASS_0207"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70634"
FT                   /db_xref="GOA:B2S2F5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F5"
FT                   /protein_id="ACD70634.1"
FT                   /translation="MADFHLIAPKGANRARRIVGRGSSSGRGTTSGRGTKGQQARAGHK
FT                   AYVGFEGGQMPLYRRVPRRGFSNCAFKKEYAVVNVGALEFVYAPGETVNRQTLIEKGLV
FT                   KGRVPFIKILADGELTKSIVVRVDRVSARAQEKIQQAGGSVECIEAQER"
FT   gene            214922..216274
FT                   /gene="secY"
FT                   /locus_tag="TPASS_0208"
FT   CDS_pept        214922..216274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="TPASS_0208"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70635"
FT                   /db_xref="GOA:A0A0H3BIN9"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIN9"
FT                   /protein_id="ACD70635.1"
FT                   /translation="MKQGVFAAVFRIRELRARIFFTLSVLTVFRFGSVLTVPSVDPRAL
FT                   SAYFRSQVRGNAFADYMDFFVGGAFSNFSVFMLGVMPYISTQILMQLSMIVFPSLKKVV
FT                   EDVGGRRRVQFWTRVATVFVCLIQSSAVTVYANQIPGAIVIQSYAVHLFVTMLTVTSGS
FT                   MITLWLGEQITARGIGNGVSMIIFSGIVARLPHALAEMWRLQRLGELNMVFVIVAFVMF
FT                   VGIIVLVVYEQQGQRKIPIHYARRVVGRKMYGGQSTYIPFKINPSGVIPIIFASSFLTF
FT                   PLQIASSIGPNVRFLHQLAQFLRPNSWWYNAFYVVLIVFFAYFYTQVTLNPTEIAKQIR
FT                   ENGGTIPGIRADKTEEYLQGILNRLVLPGSLYLGMIAVLPTLIQAAFGFPSSISLLMGG
FT                   TSLLILVGVDLDTMSQIEAQLKMRQREGLGGRGKVLPRICSGYLRKDVYEE"
FT   gene            216279..216392
FT                   /gene="rpmJ1"
FT                   /locus_tag="TPASS_0209"
FT   CDS_pept        216279..216392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ1"
FT                   /locus_tag="TPASS_0209"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70636"
FT                   /db_xref="GOA:B2S2F7"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F7"
FT                   /protein_id="ACD70636.1"
FT                   /translation="MKIRTSVKVICDKCKLIKRFGIIRVICVNPKHKQRQG"
FT   gene            216408..216773
FT                   /gene="rpsM"
FT                   /locus_tag="TPASS_0210"
FT   CDS_pept        216408..216773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="TPASS_0210"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70637"
FT                   /db_xref="GOA:B2S2F8"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F8"
FT                   /protein_id="ACD70637.1"
FT                   /translation="MARIAGVDLPNKHVSVALTYIYGISRSSARTICEKARISSACLIN
FT                   DLSQDELAVVRAIIDREYKVEGRLRTEVALNIKRLMDIGCYRGLRHRKGLPVRGQRTRT
FT                   NARTRKGKRKTVAGKKK"
FT   gene            216791..217171
FT                   /gene="rpsK"
FT                   /locus_tag="TPASS_0211"
FT   CDS_pept        216791..217171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="TPASS_0211"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70638"
FT                   /db_xref="GOA:B2S2F9"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2F9"
FT                   /protein_id="ACD70638.1"
FT                   /translation="MAVTKKRKEKKNVYEGNVYIQATFNNTIITVTDLQGNALSWASSG
FT                   GLGFNGAKKSTPFAAQTVAEAAVQKAQQCGLREVHVFVKGPGIGRESAIRMLGTMGLRV
FT                   RSIRDITPIPHNGCRPRKTRRI"
FT   gene            217186..218241
FT                   /gene="rpoA"
FT                   /locus_tag="TPASS_0212"
FT   CDS_pept        217186..218241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="TPASS_0212"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70639"
FT                   /db_xref="GOA:A0A0H3BJZ2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJZ2"
FT                   /protein_id="ACD70639.1"
FT                   /translation="MPRRNLLKGFKRPKVLEFLSENSSECYGKFTASPFETGFGTTVGN
FT                   CLRRVLLSSIQGYAVTGVRITSFDADGVAHFISSEFEQIPHVREDTLEILNNFKRLRFL
FT                   LPQGAESSTFTYEFRGAVSLTGKDFAKKFQLEVLSQDLLIMEMMDGAHVEVELHVEFGR
FT                   GYVPAESHDRYADLVGVIPVDAIFSPVLRVRYDIQSCRVGQRGDYDQLSLEVWTDGTVR
FT                   PEDAIAEAAKIIKEHFTVFVNFDETALDLEDEPEEDDPAVLELLNTKIADVDFSVRARN
FT                   CLLTMGIKTLGELTRISEQTLANTRNVGKKSLSEIQGKLQEYNLRLGMADYNHVGVVSR
FT                   LMRQKEEIDEA"
FT   gene            218231..218725
FT                   /gene="rplQ"
FT                   /locus_tag="TPASS_0213"
FT   CDS_pept        218231..218725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="TPASS_0213"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70640"
FT                   /db_xref="GOA:B2S2G1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2G1"
FT                   /protein_id="ACD70640.1"
FT                   /translation="MRHRTGFNPLSCMAAHRRALRRNMVTSLFKFERITTTKPKAAEVR
FT                   RAAERLITRSKSDSVHNRRQVARFIWDKAVLHKLFADIGPRMREREGGYTRILKLGLRQ
FT                   GDAAHVVVLELVDYTFEKSLKKRARTDSVPARKGAGKKDASRVSGTVPDGQSQKIGKKK
FT                   E"
FT   gene            218749..218946
FT                   /locus_tag="TPASS_0214"
FT   CDS_pept        218749..218946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK20"
FT                   /protein_id="ACD70641.1"
FT                   /translation="MSKAHRGKGIRGMVGRGRGVCPVTGQTGVKLLYECEIDGKKVKVS
FT                   KVGRATLQNRKRRLDAQPGA"
FT   gene            219152..219814
FT                   /gene="grpE"
FT                   /locus_tag="TPASS_0215"
FT   CDS_pept        219152..219814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="TPASS_0215"
FT                   /product="chaperone protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70642"
FT                   /db_xref="GOA:A0A0H3BIE5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE5"
FT                   /protein_id="ACD70642.1"
FT                   /translation="MCGGDVQGQGVASGCDEALERADSLRASDPVPVESGEGSVPGEHS
FT                   QELETGASEETLRERVNVLQEQYLRKAADLENYRKRALRERQEAVEHAYAALLADIVAV
FT                   LDDFDRAIEAADHASSTEVEASSAFREGVLMIRKQLSSVLETKYGLEYYPVLGERFDPN
FT                   LHEALSMSPSASVHEKIVGAELQKGYRVRNRILRHAKVMVLTPEEQTEPDRGDGPSE"
FT   gene            219930..221837
FT                   /gene="dnaK"
FT                   /locus_tag="TPASS_0216"
FT   CDS_pept        219930..221837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="TPASS_0216"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70643"
FT                   /db_xref="GOA:B2S2G4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2G4"
FT                   /protein_id="ACD70643.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMEGGEPVVIQNAEGGRTTPSIIGFTSD
FT                   GGRVVGQPAKNQMVTNPEHTIYSIKRFIGSRFNELTGEAKKVPYKIVPQGDDVRVEVEG
FT                   KLYSTQEISAFILQKMKKTAEDYLGEAVTEAVITVPAYFNDAQRQATKDAGKIAGLDVK
FT                   RIINEPTAASLAFGFNKDSKREKIIAVYDLGGGTFDISILELGDGVFEVKSTNGDTHLG
FT                   GDDFDARIVQWLEQGFKSDTGIDLGNDRMALQRLREAAEKAKIALSSSASTEINLPFIT
FT                   ADANGPKHLQRTLSRSEFEKMTDDLFERTKEPCRKALKDAGISADRIDEILLVGGSTRM
FT                   PKVAHVIKDVFGKEGSKGVNPDEAVAIGAAIQGGILGGDVKDVLLLDVTPLSLGIETMG
FT                   GVFTPLISRNTTIPTRKSQVFSTAADGQTAVSIHVLQGERGMANQNRTLGNFDLVGIPP
FT                   APRGVPQIEVTFDIDANGIVHVSAKDLGTGKEQHIRIESSSGLSESEIDRMVKEAEANA
FT                   ESDKREREKIEARNVADSLIYQTEKTLKEAGDGVNAADRARIDEAIAELKTVLSGDDVA
FT                   SIKAKTEILQQASYKIAEEMYKRQAAAGAAAGKKSDAPSGNEAEGGDVDYEVVKDEDSK
FT                   "
FT   gene            221958..223207
FT                   /pseudo
FT                   /gene="dnaJ"
FT                   /locus_tag="TPASS_0217"
FT                   /note="heat shock protein DnaJ; frameshift"
FT   gene            223384..224853
FT                   /locus_tag="TPASS_0218"
FT   CDS_pept        223384..224853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0218"
FT                   /product="possible sigma factor SigB regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70644"
FT                   /db_xref="GOA:A0A0H3BHW2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHW2"
FT                   /protein_id="ACD70644.1"
FT                   /translation="MIRRRLAIVKAGSFALLALFFSIFLRFLSPRYSFLGRFVSARDMA
FT                   LLISRYEHLPELSSRDRALLVGFVFMIFALALTEIQRYAHGRIRLVVYRQTETRLFEHF
FT                   ITLLRFCYRNEQLVAAFQEVLEYRADCAVLLMDTISNRVIYNSAARFVSDTRTYDLVLH
FT                   KFSMDYTWHWSDGIYFFDDDLCLMSDRRRARGVCLSSGELRLFIVCRFIRAVEREVISL
FT                   LFKEFEEYLNRKRNMSTLLLYSHVSQEWAMMARVQRALLPKALPHTKEICVGAFYQPLV
FT                   NVSGDYYDVISIDEHLFLFVIGDVSGKGLAASLVMGVVLSTIRIVEDKKNLPEILYAVD
FT                   RAVKRMHLHDKYTTLFLGLIDTAGMNIRYINASMESPLVFTQAGEAHEVYHLHSNCPVI
FT                   GIVDLPPIQIHERTLCPGDVMVMVSDGVVEVVNAQGVELRDADEYLHILERHVGEHPAQ
FT                   MAQSIAALALNFSADRTTHDDMTIVTVQVKR"
FT   gene            224857..227004
FT                   /locus_tag="TPASS_0219"
FT   CDS_pept        224857..227004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0219"
FT                   /product="possible sigma factor SigB regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70645"
FT                   /db_xref="GOA:A0A0H3BIP2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIP2"
FT                   /protein_id="ACD70645.1"
FT                   /translation="MGLLFFSYLFVAVFVFDVFCLKFYTRRAYALLANIALVSGVASFF
FT                   LSLSLTAVLYGKMNIQAFLFKIALIFFTHASYLFSDMAYQLPYFKKNKRFFLCNTTIHL
FT                   FGILIIIFGMGPFKWNVLVSFKFYQNYLFSSVSGIVLYAALFFLIIPCVTFATLVKKAF
FT                   MMKSIAYRQQLLFLAGAVALGFITWVIILFLFAVFPWVFVFFPLGGVFIVLFSQWAFAS
FT                   TGIVSFKEVVFALSRFVLCTVGFSCTAGYISVFWVHRFSTLDMQFVFGFFIVYALFALR
FT                   DYAFDACSVFFGEIADSGQKLAAELQALDYTAKPAQVLRTFMDTLRMRIACRGLTFLLA
FT                   DEAGVFKTVYSDFEEMATHEMEHQSLQYFFNQDVLMIRKSDPVIDHARQAIRTDILHFF
FT                   DITHAQMIVLIREAQKLIGCLCFGMKNNGVEYSNHDQHVLEKLYSHFVLVSYYLQNIAK
FT                   QDVVITVDKELKMSHQIIESIQRKRDFIQDASVEVDSIAYSAHQLGGDFVDFIKLSEKR
FT                   YLLVIGDVSGKGLAASMSMVILKSVLSTFLRGLCLEETAVFTTFIEKINRFIKDNLPCG
FT                   TFFAGVFCILDLATHTLYYANCGIPLMSMYVASYKNVVEIQGEGRVLGFVKDVMPFLRV
FT                   RKVQLGQGDVVVFSTDGMVEVQNLQRERFGNERVDRILQESHGLPVSQITRTIYARLCE
FT                   FMARDMQDDVTVLAIKCLGPR"
FT   gene            227033..227359
FT                   /gene="spoIIAA1"
FT                   /locus_tag="TPASS_0220"
FT   CDS_pept        227033..227359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIAA1"
FT                   /locus_tag="TPASS_0220"
FT                   /product="anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70646"
FT                   /db_xref="GOA:A0A0H3BJZ6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJZ6"
FT                   /protein_id="ACD70646.1"
FT                   /translation="MDNINIAKDVRPGCVLLTVTGAVSSYTYGEFESRVHGALKENHVV
FT                   LDLSGVTAMSSSGLGVLISAYDEGLKYQRRLCILNPSESVRRAIELTGFSEMFTVIKSL
FT                   DELD"
FT   gene            227360..228142
FT                   /locus_tag="TPASS_0221"
FT   CDS_pept        227360..228142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0221"
FT                   /product="possible D,D-carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70647"
FT                   /db_xref="GOA:A0A0H3BK24"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK24"
FT                   /protein_id="ACD70647.1"
FT                   /translation="MARWNCVCVCRVRVSCSGKCGLAAGRGSGGSASCACCCEARGASC
FT                   APCTRLCAQGREFLQELDAVLTTEGYLLRLVDKKHPLPETFVPKHLVPVREQWLFFSKG
FT                   RSLLLTKIAYEALHQLIQAAARDGVALSVGSAYRSFAYQKKLFSWYAQEHGMQEAMRFS
FT                   AREGTSQHQLGTVVDFGSITPAFARSDAGRWTQRNAHRFGWSLSFPPGYEQVTGYVWEP
FT                   WHFRYVGVRACALQKKWFEDIQQYMLGFIHEWKVNASS"
FT   gene            228152..228598
FT                   /locus_tag="TPASS_0222"
FT   CDS_pept        228152..228598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70648"
FT                   /db_xref="GOA:A0A0H3BIE7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE7"
FT                   /protein_id="ACD70648.1"
FT                   /translation="MWKRGVGALLWGMVLLRSFVAYADSQAATGGLLKEIMGEVASIRL
FT                   ESNMLKQQLRERHAESAALKKALQTLDVKLEKAAKALEESEHALSESKELIETLRSELE
FT                   ILRQRVNALNMRLRRLEITNNVLIGVAVVCGVAAIGAGIYAAVK"
FT   gene            228866..230173
FT                   /locus_tag="TPASS_0223"
FT   CDS_pept        228866..230173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0223"
FT                   /product="aspartate aminotransferase TpAAT"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70649"
FT                   /db_xref="GOA:A0A0H3BHW5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHW5"
FT                   /protein_id="ACD70649.1"
FT                   /translation="MRAPDMNGAVGMVLRHGVPVLRDTLHALVPDLSSSEIVSYAPTAG
FT                   IPALRERWARRLCARDPVLCPDEPDVAAMQSAAEQGEHSCAAVFPKMSLPIVLPGLTAA
FT                   LSCAMDLFVGAGQTVLVPAPRWENYDLMLAVRCAATPVPFSLFRAGRFDLSACKEALDA
FT                   QASDGVIRLILNFPHNPSGYTPTEEEAQQLYEVVYAYADAGCAVLVICDDAYSGFEYEA
FT                   SLMRGSFFARFAQAHKNICALKIDGLTKEEYAWGLRVGFLSCAGLALGVSQYQAFEKKV
FT                   MGMIRASLSCTATLTQTLALRLLAEEDEPAGLGSATARERHQFFQLMCARYREVQRVVR
FT                   DLTWSTTECGAAVPLRVEFLPCNSGYFTCIRCIGFSAETLRQYLLEQCGIGTVAIDEQH
FT                   LRVAFSALELPAIERVLRAVVHTAVQLSCVGEGSRS"
FT   gene            230210..230314
FT                   /locus_tag="TPASS_0224"
FT   CDS_pept        230210..230314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70650"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIP5"
FT                   /protein_id="ACD70650.1"
FT                   /translation="MRISAGVLNFLKVDLFKGVRHACAPLVWDAYPLK"
FT   gene            230360..231100
FT                   /locus_tag="TPASS_0225"
FT   CDS_pept        230360..231100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0225"
FT                   /product="leucine-rich repeat protein TpLRR"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70651"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK00"
FT                   /protein_id="ACD70651.1"
FT                   /translation="MPKQVVVFAMWCIGLGVLVSHPVSAKQNAVSRAEVKETPAKFFQY
FT                   GLTPDRDGIIITRYLGKGIAVVLPSQIDGLPVVEVATKAFYGCVSLVRVSLPSSVRMIG
FT                   QHAFDGCTKLARIELPDGLREIRHHAFHKCVSLAGIVFPRSLQVIGQDVFSSCGSLVDV
FT                   VLPNSVKEIGSGAFRDCAELASVRLPVGVKNLADGLFEGCRNLVELGNLPEKVSFGVGV
FT                   FVGCYRLPDVLKRSVRKLGYKGEF"
FT   gene            231345..232839
FT                   /gene="rrs1"
FT                   /locus_tag="TPASS_r0001"
FT   rRNA            231345..232839
FT                   /gene="rrs1"
FT                   /locus_tag="TPASS_r0001"
FT                   /product="16S ribosomal RNA"
FT   gene            232944..233017
FT                   /locus_tag="TPASS_t0012"
FT   tRNA            232944..233017
FT                   /locus_tag="TPASS_t0012"
FT                   /product="tRNA-Ile"
FT                   /note="tRNA-Ile1; codon recognized: AUC"
FT   gene            233133..236033
FT                   /gene="rrl1"
FT                   /locus_tag="TPASS_r0002"
FT   rRNA            233133..236033
FT                   /gene="rrl1"
FT                   /locus_tag="TPASS_r0002"
FT                   /product="23S ribosomal RNA"
FT   gene            236083..236168
FT                   /gene="rrf1"
FT                   /locus_tag="TPASS_r0003"
FT   rRNA            236083..236168
FT                   /gene="rrf1"
FT                   /locus_tag="TPASS_r0003"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(236252..236938)
FT                   /locus_tag="TPASS_0226"
FT   CDS_pept        complement(236252..236938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70652"
FT                   /db_xref="GOA:A0A0H3BK30"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK30"
FT                   /protein_id="ACD70652.1"
FT                   /translation="MFFSLYERRQSLLHRAPPVAKVASFALLLLCCNAQSWCMHASLTL
FT                   VLLALTLIVTRSLKCVAAHIRVVSIYLAFFFSLKILHTFFSTGVVSATQINQHIHAGYH
FT                   IGIRLFLLLCASSLFYACTSRLELFSLCLRMGKVLHVRSTAYTTPCAVYVMMLVLYFGH
FT                   DIFREWTELRFVWRARTRANTSFYNWVDATLHFSKTLLTRLLERAQHPSLRRADFKVSD
FT                   NILSSE"
FT   gene            complement(236991..237758)
FT                   /locus_tag="TPASS_0227"
FT   CDS_pept        complement(236991..237758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0227"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70653"
FT                   /db_xref="GOA:A0A0H3BIF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF1"
FT                   /protein_id="ACD70653.1"
FT                   /translation="MSADVAADTAVESCAGPLLELVNVSKSFERDCEVLHSVSFRVFPG
FT                   DCVVLAGANGSGKTVLMNILAGLEPPSSGRVYMARGTTVGLAFQNADTQILGETVFEDC
FT                   AFGPLQWGYSRAEIDARTNSALAAVSLLDRRDHYARALSGGEKRRLTVAGVLALDAKVV
FT                   ILDEPFANLDYPSVRQVVQLIISLKHAGKTLVIITHEVEKILAAATRLCILSKGVISYD
FT                   GTPQDALDSKIFSCYGLRDPLHCPLTLSDLLWT"
FT   gene            complement(237825..238640)
FT                   /locus_tag="TPASS_0228"
FT   CDS_pept        complement(237825..238640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0228"
FT                   /product="possible biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70654"
FT                   /db_xref="GOA:A0A0H3BHX1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHX1"
FT                   /protein_id="ACD70654.1"
FT                   /translation="MHRTEPTINCVHDGTRSLHLSIDTTRALPAHSGNEPTRTHLAAVR
FT                   VSLLKTIPVAPPKILKDSSFRVTLRIDPSEEYCTMHRSKSLAFVALFAALISSSALVSI
FT                   PLKPVPLVLQNAAAVLTGLLLGPRDGALAVLSFLGAGLLGLPVFSGGRGGYTALFAPTG
FT                   GFLLGYILAATLAGAIAQHHRLSCTPPRGGGRALLLWIRLTVATLVGFLSIYSIGLPVL
FT                   GYVLGLRTGELMLGVFLPFFLADTLKIALVVLLAHHLAPTVRRHLYRHG"
FT   gene            238584..239417
FT                   /locus_tag="TPASS_0229"
FT   CDS_pept        238584..239417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0229"
FT                   /product="DNA polymerase, bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70655"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIQ3"
FT                   /protein_id="ACD70655.1"
FT                   /translation="MQGSGTVMYAVYGRLSPMHAGDRESIARFVRVVRDCLDLFRTEGI
FT                   GPRPRNDSVILPNAACSPRNHAGKRAQSTADACVRSSDGSVYTDETLREEIFACRACEL
FT                   YQRRTHAVVGEGVADADVLVVGEAPGAEEDRSGRPFVGRSGKLLDAMLAAIGLSRQQNC
FT                   YITNVVKCRPPRNRTPTPHETACCARFLHAHLTLHRPCAILVLGRCAAQHMLQTTDGIG
FT                   KLRGRFFTYQGIPLLATYHPSALLRDEALKRPAWEDLKTFRARLLQLKQDAHMPI"
FT   gene            239422..241395
FT                   /gene="priA"
FT                   /locus_tag="TPASS_0230"
FT   CDS_pept        239422..241395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="TPASS_0230"
FT                   /product="primosomal protein N"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70656"
FT                   /db_xref="GOA:A0A0H3BK04"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK04"
FT                   /protein_id="ACD70656.1"
FT                   /translation="MAPWLELVFDVPLDKSFTYRACAAHAGEALVGRRVLAPFGARTLI
FT                   GFVISESHSSPADCGGAVGTFKEIIRVIDREALFDQTHLACARWMAHFYLCALGQALCA
FT                   VVPSRKRERTLSSFASCAGVRRTDTYALSGEQRKAIDAITASTGARSFYVHGVTGSGKT
FT                   EVFLRAAEAVLARGKSVIYLVPEIALTHQVLQEVYVRFGSQAAVLHSALSGSQRLGEWR
FT                   RIQRMRHCVVIGARSAIFAPLKRLGLVIMDEEHDSSYKSAHVPRYHARQVAMYRCADAN
FT                   CPFVMGSATPSVEAWYAMLRGAVRRLPLTARVAGGAPPRVEVVDVSKEALLLSTRLVDE
FT                   IRKTKEAGYQSMLFLNRRGFSYSFQCRSCGYTLCCTQCAVPLTWHKRVGAMQCHYCGRQ
FT                   EAPPESCPCCHSFDTRYGGVGTEYIEEAVQALFPEYRIARVDTDALRSGHVQQTMEQFR
FT                   AGKIDVLLGTQMIAKGFNFPTLRLVGIACADTGLHTPDFRAAERSFALMMQVAGRAGRY
FT                   VDNGLVIIQTRNPAHPAVVCAQHGDCESFYAQELAQREALCFPPFVRLIRFVFRSKTRR
FT                   KAKDAAYAAHALLTAQMPLGADVLGPAACVVAQVAGSYRMQILLRAPSFPVVQQVARSF
FT                   LDEFRAPAGVYVESDVDPVNVL"
FT   gene            241496..242146
FT                   /locus_tag="TPASS_0231"
FT   CDS_pept        241496..242146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70657"
FT                   /db_xref="GOA:A0A0H3BK33"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK33"
FT                   /protein_id="ACD70657.1"
FT                   /translation="MALPIIFQDAAVVAVDKPAGLAVQPGARVRVCVVDVLQKQLGVRL
FT                   FPLHRLDKDTAGVLLFAKHARAAALYQGILGSMRVIKRYRALCFGRPPRECGDIRVPIR
FT                   TGTAARRRQVVRAAHTAYRVLRATDTHTYLELTLHSGRTHQIRIHLAALGCPIIGDDKY
FT                   GDFARNKACARAWGVKRLQLFAHSLVLPCACKPLVLRARMPVHFLRALDAVAL"
FT   gene            242246..242362
FT                   /locus_tag="TPASS_0232"
FT   CDS_pept        242246..242362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF5"
FT                   /protein_id="ACD70658.1"
FT                   /translation="MYCTRCVFAGARGGERSPAAVLSVGKIPAPIVISGYLC"
FT   gene            242393..242938
FT                   /locus_tag="TPASS_0233"
FT   CDS_pept        242393..242938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0233"
FT                   /product="possible anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70659"
FT                   /db_xref="GOA:A0A0H3BHX6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHX6"
FT                   /protein_id="ACD70659.1"
FT                   /translation="MGTVVPGFDDEKDESLKMNLQKIDDLEGGVVVFLNGYIDTYNSSF
FT                   FQKRIAKVIDAGYTRIVFNCASLNYVSSTGIGSFTAFLKTVKPKGGDIVLLDIQPKVYE
FT                   VFQLLGFSQFFNIRDSIADAVSLFRNKVSPLKVDTFPKVFSCPICSKKLKATKQGRFRC
FT                   SECKTILALDASAHVSLG"
FT   gene            243072..243144
FT                   /locus_tag="TPASS_t0013"
FT   tRNA            243072..243144
FT                   /locus_tag="TPASS_t0013"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA-Thr2; codon recognized: ACC"
FT   gene            243173..243343
FT                   /gene="rpmG"
FT                   /locus_tag="TPASS_0234"
FT   CDS_pept        243173..243343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="TPASS_0234"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70660"
FT                   /db_xref="GOA:B2S2I1"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2I1"
FT                   /protein_id="ACD70660.1"
FT                   /translation="MAKRTAVELIALQCTGCKRRNYTTSRNRRNVQEKLELRKYCPFER
FT                   RRVLHREAKIK"
FT   gene            243398..243470
FT                   /locus_tag="TPASS_t0014"
FT   tRNA            243398..243470
FT                   /locus_tag="TPASS_t0014"
FT                   /product="tRNA-Trp"
FT                   /note="tRNA-Trp1; codon recognized: UGG"
FT   gene            243493..243672
FT                   /gene="secE"
FT                   /locus_tag="TPASS_0235"
FT   CDS_pept        243493..243672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="TPASS_0235"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70661"
FT                   /db_xref="GOA:A0A0H3BIQ6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIQ6"
FT                   /protein_id="ACD70661.1"
FT                   /translation="MLKFAKFRRECVAEFRRVVWPARTQVHTAVKVVLVSTVVMALFLG
FT                   LIDALFVALLSFFF"
FT   gene            243682..244239
FT                   /gene="nusG"
FT                   /locus_tag="TPASS_0236"
FT   CDS_pept        243682..244239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="TPASS_0236"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70662"
FT                   /db_xref="GOA:A0A0H3BK08"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK08"
FT                   /protein_id="ACD70662.1"
FT                   /translation="MAKEWYILHTFSGREARVERAVRMLVEHARIPTNVIFDIKIPEEL
FT                   LTEVKDGKKRVVRRKFFPGYLLVEMDLPEVDWRIVCNEVRRIPGVSGFLGSSGNAKPQA
FT                   VSADEARRILQKAGEIKGDRTPRIAQTFLVGQQVRIVEGPFATFSGEVEEVMSERNKVR
FT                   VAVTIFGRATPVELELVQVEAL"
FT   gene            244346..244786
FT                   /gene="rplK"
FT                   /locus_tag="TPASS_0237"
FT   CDS_pept        244346..244786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="TPASS_0237"
FT                   /product="ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70663"
FT                   /db_xref="GOA:B2S2I4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2I4"
FT                   /protein_id="ACD70663.1"
FT                   /translation="MAAKKKVVTQIKLQCPAGKATPAPPVGPALGPHGVSAPQFVQQFN
FT                   DRTKSMEPGLVVPVVVTVYSDKSFSFVLKTPPAAVLIRKACGIEKGSTNSVKQKVARLS
FT                   LAQLTEIAQVKLPDMSALTLDAAKRIIAGTARSMGVEVERSL"
FT   gene            244783..245463
FT                   /gene="rplA"
FT                   /locus_tag="TPASS_0238"
FT   CDS_pept        244783..245463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="TPASS_0238"
FT                   /product="ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70664"
FT                   /db_xref="GOA:B2S2I5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2I5"
FT                   /protein_id="ACD70664.1"
FT                   /translation="MKRGKKYRAAVARYDRAERFSLDRAVGLLKEVRYASFDETVEVHV
FT                   SLRLKKNQTVRDTVVLPHRFRAEVRVLVFCKEDRVSEALAAGAAYAGGAEYLEKVKGGW
FT                   FDFDVVVASPDMMKDVGRLGMVLGRRGLMPNPRTGTVSADLGAAVCELKKGRVEFRADK
FT                   TGVVHLAVGKTTMDSAQIVENVDVFLSEMDRKKPVDVKAGFVRSISLSSSMGPGIWVVH
FT                   KSEE"
FT   gene            245465..246007
FT                   /gene="rplJ"
FT                   /locus_tag="TPASS_0239"
FT   CDS_pept        245465..246007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="TPASS_0239"
FT                   /product="ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70665"
FT                   /db_xref="GOA:B2S2I6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2I6"
FT                   /protein_id="ACD70665.1"
FT                   /translation="MAVRARRLQPAKVAAVESLTRDLGEASSYIFTEYRGLTVEQLTAL
FT                   RRALREFSCVYRVVRNNFANIAFTSLNMTVGEYLVGPTAIALVDTEHANGVARVLFDFA
FT                   KEVPALVVKGAILDGEVFDASKVEAYSKLPGKKELVSMFLSALNATTVKFVRVLQAVMD
FT                   KRDEGVEVSVVSGGDSS"
FT   gene            246116..246505
FT                   /gene="rplL"
FT                   /locus_tag="TPASS_0240"
FT   CDS_pept        246116..246505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="TPASS_0240"
FT                   /product="ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70666"
FT                   /db_xref="GOA:B2S2I7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2I7"
FT                   /protein_id="ACD70666.1"
FT                   /translation="MAALSNEQIIEAIRGKTILELSELIKAVEEEFGVTAAVPVAPVAE
FT                   GGGAGSVAAEEQTEFTVVLKGLAEPGKKIAVIKEVRNVISGLGLKEAKDLVEGAPKTLK
FT                   ENVSKEEAAKIKESMTAAGALIEIS"
FT   gene            246768..250304
FT                   /gene="rpoB"
FT                   /locus_tag="TPASS_0241"
FT   CDS_pept        246768..250304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="TPASS_0241"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70667"
FT                   /db_xref="GOA:A0A0H3BK37"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK37"
FT                   /protein_id="ACD70667.1"
FT                   /translation="MSARVCKTHRVYVGRDVRNFMDIPDLIEIQLRSYDTFLHGARNTP
FT                   SGADTLISGTREELGLEDVFKTTFPIESSTGDMTLEYQSYSLDEKNIKFSEAECKQKGL
FT                   TYAIPLKALVDLRFNNTGEIRRKDIYMGDIPKMTERGTFIINGAERVVVSQIHRSPGVV
FT                   FSHEKDKEGREVFSSRIIPYRGSWLEFEIDQKKDLIYAKLDKKRRILGTVFLRALHYET
FT                   REQIIEAFYAIEKTPVCQDRAEYELLTGKILARSVTVENEQGETRVLYKAGEKIHPHVI
FT                   DDLLQNGICEVYIINLEAEGSLRSAVVINCLEREEMKFSKSGAQDELSREEALCIVYSA
FT                   LRPSDPMTMDAAEKDLQTMFFSPRRYDLGRVGRYKLNKKFRSDSPTTECTLTLDDIVNT
FT                   MKFLIRMYSGDAQEDDIDHLGNRRIRSVGELMTNTLKTAFLRMERIAKERMSSKETETI
FT                   KPQDLISIKPIMAAIKEFFGASQLSQFMDQVNPLAELTHKRRLNALGPGGLSRERAGFE
FT                   VRDVHYTHYGRMCPIETPEGPNIGLIVSMANYARVNGYGFLEVPYVRVRDGVVTKEIEY
FT                   LDAMDEDRYYIGQDSTAVGPDGVIRVDHVSCRHRGDYSTRSPKDIQYMDVSPKQIISVS
FT                   ASLIPFLEHDDANRALMGSNMQRQGVPLIFPEPPRVGTGMEEKCAYDSGVLVKAKQDGT
FT                   VAYVSSEKIVVCSAAASGEEQEVVYPLLKYQRTNQDTCYHQRPIVHVGDRVQVGDALAD
FT                   GPATYRGELALGRNILVGFVPWNGYNYEDAILISHRVVKEDMFTSVHIKEFSTEVRETK
FT                   LGSERMTNDIPNKSEKNLDNLDAEGIIRIGSKVRAGDVLIGKITPKSESETTPEFRLLN
FT                   SIFGEKAKEVRDSSLRVPHGVEGTVIDVQRLRRSEGDDLNPGVSEVVKVLIATKRKLRE
FT                   GDKMAGRHGNKGIVARILPEEDMPYLDDGTPLDVCLNPLGVPSRMNIGQILESELGLAG
FT                   LRLDEWYESPVFQSPSNEQIGEKLMQAGFPTNSKVMLRDGRTGDYFQNPVFVGVIYFMK
FT                   LAHLVDDKMHARSTGPYSLVTQQPLGGKAQFGGQRLGEMEVWALEAYGAANTLQELLTI
FT                   KSDDMHGRSKIYEAIVKGEASSPTGIPESFNVLVQELRGLALDFTIYDAKGKQIPLTER
FT                   DEEMTNKIGSKF"
FT   gene            250317..254567
FT                   /gene="rpoC"
FT                   /locus_tag="TPASS_0242"
FT   CDS_pept        250317..254567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="TPASS_0242"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70668"
FT                   /db_xref="GOA:B2S2I9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2I9"
FT                   /protein_id="ACD70668.1"
FT                   /translation="MKDIRDFDSLQIKLASPDTIRAWSYGEVKKPETINYRTLRPEREG
FT                   LFCERIFGTTKEWECFCGKFKSIRYRGVICDRCGVEVTHFKVRRERMGHIELATPVSHI
FT                   WYYRCVPSRMGLLLDLQVIALRSVLYYEKYIVIEPGDTDLKKNQLLTETEYNDAQERYG
FT                   GGFTAGMGAEAIRTLLQNLDLDALVAQLREKMMEKGAKSDKRLLRRIEIVENFRVSGNK
FT                   PEWMILSVIPVIPPDLRPMVQLDGGRFATSDLNDLYRRVIHRNSRLIRLMELKAPDIII
FT                   RNEKRMLQEAVDALFDNSKRKPAIKGASNRPLKSISDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPELKLWQCGLPTKMALELFKPFIMKKLVEKEIVSNIKKAKMLVEQESPKVFS
FT                   VLDEVVKEHPVMLNRAPTLHRLGIQAFEPVLVEGKAIRLHPLVCKPFNADFDGDQMAVH
FT                   VPLTQAAQMECWTLMLSNRNLLDPANGRTIVYPSQDMVLGLYYLTKERSLPEGARPRRF
FT                   SSVEEVMMAAEKGVIGWQDQIQVRYHKCDGQLVVTTAGRLVLNEEVPAEIPFVNETLDD
FT                   KRIRKLIERVFKRQDSWLAVQMLDALKTIGYTYATFFGATLSMDDIIVPEQKVQMLEKA
FT                   NKEVLAIASQYRGGHITQEERYNRVVEVWSKTSEELTSLMMETLERDKDGFNTIYMMAT
FT                   SGARGSRNQIRQLAGMRGLMAKPSGDIIELPIRSNFKEGLNVIEFFISTNGARKGLADT
FT                   ALKTADAGYLTRRLVDIAQDVVVNEEDCGTINGIEYRAVKSGDEIIESLAERIVGKYTL
FT                   ERVEHPITHELLLDVNEYIDDERAEKVEEAGVESVKLRTVLTCESKRGVCVCCYGRNLA
FT                   RNKIVEIGEAVGIVAAQSIGQPGTQLTMRTFHVGGTASSTTEENRITFKYPILVKSIEG
FT                   VHVKMEDGSQLFTRRGTLFFHKTLAEYQLQEGDSVQVRDRARVLKDEVLYHTTDGQTVY
FT                   ASVSGFARIIDRTVYLVGPEQKTEIRNGSNVVIKADEYVPPGKTVATFDPFTEPILAEQ
FT                   DGFVRYEDIILGSTLIEEVNTETGMVERRITTLKTGIQLQPRVFISDESGNALGSYYLP
FT                   EEARLMVEEGAQVKAGTVIVKLAKAIQKTSDITGGLPRVSELFEARRPKNAAVLAQISG
FT                   VVSFKGLFKGKRIVVVRDHYGKEYKHLVSMSRQLLVRDGDTVEAGERLCDGCFDPHDIL
FT                   AILGENALQNYLMNEIRDVYRVQGVSINDQHIGLVVRQMLRKTEVVSVGDTRFIYGQQV
FT                   DKYRFHEENRRVEAEGGQPAVARPMFQGITKAALNIDSFISAASFQETNKVLTNAAIAG
FT                   SVDDLCGLKENVIIGHLIPAGTGMRRYRQVKLFDKNKRDLDVQMEEVIRRRKLEEEALA
FT                   QAVAGMEGEPEGEA"
FT   gene            254670..255044
FT                   /gene="rpsL"
FT                   /locus_tag="TPASS_0243"
FT   CDS_pept        254670..255044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="TPASS_0243"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70669"
FT                   /db_xref="GOA:B2S2J0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2J0"
FT                   /protein_id="ACD70669.1"
FT                   /translation="MPTINQLTRIGRKAVFSRTKSPALQACPQKRGVCTRVMTVTPKKP
FT                   NSALRKVARVRLSSGVEVTAYIPGIGHNLQEHSIVLIRGGRVKDLPGVRYHIIRGAKDT
FT                   LGVVDRKRGRSKYGAKRPRA"
FT   gene            255066..255536
FT                   /gene="rpsG"
FT                   /locus_tag="TPASS_0244"
FT   CDS_pept        255066..255536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="TPASS_0244"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70670"
FT                   /db_xref="GOA:B2S2J1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2J1"
FT                   /protein_id="ACD70670.1"
FT                   /translation="MGRKRRVSRRVPPPDARYNSVVLAKFICRMMLAGKKATAVGIMYD
FT                   CLERIQQRTGEEPLPVFTKALENVKPAVEVKSRRVGGSTYQVPMEIRETRREALGMRWI
FT                   IGAARRRSGRGMSERLAAEILDAYHSTGTAFKRKEDTHRMAEANKAFSHYRW"
FT   gene            255560..259015
FT                   /locus_tag="TPASS_0245"
FT   CDS_pept        255560..259015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF9"
FT                   /protein_id="ACD70671.1"
FT                   /translation="MLQGRCLPLAGGVFALVLSLDSSGRRFWVACSCAPYQHKRRVHTV
FT                   GGLLSDPHNFARACALFREFSAREERSGVVRAELKCPVDVRDSFLRASREIDPRAAHSL
FT                   QQEEVLGDGRAALCSADCLLLQAFTHFHNTELARYRARLADIDARIVYERFLRDWECAV
FT                   ACAHFGIHRRSTVFTRVHSDAIRDLEEQRAALALETPESFFVLHAAQWLGEVERVSSGV
FT                   FAQTPSVSAALERIATSLARGDAVLLRGHLGTGKTELAVLAAERFALHKLITEDVRCAL
FT                   NEWCTAATGGSCAEIRGSERGVSDALQNSQEARTQFQRLFSQRAAYYEQALRLGDERLL
FT                   QRIKPLFISGSKHIDTEDLFLEKTLVLKNSLEGKTPEHCYQDVHAFTERGYAFDPMLDI
FT                   YLAKYGNFGTEVQKIEREVLRAVKEGRPLVIDEINAIPMQHLIALNDILQKRVGDFAYI
FT                   PGVGPVKIAAGFGVIATGNISSGLVHYEGTGALNPAFASRFNTFEYDYPPQSTEGLYTN
FT                   QAHPEKNELFRIILARLASSGGSLCLPDIDGSLDKLFKLAQLAKVTQQVFSGKWKDSTG
FT                   GSETHDGLGDVEPELREAVLSIRNVIRVLDEWNRGEEKDVDQALWDGFIGGVLNADDQN
FT                   YILSQAVRFGFFQEKDGWSVRPKGIGAGFTSYEEIRTRPYEYTRLPDGVKTLAEVVVLL
FT                   FGHGPTYAMHTQNTVPDVVDAGAMLVLHDRIHELVRVCAAFRLLQEKSYARECADRIAH
FT                   LQCSCDQLVSEHARLRSEGGTPRALWDDLARAEQTSDALIQELLPEFRHCFPDICGDEC
FT                   TYSDVFFEFGKSITAAIPLAEDSVLIAGGTDDIRLLYRVHDQWLVAESTHKSVKTDWRI
FT                   CALISMGDGEVVVVTEGGETIVLSIQERSKKAERRRVSFEVVARVEGVYERVLCVEKVN
FT                   AHRVVVGDETGALFILEKSAHGYEYRGPILGLGGGIRVVRALNTAQLVVFSGFSGTRLL
FT                   HNEEYSDAIYGFENPYTEAVVLSEDRVVVFGDDGESRVLRHEHGMAAGDYAYGEWITGF
FT                   KSVVLCALALSSRMVLVFGRGGEARLLSFDATGTAQYSRSFGNTTGAVVSAFLLQSEHP
FT                   SVFNVFIAAENGTCRLLTVHEFCEPSMFKERLSKIVAPPLHDNE"
FT   gene            259161..260954
FT                   /locus_tag="TPASS_0246"
FT   CDS_pept        259161..260954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70672"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHY1"
FT                   /protein_id="ACD70672.1"
FT                   /translation="MVGVPLQWFLKDDFDGKEILWNLFRELVYYRELKADYAYYCNRVS
FT                   FFEDAAQGMRRLMYEAVFSREARDEIRVRAFVQHYCHTEVASLFYLFDAVYAFHYVRNR
FT                   APYYTTPEGSALLASLYQKERGVYWEHTETALHLQFAYALAERVLFHDMPKGCNRACIA
FT                   RDPVVQEVLRTLVLGTEMSNFIHSEFFPLSGEVVPTKHRDRIVSVFLLEHFVRLWHLSV
FT                   ANITFELKNITDRSYDPFRNERAFEYTKSNLHAVHSRDGQQELKKREDVFESCTTQFDE
FT                   RFSISPKERKEFARLLRTTHRLRIDMRSFWKSLIGKSVQWIDCYEGKCPKGRLNVGDFV
FT                   SVFPDFQEFRGRDQRYKLRVYDRVYEVRACTLRPAQIEVSFVVDNSGSMNKEKIASARE
FT                   ALAVSMLSLKDFGEYSDMLAAGRRERTTIHSEVYYFGSSFIKVKSFGKSKSKDFNSAQL
FT                   IKASVNLDGRFGGTNDAEVLKHILADVERRRARVSSDTSFVKVVLVITDGCSSYPHESR
FT                   RTIEELRRRGVMIFGFQIGLMSPEETALFHDVWNSTEELGLLLGERLEYLPRELLRTLR
FT                   VVLSKVHRLSSGERLHAQRVW"
FT   gene            261005..262078
FT                   /gene="amiA"
FT                   /locus_tag="TPASS_0247"
FT   CDS_pept        261005..262078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiA"
FT                   /locus_tag="TPASS_0247"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70673"
FT                   /db_xref="GOA:A0A0H3BIR1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIR1"
FT                   /protein_id="ACD70673.1"
FT                   /translation="MHWYFDRVSRARGIMKFLRSCLIGGVFFFALCLSADEAFVSAMKL
FT                   ARTLNVSVSWNPLSQTILFSKGERRVQCRVGQVLALLDGSEVLMIDPPVVKDAVVYVSG
FT                   GFAERLRKVFGYSSHQPEHRVGAVLIDPGHGGKDWGTKGSYREQGKTVVVKEKDIALRA
FT                   SQNIYDLLTARYPDRKIIMTRKGDSYLTLEERVAMANGVKLGKYEAILYVSVHANFSWN
FT                   TKASGFEVWYLPPEYRRSILDKNAASKEVLPILNSMLEEEFTMESIMIARSIADGMQAS
FT                   VGAQSKNRGVKEEAWFVVRNAKMPSVLVELGFVSNPVEARLLNDADYLKRCAQGIYNGL
FT                   VSFITYFEGSGGFTGPL"
FT   gene            262145..262549
FT                   /locus_tag="TPASS_0248"
FT   CDS_pept        262145..262549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK13"
FT                   /protein_id="ACD70674.1"
FT                   /translation="MWHLRCSNWRGSGVFGMCFSLSGCVMGQWCVSRAIVRGHTQGGAV
FT                   REVVRELLLGPQHHGYARLVDPAVRPLSCFSRGDTLYIDLPVGVLSPKYRTCSLHRAYE
FT                   LXERSVVLNCAPVKRVCFYVGGRAGFESDG"
FT   gene            262628..263680
FT                   /gene="flaA1"
FT                   /locus_tag="TPASS_0249"
FT   CDS_pept        262628..263680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA1"
FT                   /locus_tag="TPASS_0249"
FT                   /product="flagellar filament outer layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70675"
FT                   /db_xref="GOA:A0A0H3BK42"
FT                   /db_xref="InterPro:IPR006714"
FT                   /db_xref="InterPro:IPR016369"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK42"
FT                   /protein_id="ACD70675.1"
FT                   /translation="MKKAVVLSAVALLSGVCAVADESVLIDFAKLNADIMADKSGGMTH
FT                   NRRTVLDYASLADTSYTDEQKALMRSSLAVAQWEVVLNSSARNPVAHAASRVIEAPVSE
FT                   GAKSFAGERVLGVRVLFPTWDSNANAMIKPAFVIPAYEVMAQVDDQGNVQAPTEEEKAS
FT                   GKGRFEDGYGVVKNVGVLKSIAVNTYGMNYPHGLYVMMRDQDGEVHRYFMGYLLFDSWK
FT                   ELVWNNPSYISDVRSREVRLYPVYPASTPHVVFEGFMVTRDAAHAGGDYVGYFKDVKII
FT                   YDKAVLSTVRDFADEDLWGIQARREAERKRVEVARFGQQQVLRYIEQEKLATEVGFTPS
FT                   GGAQRQEEQQ"
FT   gene            263731..263958
FT                   /locus_tag="TPASS_0250a"
FT   CDS_pept        263731..263958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0250a"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0250a"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG2"
FT                   /protein_id="ACD70676.1"
FT                   /translation="MSFPSLLFLGFSGVLAFGEVGWVGVYPPGRGMIRVRCVGCVVGWL
FT                   GLRRVLVRGGIWLLLHPGIGRVLCLYLGAW"
FT   gene            263793..264080
FT                   /gene="rpsT"
FT                   /locus_tag="TPASS_0250b"
FT   CDS_pept        263793..264080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="TPASS_0250b"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0250b"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70677"
FT                   /db_xref="GOA:B2S2J8"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2J8"
FT                   /protein_id="ACD70677.1"
FT                   /translation="MGRSVSARKRHDQSEVRRMRGRMARSAARTCARRYLAAVTSGDRE
FT                   SSLPLLRSLVKRLDTAARKGVFARKAVARQKSRMCRLYNGVFSSPEVVRV"
FT   gene            264112..264429
FT                   /locus_tag="TPASS_0251"
FT   CDS_pept        264112..264429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0251"
FT                   /product="DNA-binding protein II"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70678"
FT                   /db_xref="GOA:A0A0H3BHY7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHY7"
FT                   /protein_id="ACD70678.1"
FT                   /translation="MKRVRRTRSFVVDALCDEVDLSRRHVARVVDSFVSVVTAALERGE
FT                   TVELRDFGVFESRVRKASVGKSIKTGEVVSIPSHCVVVFRPSKRLKSAVRGYRSGEVGA
FT                   D"
FT   gene            264419..266059
FT                   /locus_tag="TPASS_0252"
FT   CDS_pept        264419..266059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0252"
FT                   /product="possible apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70679"
FT                   /db_xref="GOA:A0A0H3BIR9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIR9"
FT                   /protein_id="ACD70679.1"
FT                   /translation="MRIEEWCRSRLGEFLLFVLAVSLFALSHPNPLLPRGCALLAYGAL
FT                   APLFLLVRWASGFAVVFWGGAYGAFSYGAFSYWLFVFHPVALCVVAGFSALFLAALCLA
FT                   LKAGGAFWQRRALLVQCLVWLGYEYAKTLGFLGFPYGVMGYSQWRVLPLIQVASVFGVW
FT                   AVSALVVFPSAWLASVLGQWVEESERNARAFLSAAYSHWVSALVWVGLCGFCVCAAKAG
FT                   WWPDCTAHTRAKVALVQPNGDPRRGGIESYRADFSTLTYLSDWALERYPDVDLVVWPET
FT                   AFVPRIDWHYRYRHEQQSFQLVCDLLDYVNAKNCPFIIGSDDAYKKRTKEGNWERVDYN
FT                   AALLFIPGVNVLPPSPQRYHKIKLVPFTEYFPYKRVFPWFYNFLEKQDARFWAQGSEFV
FT                   VFEARGLKFSVPICFEDAFGYITREFCARGASLLVNISNDSWAKSLSCQYQHLSMAVFR
FT                   AIENRRALVRASTSGQTVAIAPDGRILDELQPFAPGVLVADVPIVTCACGGYRYWGDAL
FT                   GVFFCVASLFILIAGGVRHMLRCRRGGWR"
FT   gene            266050..266463
FT                   /locus_tag="TPASS_0253"
FT   CDS_pept        266050..266463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70680"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK21"
FT                   /protein_id="ACD70680.1"
FT                   /translation="MALKRVSEGHGKTVLGAKTVFDGVLRFKGNLHIRGKFSGAIDAQG
FT                   CLTIAPGAVCAVQYARAVSIFVEGEVRGNLTVVDRVEMRDGSRVFGDVTASRIKICDGV
FT                   TFEGSVCMTREGNVSKRDLFSVQSEQLKEHLRR"
FT   gene            266700..268259
FT                   /gene="rho"
FT                   /locus_tag="TPASS_0254"
FT   CDS_pept        266700..268259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="TPASS_0254"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70681"
FT                   /db_xref="GOA:A0A0H3BK49"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK49"
FT                   /protein_id="ACD70681.1"
FT                   /translation="MKVSVGTVVGQGELGLEEGIVGNQIVSEDSAADVGECDAYGGRKK
FT                   LVIRSRSRRRVVTPKALEVEKRPRRALRFKQNFCPEDAETSESSADVKGRARLLIDDLT
FT                   EMGMHALRDFAVQRGISQEDVVVMKKSDIIFHVLKNHTENGGVIFASGSLEILPDGYGF
FT                   LRSPQNSYLPGSDDIYVSPSQIRLFNLKTGDTIYGQIRSPKEGERFFAMLRVETVNFEE
FT                   VAKVQDRVPFDSLTPLYPREKLNLETRTEDISTRVMNLFCPIGKGQRALIVAPPRTGKT
FT                   ILMQKIANAITQNHPEVYLIVLLIDERPEEVTDMERTVDAEVISSTFDEQATRHVQIAE
FT                   IVLERAKRLVEHRKDVVILLDSITRLARAYNQTMPTSGKVLSGGVDSNALHKPKRFFGA
FT                   ARNVEEGGSLTIIATALIETGSRMDEVIFEEFKGTGNMEINLDRRLSDRRLFPAVSIKK
FT                   SGTRKEELLLTEEEMQRIWVLRKVINPMDDAEIVELLIDKMRKTKNNEAFLRSMNTGAF
FT                   SS"
FT   gene            268378..268581
FT                   /gene="rpmE"
FT                   /locus_tag="TPASS_0255"
FT   CDS_pept        268378..268581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="TPASS_0255"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70682"
FT                   /db_xref="GOA:B2S2K3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2K3"
FT                   /protein_id="ACD70682.1"
FT                   /translation="MKKGLHPRYEETKVVCACGNVIVTASTVKDLRVEICSACHPFFTG
FT                   KQKLVDSAGRIDRFNRRYKIRG"
FT   gene            268626..269276
FT                   /gene="pgsA"
FT                   /locus_tag="TPASS_0256"
FT   CDS_pept        268626..269276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="TPASS_0256"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70683"
FT                   /db_xref="GOA:A0A0H3BIG6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG6"
FT                   /protein_id="ACD70683.1"
FT                   /translation="MRLSDFYTALRLALVLPFFALYHMSRWVVMYFPAANVGRVVSIAS
FT                   VLLFLFIACTDFLDGYYARKSGKYSSFGKVFDPFADVIANVTVMLCLVADNFMPVFLFL
FT                   CILYREFGMMFLRMLACGEGHVVGAQRMGKLKTASYMGAVLFSLLLKALYAFELAGADW
FT                   YERMRAVGRLVYVVPVVLALASFFSYLKTFFPILKRVCGRTRYPVCKTCREWD"
FT   gene            269373..270443
FT                   /gene="glpQ"
FT                   /locus_tag="TPASS_0257"
FT   CDS_pept        269373..270443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="TPASS_0257"
FT                   /product="glycerophosphoryldiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70684"
FT                   /db_xref="GOA:A0A0H3BHY9"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHY9"
FT                   /protein_id="ACD70684.1"
FT                   /translation="MRGTYCVTLWGGVFAALVAGCASERMIVAYRGAAGYVPEHTFASK
FT                   VLAFAQGADYLQQDVVLSKDNQLIVAQSHILDNMTDVAEKFPRRQRADGHFYVIDFTVE
FT                   ELSLLRATNSFYTRGKRHTPVYGQRFPLWKPGFRLHTFEEELQFIRGLEQTTGKKIGIY
FT                   SEIKVPWFHHQEGKDIAALTLALLKKYGYQSRSDLVYVQTYDFNELKRIKRELLPKYEM
FT                   NVKLIQRVAYTDQRETQEKDSRGKWINYNYNWMFEPGGMQKIAKYADGVGPDWRMLIEN
FT                   EWSKVGAVRLSPMVSAIQDAKLECHVHTVRKETLPSYARTMDEMFSILFKQTGANVVLT
FT                   DFPDLGVKFLGKPARY"
FT   gene            complement(270509..271219)
FT                   /locus_tag="TPASS_0258"
FT   CDS_pept        complement(270509..271219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIS3"
FT                   /protein_id="ACD70685.1"
FT                   /translation="MLSLGPFHRKGWHCNSLRIRTQSTETVTHVGARSFRSAVFTLLTT
FT                   VCALCGDPAHAYLVQFKEQFYRLYHTHLHQYPDEVIENIHWLERAVHADFANPLYALAP
FT                   IRDKKSWEKYRALFMMHLNLKLTEQHLRLGEKFDKREALFFNAPWREENIESLATAERC
FT                   YHTARRYWHEAALWAERANADQFRFLFLTELPAWEDERERIARGTLNYARTISRELARL
FT                   EAVRARFMEMNDTY"
FT   gene            271298..271909
FT                   /locus_tag="TPASS_0259"
FT   CDS_pept        271298..271909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70686"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK23"
FT                   /protein_id="ACD70686.1"
FT                   /translation="MYLVFIGVLCENGPLFCPDCACSLEEETMMRKLSTGLLLWIAFIS
FT                   GVTSCKSAPPAEELVEVAPPVEEQEEEPMTPVPEEPQEPMAVAPQEVSRAEYVVKNEDT
FT                   LSQIAKKFYGSRIRGYYFPIIMACSEGVVTHPDRIRPGMKLVIPNFDEFMADPDHVRKG
FT                   LEAFAQVERIYRSEGKMKLAEFMNKLGEKIGKTDPRDMPR"
FT   gene            complement(272040..273386)
FT                   /locus_tag="TPASS_0260"
FT   CDS_pept        complement(272040..273386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70687"
FT                   /db_xref="GOA:A0A0H3BK54"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK54"
FT                   /protein_id="ACD70687.1"
FT                   /translation="MCYYRYVQVHSIWRRFCALGLLVPFLLLLFSCTNTVGYGVLQWSL
FT                   PDLGLSTGDILPVYVRSNVSQVYIVEIQKKKVELPFWQLKLCRTKKEALQYAERLREYR
FT                   YSYATSVLDGLPLREGPENTAPQVYRLREGQAVKLLWKGTGKAVYRGENRLEGDWFKVM
FT                   TEDGTTGWCFSHGLSLFDERESRPTVRETDDLARDRDLQHVLNSAWYPEYYRTMVEQRR
FT                   IDLEKMASGWGLFVGEKKGLARIELPDAHYAFPYSRLVKTGSNGYLFDGSSLSIYVRDA
FT                   HTLAAQFTDEAGRLRIERFVTLEKTPEEIIAEEQLRRSALLEHVCTPGLRLHSEIYGTL
FT                   SFTERNVFTWTGARALSPALIPAGAGSTGRVALRCFIDQSLKSEYEGVLSFDFDSAQEW
FT                   VHFLYLRTPGGLKLEHIDSTHLKDATVLRRSVSPVVLYFAPEGHAEPQP"
FT   gene            273501..274544
FT                   /locus_tag="TPASS_0261"
FT   CDS_pept        273501..274544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0261"
FT                   /product="possible catabolite gene activator"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70688"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH0"
FT                   /protein_id="ACD70688.1"
FT                   /translation="MGATLFLGVAWKTEADVPKAIQYKANSVIYFSGDLDDRVMILNKG
FT                   HVALTFADVETGSQVTEYIKTGEFFGVKSALGNFPREENAITLVDSIVYAFGSQEFEAF
FT                   AQTNIRIVMKMLKVFSRQLRSVHRQLESLLDSQEETNNEEGLYTVARAFHASEHYLAAS
FT                   QVAQRYRELYPDGKHRHDIASMLESADGTVGRGFEEAGAQGSDAGFEVPSAFAESAVDS
FT                   EVGDLRAAELLEQQGKWGEAYEHYRLGCASNGGVGAEAAYLGAGRCLFEQREFVRSIQT
FT                   FTECITRNPKSTRLAEVLMYLGQCYQGMGRPDKAISFYDKALSTAPESLVPRIKELQRS
FT                   CEEASHG"
FT   gene            274522..275196
FT                   /gene="crp"
FT                   /locus_tag="TPASS_0262"
FT   CDS_pept        274522..275196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="TPASS_0262"
FT                   /product="catabolite gene activator"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70689"
FT                   /db_xref="GOA:A0A0H3BHZ3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHZ3"
FT                   /protein_id="ACD70689.1"
FT                   /translation="MRRRRMADAFASFTRFAKKFQRGSVIFAEFDVGESFYLVQSGRVR
FT                   LIKIINGKERYLDVLQPGEIFGEMSILDNSPRSASAVAYDDVVALEFNRENFEVLMMGN
FT                   PAIAMRLLKTFVRRIYTQKRRFMILTIQDSTARVGDVFLMLDETQPHVDRSSDARSFDI
FT                   SIEEIARWAGLSDREVQDALRRLSDQRKVEWQERRIVVKNMTDLNRYVTMRRGKGDGLP
FT                   LG"
FT   gene            275211..276995
FT                   /locus_tag="TPASS_0263"
FT   CDS_pept        275211..276995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70690"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIS6"
FT                   /protein_id="ACD70690.1"
FT                   /translation="MPIRFRCLLRRRSFSLGCTVRVHTKALRGLCVQLWFCTVWELCER
FT                   SLLIIRVERPILGGDGCAFCDNIRPCWGMVRRVEGEGNAAGVLYAKEAQLLLGGAQGWQ
FT                   SLTRVKNLRTRVGRAGHPALELSSAARTRSVRGDLYLSFDDPLVSDLYGRYRVQSSSAQ
FT                   HVGEERAHRGAGAALFRTMHRSVPSAYGGAAGGDGAEGVVLQPNPGALFYGSQALSSFS
FT                   IEFWLYPAVSENGAVLFRWRSSLSDRGRSFYQHIVAHILQHRLEWRAEGLWNDVRGQAV
FT                   SLRLRSRTHVLPERWSHHMLTYDETRGVLEYRMNGRTECLEYLTDSQDETGQVWHARLG
FT                   AAAAVHIGERYSGLIDEVVITEEFVPPSEAGEVLRRFNRLARFDQAGGRFESEITDAGG
FT                   LQAVVRRVNADVDIPEQADVAFFVRVGQTKEDWTLEYPLWQPVVAGQPLSGLEGRYFQV
FT                   AVQLYPDGAGRKTPVVHAVTVDYEQDERPLPPGRLFAQAADGSVILTWTPSVDFDVEGY
FT                   VVYVGDTSGMYFVAGSPIRVGKRLSYTVRGLQNGVLYFFALAAYDGAGEERIGQLSAEA
FT                   WARPLPHLGTADIPSQGG"
FT   gene            277000..277656
FT                   /gene="deoC"
FT                   /locus_tag="TPASS_0264"
FT   CDS_pept        277000..277656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="TPASS_0264"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70691"
FT                   /db_xref="GOA:B2S2L2"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2L2"
FT                   /protein_id="ACD70691.1"
FT                   /translation="MELNAYIDHTLLRPSASEAEVLRLCQEAQHYRFASVCVNPCHVAL
FT                   AAGAVRGTAVRVCSVIGFPFGTHVTEVKCAEAQRALDDGAQELDMVVRIDKVCAGEREV
FT                   VEREIAQVAARCHARGAIVKVIVETALLDEMHIAFACSCVEAGHADFIKTSTGYASRGG
FT                   TEGDIQCFKKYLKGETKIKASGGIRTRAQAQRFIELGCARIGTSNGVAIMEERAS"
FT   gene            complement(278088..279455)
FT                   /gene="braC"
FT                   /locus_tag="TPASS_0265"
FT   CDS_pept        complement(278088..279455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="braC"
FT                   /locus_tag="TPASS_0265"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70692"
FT                   /db_xref="GOA:A0A0H3BK28"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK28"
FT                   /protein_id="ACD70692.1"
FT                   /translation="MIHTHTLSLSFMLFSFFFGAGNLILPPLLGKHAGTTLATALLGFA
FT                   TSAVLIPIAGLITIAHAGGIVPLSERVGKRFAHLYPAITLLVIGPALSIPRAGIVPFAL
FT                   AIAPLIHRANTTLLAQLIYTTCFFIVSYWLCMRPHTLSNTLGKVLTPALLVLVLLLFLA
FT                   SFTPTLGPYLPAQGAYATHIPFSQGFLDGYLTTDALASLMFGNMILTYLHRTRYTTAPF
FT                   PPTPANTLADMRTVAWIAGVMLFFTYGVLAHLGALSARQLPHTVNGAHILASVSRHLFG
FT                   KAGIALLGLIFTIACLTTCAGLLVCVSEYFHKRAPRVSYLCWIRLFTISSFALANTGLE
FT                   RILAYGTPLLMILYPISLVLIGISHLERLIRIPRAAYRLTVWSAGTLSTCAVGTPLVAH
FT                   TRIGHVLNTLIHTLPLAQEQLCWLIPSAAVLILSTAHARLREKTCTPRGTLPLTDN"
FT   gene            279506..279631
FT                   /locus_tag="TPASS_0266"
FT   CDS_pept        279506..279631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK58"
FT                   /protein_id="ACD70693.1"
FT                   /translation="MVRVQRRVLKNFMRVVGVDKGYRLWVEWLSCVCCGYVVRAE"
FT   gene            279779..281273
FT                   /gene="rrs2"
FT                   /locus_tag="TPASS_r0004"
FT   rRNA            279779..281273
FT                   /gene="rrs2"
FT                   /locus_tag="TPASS_r0004"
FT                   /product="16S ribosomal RNA"
FT   gene            281377..281450
FT                   /locus_tag="TPASS_t0015"
FT   tRNA            281377..281450
FT                   /locus_tag="TPASS_t0015"
FT                   /product="tRNA-Ala"
FT                   /note="tRNA-Ala3; codon recognized: GCA"
FT   gene            281567..284467
FT                   /gene="rrl2"
FT                   /locus_tag="TPASS_r0005"
FT   rRNA            281567..284467
FT                   /gene="rrl2"
FT                   /locus_tag="TPASS_r0005"
FT                   /product="23S ribosomal RNA"
FT   gene            284523..284608
FT                   /gene="rrf2"
FT                   /locus_tag="TPASS_r0006"
FT   rRNA            284523..284608
FT                   /gene="rrf2"
FT                   /locus_tag="TPASS_r0006"
FT                   /product="5S ribosomal RNA"
FT   gene            284740..285105
FT                   /locus_tag="TPASS_0267"
FT   CDS_pept        284740..285105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70694"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH3"
FT                   /protein_id="ACD70694.1"
FT                   /translation="MASAHSFDLVDLDDEDYGTILAEDVEFSGTVRFEEPFMVRGVFEG
FT                   SIESSGDLMVEEQARVRAEIVADRVVIKGEVIGNVTAMSVVRVFPCGRLIGDVTAPEVV
FT                   LESGCFFSGVCSMPESG"
FT   gene            285102..285755
FT                   /locus_tag="TPASS_0268"
FT   CDS_pept        285102..285755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70695"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BHZ8"
FT                   /protein_id="ACD70695.1"
FT                   /translation="MIGFPCRRVALLVARFLLPVVFCFVCRGLCSQQSGLAFYRAGSYR
FT                   EAIRCCEEAIAQGSKDLEHYLVLAWALVAVGKYHEAAQWALEGRAVAAHDPRLIEAQAE
FT                   AFCHLGRNEEALRLFQDYIACAPNGARQTAAYYLMGEIYLRTSRFLHADIAFSVALQLD
FT                   SLNDFWWARLGYARERAGDYRYALQAYDRALQLNRDLADARRGRERVLRYVFRR"
FT   gene            285765..287213
FT                   /locus_tag="TPASS_0269"
FT   CDS_pept        285765..287213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70696"
FT                   /db_xref="GOA:A0A0H3BIT1"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIT1"
FT                   /protein_id="ACD70696.1"
FT                   /translation="MFSVRIETLGCRLNHVESESLAALFLQEGFAVCRGNTSTAPVVLC
FT                   VINTCTVTSKAEQKARRLVRLLLRTYPTAIALVTGCYAQLEPASLEAMDDRVLAFPGKQ
FT                   KDALSLLPSCLRALLVQRGPAPIDQYVCGMRALLASLKKKIISLELTSEFPSQTHMPTR
FT                   NALPQLTGVPHAPRVSVSSFSEPTAVPRFALYAPRFLFHSRASIKVQDGCNSGCAFCRI
FT                   RFARGRAVSLETHEVIGRVQALEARGMSEVVLTGVNLSQYRSGSIDFAGLLELIVQETH
FT                   TIHIRISSLYPESVTSAFLRAIAHTRVSPHFHLSVQSGSDRVLRRMRRAYTRADIYQAV
FT                   SDLRSVREEPFLGCDIIVGFPGETEEDFADTQRMCKTLRFAGIHVFPFSARPGTEAFAM
FT                   DAKVPQRIAGERVAAMQQLAEKNYRAYLEYWNGRELCAVVEQSVARVLTENYLSLPIIE
FT                   RGGVAASAGSHVRIRVHNEGAILL"
FT   gene            287287..288723
FT                   /gene="pcnA"
FT                   /locus_tag="TPASS_0270"
FT   CDS_pept        287287..288723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnA"
FT                   /locus_tag="TPASS_0270"
FT                   /product="polynucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70697"
FT                   /db_xref="GOA:A0A0H3BK34"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK34"
FT                   /protein_id="ACD70697.1"
FT                   /translation="MRVFPVCPLLREVSERFIRAGFCIYVVGGAVRDFLLNRSAHDWDL
FT                   ATDAPPERVRMLFRRTVPTGIEHGTVTILFRGHSIECTTFRVESDYSDRRHPDSVCFAA
FT                   RIEDDLARRDFTVNAFAAALPSGEIIDVCGGYADLRNGLICSVGDAHARFSEDALRPLR
FT                   AVRFAAQLSFSIEARTREAIIALRAHTARISRERVRDELSKMLCTPRPSIALRLMEETG
FT                   LLHTLFPALAQVCGRNEGEEKETQDSLQVSPQQRRDARTFAACAFAACDRVPAELAVRL
FT                   AALLFPLAHYRTLPASGTGAALFICPPALAEARELLRGLKYPNYLTAQVCHLVAHARFT
FT                   PHECWSEGTLRRFVVTVGTTQLESLCVLRRAYLADDDYRISAQPGVSCENAREGKKMQE
FT                   QFEIFVTRVRRVAAQLPVHGIRDLAVNGRDLIAQGIPPGPTIGHILNALFDMVLMQPSR
FT                   NTRPQLLEHAQEIVRTMAQN"
FT   gene            complement(288720..289694)
FT                   /gene="parB"
FT                   /locus_tag="TPASS_0271"
FT   CDS_pept        complement(288720..289694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="TPASS_0271"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70698"
FT                   /db_xref="GOA:A0A0H3BK63"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK63"
FT                   /protein_id="ACD70698.1"
FT                   /translation="MGKDKLGKGIDALLQESSDRYDVRDSGGVQTVHYLDPTLLQANPH
FT                   QARRTFAQESLEELAASIREHGVIQPVLAEKNQDGSWVIIAGERRTRAAILAGLNRIPV
FT                   IVRTCDHEKKLAIALIENVQRENLNPLEEARAYQHIMDLGNLSHEELAQRVGKNRSTIT
FT                   NALRLLKLPPEVQQSLSSRTLSAGHARALLSLTDMQLCVSVAQYVVTHALSVRAAEECV
FT                   ACLNRGGSLHDYAGARAHTAASSPSPGGSATDITRLPPSSPSTDAQLDARIRNADIADI
FT                   EQQLLEQLGTKVRISGNLQRGRIEITYFSQAELERLYGLLKAH"
FT   gene            complement(289681..290442)
FT                   /gene="parA"
FT                   /locus_tag="TPASS_0272"
FT   CDS_pept        complement(289681..290442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="TPASS_0272"
FT                   /product="chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70699"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH6"
FT                   /protein_id="ACD70699.1"
FT                   /translation="MGKTLVFVNQKGGVGKTTSAINLGAYLALAGKKTLLVDFDPQGNM
FT                   SSGLGLARGLTVYDLLAGKAHINSVLRTTPVHNLFAIPASIDLSGATVELVDEQDRELY
FT                   LKKILAEVKDTYDFILIDCPPSLGILTLNGLAAANEVFIPLQCEYFALEGLTLLLQTVK
FT                   RVQSGLNTALSIGGIFFTMYDTRTKLAQEVVKQVTTYFGDKVFNTIIPRNVKLSEAPSH
FT                   GLPISSYDAQCAGARSYEKLAREIVARDGQR"
FT   gene            290575..291366
FT                   /locus_tag="TPASS_0273"
FT   CDS_pept        290575..291366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70700"
FT                   /db_xref="GOA:A0A0H3BI02"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI02"
FT                   /protein_id="ACD70700.1"
FT                   /translation="MLPYAEVILFLIKKHCIDCGEAFFGIVVLNALCLAGVGYSLLWHQ
FT                   GPGRSVLFVLVLATLYACLCAFCVVRGERGCDTLADTNLRVFTHALREVWLQSLWCALL
FT                   QCVLFRTGKYVCTYYFARTHSVFTACGILSAWTYALACGALLWFVPVRARYRTHFRQCV
FT                   YLSARVFFEHPCITFLMVLYSMGVLALSVPMAFLFPGPCGIVLLWQDVLRTLCFRRAWL
FT                   AAHEGRKAACAPPIPWEQLMCQMRAQSRAHTVGELFSPWKS"
FT   gene            complement(291404..291904)
FT                   /locus_tag="TPASS_0274"
FT   CDS_pept        complement(291404..291904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0274"
FT                   /product="possible deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70701"
FT                   /db_xref="GOA:A0A0H3BIT5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIT5"
FT                   /protein_id="ACD70701.1"
FT                   /translation="MGQREELVTRPSWDEYFMEVCHAIAKRATCDRGRAGCVIARDHHL
FT                   LVTGYAGAPRGLLHCDEHGHQLRTVQHEDGTCTQHCVRTVHAEQNALCQAARLGIGLEG
FT                   ATLYCTMTPCRTCAMLIINCGIVRVVAEKRYQTATESIMLFAQAQIALEHIYQNPAEYG
FT                   TPS"
FT   gene            complement(291993..292742)
FT                   /locus_tag="TPASS_0275"
FT   CDS_pept        complement(291993..292742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0275"
FT                   /product="possible UDP-N-acetyl-D-mannosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70702"
FT                   /db_xref="GOA:A0A0H3BK39"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK39"
FT                   /protein_id="ACD70702.1"
FT                   /translation="MEQTQLVTRIEFLSVPLDVVREEYLCTVILSLLEKKEPQHIIFLS
FT                   LWDVLKARHNHEFRTMVGRAALCLPTSYSIVRGARFLGLPTPIFRHPFQFIITLLNVMD
FT                   THYKSLYLFGGRGQSLLEAERNVHSTFPGLSVVGRFHGFYRKTLENNIITAIVKSNASL
FT                   VIVGNGVPGGVRWIARNRAHFAGGIFVQDSEVIDIFSKRRKRPRAKELLHGRSPWGQTL
FT                   HPLRWHRSVRYVWYIFLLLFYRIFRTK"
FT   gene            complement(292721..293605)
FT                   /locus_tag="TPASS_0276"
FT   CDS_pept        complement(292721..293605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70703"
FT                   /db_xref="GOA:A0A0H3BK65"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK65"
FT                   /protein_id="ACD70703.1"
FT                   /translation="MVLSHSVRRAQRVDIMKQLLITAEPDSGGYVQLSGKDFHYMVRVR
FT                   RARVGDTFTLRTQAGAQYSAVVSALDIHTRSLILHCTPMPPVDEKTQVTLVLLQWMPRA
FT                   RVFDAIVRHATELGTARIIPIRGERSLIRDEKDTQHARLQRIVREARQQSGSAVNTRVD
FT                   TLHSLLGALHMLEQEFPYPSAVRIYCSEKHVGGSFHELLWTGRSTHCTAHRTPTEPNAP
FT                   HNTPDVRAQAVILAVGAEGGFSDTEERTLHDAHFAPLHFRTNVLRVETAALYALAGAHL
FT                   LLSEAALWNKRSW"
FT   gene            complement(293778..295124)
FT                   /gene="ctp"
FT                   /locus_tag="TPASS_0277"
FT   CDS_pept        complement(293778..295124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctp"
FT                   /locus_tag="TPASS_0277"
FT                   /product="carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70704"
FT                   /db_xref="GOA:A0A0H3BIH9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH9"
FT                   /protein_id="ACD70704.1"
FT                   /translation="MQTVQDVYEFLRKYYVDEVDPHILYKGALEGMINSLQDPYTTFVE
FT                   SDSISGVNLQDTTKGFFGGIGVVISKSRTSTPGKPAYVEVTAAIEDTPSWKGGIRPRDL
FT                   IVKIGTMSTDTMTMDEVLKKLRGPIGTKVTLVVKRGTKIFRPFTLTRAKIEIPTVKYAK
FT                   IDPNIAYVRLIEFNPVTATRMVETVTELRRQGCDRLILDLRNNPGGLITAAVDVTSSFI
FT                   PSGTVVTTKSRVQGHSITFSVNARAQKLPPSMPVIVLINRDSASASEIVSGALKDHKRA
FT                   YLVGQTTYGKGVVQQVFDLNERESLKMTISRYYTPSDANIDKSGIPPDLEVRETEFTPE
FT                   EEEALVSLFKSEKVKLFAEQNRTMNSERIKQYARGLAREFKLRSILVEKLIAQEYHRHN
FT                   ASFVYDLEYDEQLRKAVELIRTQDIHALVARTKTVKELQEGIQEKKKVS"
FT   gene            295252..295380
FT                   /locus_tag="TPASS_0278"
FT   CDS_pept        295252..295380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70705"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI07"
FT                   /protein_id="ACD70705.1"
FT                   /translation="MRARLCQESALDSFLSMRLDGGGHWGRCRRAPDPLWEEQDIA"
FT   gene            295426..298017
FT                   /gene="rpsA"
FT                   /locus_tag="TPASS_0279"
FT   CDS_pept        295426..298017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="TPASS_0279"
FT                   /product="ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70706"
FT                   /db_xref="GOA:A0A0H3BIU0"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIU0"
FT                   /protein_id="ACD70706.1"
FT                   /translation="MHGGGERERSFVHPRTRCVAVRARTVLQCRPMGTVIIALDGPAGS
FT                   GKSSVCRLLASRLGAQCLNTGSFYRAFTLAALRRVSELAVQACSPSPDPDAAVGCAAVP
FT                   HATNLDTSYAPLTAQKKVALFDEAYWVSFARTVALSYRAGVMYVGEENVESLLRSDEVE
FT                   SAVSYFAAMPAIRAIMTGKIRSAVCGARVVCEGRDLTTVVFVDADLKCYLDASIEARVA
FT                   RRWAQGTSRLSKQELEQRMRARDAHDRARTVGGLRCAPDALYVDTSCLTIEEVCERIAR
FT                   EAHRRALWGGERSVENQEGKGTPLVPRQLQERYSFEAPEPGSVRMGTVVQVNAGTVFVD
FT                   IGGKSEGRVPVEEFEAPPKAGDGVRVYVERVTPYGPELSKTKADRLGLKVKLRDAERDG
FT                   TPVEGRIVRLTEKKSGFEVDLGAGMMAFLPISQSDCQKVDAPESLIGLTSKFYIERISQ
FT                   SKQHRGNDNIVINRRRYLEERARQAREEFFNSVHIEDSVSGVVKSFTSFGAFIDLGGFD
FT                   GLLHVNDMSWGHVARPREFVKKGQTIELKVIRLDQAEKRINLSLKHFQPDPWLEFENKF
FT                   GVNDVVKGRVTKIADFGAFIELAEGIEGLAHISEFSWVKKTSKPSDMVKIGDEVECMIL
FT                   GYDIQAGRVSLGLKQVTANPWEEIEARYPVGARFTRRIVKVTNAGAFIEMEEGIDGFLH
FT                   VDDLSWVKRTRPADHELEVGKEIECMVIECDPQARRIRLGVKQLSDNPWQVFANAYGVG
FT                   STVEGEVSSVTDFGIFVRVPGGVEGLVRKQHLVENRDGDPGEALRKYAVGDRVKAVIVD
FT                   MNVKDRKVAFSVRDYQRKVQRDELSRYMSAPRGEDEGSFTLGDLMRQTSGK"
FT   gene            298014..298142
FT                   /locus_tag="TPASS_0280"
FT   CDS_pept        298014..298142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70707"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK44"
FT                   /protein_id="ACD70707.1"
FT                   /translation="MSGSVCCACDTRFFRAQWVDCGFGGSSSVVVGASPQGLLRVR"
FT   gene            298159..298287
FT                   /locus_tag="TPASS_0281"
FT   CDS_pept        298159..298287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70708"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK72"
FT                   /protein_id="ACD70708.1"
FT                   /translation="MYLAVVPVCCSFPWAGVGLRCSRLSVRVLELSDSVRGGGIHA"
FT   gene            298280..298999
FT                   /locus_tag="TPASS_0282"
FT   CDS_pept        298280..298999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70709"
FT                   /db_xref="GOA:A0A0H3BII3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BII3"
FT                   /protein_id="ACD70709.1"
FT                   /translation="MHEQRRGIVRVDRFLELHRRLLVGVLVAILGGLGLSAGCLLVMTR
FT                   LRARASAEVTRIAREWDVLRKPDNTVSASGHEVEGRGGSSIRAKEDALLARLESCASSP
FT                   WRDGFAYAYAQACVADIFFARKEWEKAQQAYVRAAYGARRSYVAGVYYFNAASCADERG
FT                   RFEEARELYQRSARVQDFPLVPRALFNVGRMEEALGRAAAATAAYMQLYERFPLNGWAA
FT                   LGKSRAIAISVGGGRAQ"
FT   gene            299177..299656
FT                   /gene="kdtB"
FT                   /locus_tag="TPASS_0283"
FT   CDS_pept        299177..299656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="TPASS_0283"
FT                   /product="lipopolysaccharide core biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70710"
FT                   /db_xref="GOA:B2S2N1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2N1"
FT                   /protein_id="ACD70710.1"
FT                   /translation="MKAIFAGSFDPPTFGHLDLVLRARSLFAEVHVLVAVNVQKRYLLS
FT                   ECERVDLMRQVLGDRPGVYVFPWRSLVVTYARDVGARVLVRGVRNATDFCQEFDLAWVH
FT                   RALDAGLETVFLAAKPCYAALRSSMVREVASFGGDVSTFVPRVVARLLQEKFTQA"
FT   gene            299761..300420
FT                   /locus_tag="TPASS_0284"
FT   CDS_pept        299761..300420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI13"
FT                   /protein_id="ACD70711.1"
FT                   /translation="MRADKGAVGTVAVVCAFDLSDYAFVPLCGTREQSCMKAVPGFVPC
FT                   VEVRGCESTAGVGRRCAFERAVTAAYALPGCHQVCVYADAASAAKVARFMQCATPIFPS
FT                   LRVNVLDDMRVSAFFAHVARVCAEYAQLGEEPEAVFVLRADAPFIDSVASAQLYAQHRE
FT                   YLAEYSFADGYPEGLFAAVVAPGLFPILATLTQDAHICFALRSFLRALKQTLILLI"
FT   gene            300360..301439
FT                   /locus_tag="TPASS_0285"
FT   CDS_pept        300360..301439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70712"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027608"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIU5"
FT                   /protein_id="ACD70712.1"
FT                   /translation="MFCTSFIFESIKTDINSFDLETMIAPVDVRHLRLEFYTSSKAQFL
FT                   QCAAFTDITAENYAQLISAREHALRTVPAYYALELTRAYPLSSLYRPVSFPAQVENASL
FT                   MPKEEACALIRRIADFSERAVISLSVFGDPVLYPALCDVVREILKYPGLSVLIETSGLG
FT                   WQESVVRDLCECARNSARTPFAIGWIVFLDAVSSGMYSQVHRVSLSEAEFFLKEATEFA
FT                   MQVHAQCPGVLWPQIFRMNENEKELEPFYRTWKERVGQVIVQKYDHVCGLLPDRRVADL
FT                   SPLERYPCWHLKRDMIIFTDGRVPLCKEDVHCRHALGNAFQQDLAQIWRRGQDVYLQHV
FT                   RAVHEGLCGQCDEYYTYNF"
FT   gene            301411..301776
FT                   /locus_tag="TPASS_0286"
FT   CDS_pept        301411..301776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK48"
FT                   /protein_id="ACD70713.1"
FT                   /translation="MMSTIPIIFNEKNVAHTVVGGQLCPVASAFLGAVVLNRGVRWNRA
FT                   EFFAQLTTLGIAPIVSVERSAAAPDVTGLAERFPFVKFITPLECISVGEMINLGVAELD
FT                   VMYVLVLWSDMRIDPQV"
FT   gene            301743..302366
FT                   /locus_tag="TPASS_0287"
FT   CDS_pept        301743..302366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK76"
FT                   /protein_id="ACD70714.1"
FT                   /translation="MERHAHRSAGMSQHIQDILRTNTHMCIAPQLCSSHSTVLPTQIVP
FT                   ALRKSDFFTQPTECTTNHTPTIYPYDFVGIYHRDRFIQCGGFDFTIANAYWQNLDFGLR
FT                   SYLWGECIEVNTQIRLFYEALPPQEDASADSSYRIFYLKNLAPLLEKDRAFISGTQFFS
FT                   FFRNSGLHLIEAYRLFRDAQKWVAVNRYRFKKTAARLVSEWEPR"
FT   gene            302366..303313
FT                   /gene="spsF"
FT                   /locus_tag="TPASS_0288"
FT   CDS_pept        302366..303313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsF"
FT                   /locus_tag="TPASS_0288"
FT                   /product="spore coat polysaccharide biosynthesis protein F"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70715"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BII6"
FT                   /protein_id="ACD70715.1"
FT                   /translation="MEQDRSGVAVIVQARVDSTRLPGKALLPLMGEPLIHYVLQATRVI
FT                   PAETYILACDEHSKKDFEPVARAHGFYCISGSAEDVLHRFCIAVKAFEHSFPIRTVVRV
FT                   TGDNPFLFHEAAAAALLRYAELDEPDYFTFTGLPYGSGVEILKARSLLLADRLPLEAYD
FT                   REHVGPALHRRPGIFVCVREPAAAAWYHPDVRVTVDTQEDFQRAQHMMEYVCTLQCPFP
FT                   LSSDVILDAYAYARQVVVFVPSVKIGQGAGHLYRAAYLVLRLQGRVRCCLYVPDRSLLC
FT                   KLSTPFPEELIVDTVPADASLIVVDNFRTCYVRD"
FT   gene            303336..304940
FT                   /locus_tag="TPASS_0289"
FT   CDS_pept        303336..304940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70716"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI18"
FT                   /protein_id="ACD70716.1"
FT                   /translation="MLALDEGGSGRLNADYLIDVFPVLQSPGRRSLAALTNVRDSAFIP
FT                   LPETRKEQDLPVANGRFFPIPGVTTVLVVYGAEDTHGRARSCAERIAALGFDTSVVVPG
FT                   EASERTDGKVHIYPSLPHLKEHLHRWDVVVTHFGFTAFEAAAAGAAVLLVSPTPYHFLL
FT                   SSAVGFSVIRSADPAAHELWSQMQQGIIIPDVVTRHSQCRDLADEIMRVARGKKHCCPF
FT                   CGEMVAVDVVGRALHKTFQRCNECDMIFLSFVISDPVRYSESYFFEEYKAQYGKTYLED
FT                   FDQIRMHGARRMEEIERLYAEVFCADEGNSFAVDKKVLDVGCAYGAFLSAAKAAGWNAV
FT                   GVDVCEFAVRHVRDTLCIPACVATFPLLPECFDFVIRHSFATNRPQQVSVYIRECTFSA
FT                   VTLWFVIEHFQDLEAVLRKVADLLVPGGILAFSTPNFAGVTGMRFPHLFFAQSPCDHFT
FT                   IWDARTVKKQLLRYGFTVKKIVVTGHHPERFYPHKHLKSGGLKWKMLMALSKWFQLGDT
FT                   MEVYAIKQGDAHGSASK"
FT   gene            304995..305828
FT                   /locus_tag="TPASS_0290"
FT   CDS_pept        304995..305828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70717"
FT                   /db_xref="GOA:A0A0H3BIV0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIV0"
FT                   /protein_id="ACD70717.1"
FT                   /translation="MSGAQVRLVVTDMDGTFLDSENNIPPENKQAVKCLHEKNIPFVIA
FT                   TGRMLPMVQEYVRQLQLVGPVVGYNGGMIREIKTGKTIFQKCFAAEAFARVLEYGMAHR
FT                   LDYLVYTSDSVYAPDYSVRIRAFHEYNRLARRGGSALIPIFPIEALSGDRQRQVMKILV
FT                   QNFSPSDLETAAEFIGSLHGVHCEHSMPHLIDVMPEGVDKGNALHILCQYYGISLEQVC
FT                   VFGDQRNDIVMFKAAGVSFCMRNGHEEAKKHATYIAESNDDAGFAQALKRYGVVE"
FT   gene            305865..306746
FT                   /locus_tag="TPASS_0291"
FT   CDS_pept        305865..306746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70718"
FT                   /db_xref="GOA:A0A0H3BK53"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK53"
FT                   /protein_id="ACD70718.1"
FT                   /translation="MVRSARSEYKCRLCARCDGYGCRGQLPGMGGVFNSANFIANCLAW
FT                   KKYVPQRHELPVVRLAPMTGAVENVGYPDEVSFYYRLIEAVSGTGVLLSVGDGCPDIKL
FT                   QSGIAALRSFKKKAAVFIKPYVNKKIFERIEWGRDVAEFVGVDIDAYHIVTMRDKVQLE
FT                   KKTPTHLRAVRRFAKLPIVVKGIFAPRDVELVRELKPDVAIVSNHGGRVETARGSTADF
FT                   LFEYGGELARCAGEVWVDGGIRSYAHLCAARELGAQQVLIGRPFITALLKGGKGGVQLL
FT                   VRNMTDRSVRCV"
FT   gene            306737..307990
FT                   /gene="tpn50"
FT                   /locus_tag="TPASS_0292"
FT   CDS_pept        306737..307990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpn50"
FT                   /locus_tag="TPASS_0292"
FT                   /product="outer membrane protein TpN50"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70719"
FT                   /db_xref="GOA:A0A0H3BK81"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK81"
FT                   /protein_id="ACD70719.1"
FT                   /translation="MCMMGSVFSRKGMLCVLAVWCAASAAYPLRLRYKFRKGDTHRINS
FT                   LIREDVFVNDTLAHTAEITNRITVHVSEVRVAHGSAPDAARYVCHFMTSEKSPNNTFRW
FT                   GRHYESIFWRDAFGVYDIDRSFFMPVVRNVPVFPDYDIEVGDTWEHEAEEAHDLRDGFG
FT                   IQTPFIVPFTVSYTYRGEVQRGSRRYHHITAAYSMSYESPKRTHGVQRNAKEGMYPVRT
FT                   TGVSKQNLYWDNELGNIAEYDDEFRILLYLSGGTVLRYQGTATAKNFAPERFDPARTVV
FT                   ELQETLKDLHMPDAKVRETEEGVTISIENVQFDADSASLAPSEYEKLRKIAELLRAFPD
FT                   RELLVSGHAARRGSVQDQQRISEERADVVARYLQELGVVDAAHVYTRGCGAQQSIAPND
FT                   SEDGRRKNRRVEITIISK"
FT   gene            308002..308178
FT                   /locus_tag="TPASS_0293"
FT   CDS_pept        308002..308178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIJ0"
FT                   /protein_id="ACD70720.1"
FT                   /translation="MRMTRVRSLCLAYARCVRLGVFRCISLRGWAPYRAVETVLVQSAL
FT                   TSVERLHEMFRVY"
FT   gene            308156..309421
FT                   /gene="prs"
FT                   /locus_tag="TPASS_0294"
FT   CDS_pept        308156..309421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="TPASS_0294"
FT                   /product="phosphoribosyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70721"
FT                   /db_xref="GOA:A0A0H3BI25"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI25"
FT                   /protein_id="ACD70721.1"
FT                   /translation="MRCSGFTDLAIVACPGGEHFADETIKHLTRVCERKFHQRMDRLTD
FT                   RYGLDSGSVIRDANFYRDLFSTELCAHDDVRRFNPPHFKVDAQFICFLNGELKTQINEC
FT                   IRGKDVFIFQDVENHQPVLVNNGKSKKIFSVNDHVMMLIVTIDAVRHAGAGRVTLVLPT
FT                   YPYSRQHKKCGREGLTAGLLGSVYEYLGVSHIVTLDLHSREIENAFHRTRLENLHASYQ
FT                   IIRELAKIENLSDPDIPFVVVAPDSGAVERNKFYSSGLKKPLAMIYKVRDYSVVAQNAK
FT                   QSNIVEINLLGDVEGKTAFIADDMLGSGGTMLKAMEFLKSRGAKQVIAAVSLPFFTGNA
FT                   LELFDEAYEKRYFSRIIGTNAVFHTQLSHKQWYTETDVSGLFARVIARIHHNQSLSSLL
FT                   DDRSIIERLLHARLSVAGTPRA"
FT   gene            309440..310684
FT                   /gene="xylB"
FT                   /locus_tag="TPASS_0295"
FT   CDS_pept        309440..310684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="TPASS_0295"
FT                   /product="carhohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70722"
FT                   /db_xref="GOA:A0A0H3BIV4"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIV4"
FT                   /protein_id="ACD70722.1"
FT                   /translation="MGSGIFVADIGTSSLKAAIISQDGKVLQYQRVFFPQPVKAQDWVR
FT                   SFFTVFERLRAVHHVIAITISGNGPSVVAVHKKSHAEDQLILWNQAGASDPRCGVSLFL
FT                   PKVLLLLQRLHFCARDVQFFLSSHEYLIYRLTGCAVTVLPERRYMPTYWTSESLRACAL
FT                   PETLFAPFVAPGSIVASYRGIPVVCGAPDFAAALIGTNTLHAGSGCDRAGSSEGLNVCV
FT                   RLPPAIRSADARVRVLPSLRADFWNVSFLIADSGSRFASYMRRTHAQGFGERMGQIMAL
FT                   PFQLHDAYPPTVVGEGRQLVEDLAFEVCAGLEYLESVTQLQPVYTVSGGQAKDSRWLQL
FT                   KADVSGRCFVLPEIHDAELTGNAALACVALDFDADMQTAAQRLCRLKREFIPNRARHEQ
FT                   YAQKRLLRAAREAQG"
FT   gene            310770..311405
FT                   /locus_tag="TPASS_0296"
FT   CDS_pept        310770..311405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70723"
FT                   /db_xref="GOA:A0A0H3BK59"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK59"
FT                   /protein_id="ACD70723.1"
FT                   /translation="MREFCPLIGVIGRSGAGKNVVSRLLAERGCYCIDADARTRELLES
FT                   YGDSIVERFQVAAAARGLSLRRKDGGLHSAHLGVLLFSEPKLLQQHEEFLLPKVTRLLC
FT                   EDIARAQAARPKAIVLNAPTLHKTELLQACSFVLYIWAPSILRMWRCKKRERVSFTHLL
FT                   RRFSAQKGFYAQSIAQNADTYTVANCGRVASLARKVDCILTRRGVLGE"
FT   gene            311369..312181
FT                   /locus_tag="TPASS_0297"
FT   CDS_pept        311369..312181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70724"
FT                   /db_xref="GOA:A0A0H3BK88"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK88"
FT                   /protein_id="ACD70724.1"
FT                   /translation="MHSDAQGCFRRVNMEQKRILWIVISLSVFMLIIFGVALLLYSPTY
FT                   SSNSAGVTDVSSYVERGDVPEHPSVDPSLWLKNPEKIPELGKTPAPTQRAIPDLTVVKD
FT                   VPTARAKSLDVSPPARAERTDAAQDRKTSPASDTRESAESKGASKHARSDRASAKSPPA
FT                   TRTRAPLVAQRDARVRGASTQPAAPSVLFWVQAASLSSKLNAERARGVLAARHMKAEIF
FT                   TKRTGAGLRHRVRVGPFTNRTEAVYSMKSIREIAEFSGCYVFQERVKN"
FT   gene            312314..313345
FT                   /gene="tpn38b"
FT                   /locus_tag="TPASS_0298"
FT   CDS_pept        312314..313345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpn38b"
FT                   /locus_tag="TPASS_0298"
FT                   /product="exported protein TpN38b"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70725"
FT                   /db_xref="GOA:A0A0H3BIJ4"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIJ4"
FT                   /protein_id="ACD70725.1"
FT                   /translation="MNGAVCVLSALIAVFTCFSCRPAVQDERAVRIAVFVPGFRHDSPV
FT                   YAMLCDGVERAVTQERATGRSIGLDIIEAGPNQALWREKLAHLAAEQRYRLIVSSNPAL
FT                   PHVLEPILRQFPLQRFLVLDAYAPQEHSLITFRYNQWEQAYLAGHLSALVSASAMRFAN
FT                   ADKKIGLIAGQSYPVMTQTIIPAFLAGARAVDPAFEVDVRVVGNWYDAAKSADLARILF
FT                   HEGVDVMMPICGGANQGVLAAARELGFYVSWFDDNGYARAPGYVVGSSVMEQERLAYEQ
FT                   TLRCIRGELPSAGAWTLGVKDGYVRFIEEDPLYLQTVPEPIRVRQSALLRRIQSGELTL
FT                   PVR"
FT   gene            313342..313566
FT                   /locus_tag="TPASS_0299"
FT   CDS_pept        313342..313566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI30"
FT                   /protein_id="ACD70726.1"
FT                   /translation="MMIAERGVRASARGVLSLHHIGKTYPRVMPRSKRGVWGMFGHPGR
FT                   RAVDDAHTAHGPCSGARETDALSTACSAM"
FT   gene            313551..315101
FT                   /gene="rbsA1"
FT                   /locus_tag="TPASS_0300"
FT   CDS_pept        313551..315101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA1"
FT                   /locus_tag="TPASS_0300"
FT                   /product="ribose/galactose ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70727"
FT                   /db_xref="GOA:A0A0H3BIW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIW0"
FT                   /protein_id="ACD70727.1"
FT                   /translation="MLSDVNLSFFTGEIHALLGKNGAGKSTLAHILSGFCVPTHGQLRL
FT                   DGKEQRFSVPFDALRAGIGIVHQQPVFAERATVFENVVMGSAALTGVRWVRRAQVRERI
FT                   DRIIAQWRMPLKKEEYVACLSADKRFFVSLLCVLFRNPRFIILDEPRCAPAQSRAVFFS
FT                   HLEEFFVRSSHAPRCGGGVIVVTHRFADALRWAQRISLIEGGKACSFLRTDLLDEYCSA
FT                   HQVNECIQKVSCALMSASTVTSSAVSSFSSLSDTQSCATVPRTSSARPWVLRVESLQVS
FT                   KHADVPLTDISFSVAASAIIGIVGTPEDGVHVLEDILCGMHAGASRTHCTGNILLQEHD
FT                   QVWCLPLQRNTPSLLRAHGVACVPSNCIQRGASMQLTLFDLLVPYTLRTWRTRVRAQMR
FT                   FVARLLAEEEIYCDPLQPACTLSGGQLQRVILARELATRPRLLILAEPAEGLDSASEQR
FT                   LLARLRQVAQAGTALVLLAREQHQAQWRALCTERFLLRAGTLCAEVSGTPSPSQDSHT"
FT   gene            315098..316231
FT                   /locus_tag="TPASS_0301"
FT   CDS_pept        315098..316231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0301"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70728"
FT                   /db_xref="GOA:A0A0H3BK61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK61"
FT                   /protein_id="ACD70728.1"
FT                   /translation="MKRVINSCIAVLLGVAVMSAVIVLCSENPSVSLAAFFLKPFSTRG
FT                   YIRALFHKAGLFVCMALGASCALKTGMINLGGDGQIYAAGFVTALLLREYWGVGFLLQW
FT                   SVALLCALSVAGILACVSGILKAWLATSEMITSFLLSTACVPLIDALIITVTRDPAGNL
FT                   LATAPVHSHFILQQQTSLFGVPAVLTYASLVALAVGCFFSYTRVGYQFRICGKAPEFGR
FT                   FVGFPVWATYVWGMVLSGALFGLTGFFSVVGLFGTCYVGFSVGMGYAALAHALIAHAHI
FT                   TVLVPLAFFFAWMETASEAAVLGAHLTVNVVLFLQAAIFLLISAQWSAPWNAVRRGARR
FT                   VYRFLVTVFCFRGEKHRTRRRHALSVHDTHHRRSRWE"
FT   gene            316222..317163
FT                   /locus_tag="TPASS_0302"
FT   CDS_pept        316222..317163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0302"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70729"
FT                   /db_xref="GOA:A0A0H3BK91"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK91"
FT                   /protein_id="ACD70729.1"
FT                   /translation="MGVIGTTVIAILHRAAPLACAAAGALATEYAGVLGIFMEGVITFS
FT                   SFCIAFFALVWGSYWGGLGITVCVVPLCLFFVAVGTERMRANPFLTGIAVHFSAMGMSA
FT                   FGASSMFARAAASAMQMDTAAHGVSFTHVSLAHTRVLPHPLWGTAVAFALVWVFHLYLY
FT                   STNVGINFMHSGEGALALQVRGTDAARYRMVSWAVAGVCAVCAGGLLVLRVGTYTPQMA
FT                   AGRGWTALAIVFLARKRMMWCVPAAIFFSGIEHMCDVLQGTHVVPTGVLFALPYILSLV
FT                   VFVCTRRTSPCRRGERRRSRLLFAYLQRVTCA"
FT   gene            complement(317150..319096)
FT                   /gene="mutL"
FT                   /locus_tag="TPASS_0303"
FT   CDS_pept        complement(317150..319096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="TPASS_0303"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70730"
FT                   /db_xref="GOA:A0A0H3BIJ7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIJ7"
FT                   /protein_id="ACD70730.1"
FT                   /translation="MACAKRATGAALRQNAGAGCLRSGKGFSMHETSYKPIHRLSPDTA
FT                   KKIAAGEVIERPASVVRELLENALDAGATKIHLEINAGGCALIRVSDNGHGMSPQDLLL
FT                   CAEAHTTSKISSADDLLQLRTLGFRGEALASIAAVSRLHLTSTRSGPLAWHYQPKAAGT
FT                   AAHVPPVPQGTEAGVLEPASLERGTVVRVEQLFENFPARKRFLGRQSAETTLCRSALID
FT                   VSLAHHPVEFRFTVDGTHKLTLLSQQTRKDRCLETQMLKGDPALFHTIEGGDCSFHFHL
FT                   VLSEPAICRRERRGIFTFVNGRRIFDYGLVQALVLGSEGYFPNGTFPVACLFLTVNSER
FT                   IDFNIHPAKKEVHLQDYAHIRHTLSRSVAHFYRQCTIAHYVRAEPAHAPATQGNAPTHS
FT                   SPPCTGVREEPAAPCAHTPRYESLFPLPVQHAHLLPPSPPHISCEHARDCTHPAPAAEG
FT                   DAPVHNHTHTGAFKVLGQVAGTFIAVERNNALYLIDQHAAHERIIFDTLQRNLGTAQIL
FT                   LIPYHIHPRSDEEARIMHRACTELSPAGFRFHEEPDGSWHVTAVPLHWRGSEEQLAHDI
FT                   LYSGKNAHDILRHVLATCACRSACKDGTILDDATLHSLVEQAFALPQSRCPHGRPIWIV
FT                   IGRDELFKRIKRT"
FT   gene            complement(319109..322225)
FT                   /locus_tag="TPASS_0304"
FT   CDS_pept        complement(319109..322225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI34"
FT                   /protein_id="ACD70731.1"
FT                   /translation="MAPAAIPLPSEETTPPVIKIKAGSIRHECSVSMRFLKGSTLPLPC
FT                   ACRVDCPIGLHRTLLSNTMGPMNARAALALAMVFTFQRLCAEERFVISTEYFDIIYTEA
FT                   STESARILAKHADRYEEQISLMLNRVPDKKKRTTVVLYAHTQDAGGSFSSKPSRKIIIN
FT                   DTRVPNLGLGSFKDSLLSIFYHELTHKISLDFFMPLLPPLFTEGVAVAFESNDGTQGRL
FT                   HDPLTMHYLIQNKLENVSPSWREVAELRYNYPHGMPYVYGGKFTEYLQKIYGKERCARL
FT                   WQNSWRLFIRHRFWDVFQKNLGTAWNEFIDSIPIPEKVAQPQLLSEREAQGHYGARSAA
FT                   PTGFAYYDRDRHAVRFRDKAGGVRTLFSHDNTLHHLNFSEDGRYLAVSDTIDTWSERTH
FT                   RVRVFDTHSGSFSPEVYTGASEACFVGNGQKIVFVRVQGQYSRLTLKDRTDPTFEKVLY
FT                   EAGPGLPFGALYAPAYAGDGTVAIIGARGMERNLLFIPVDDRPMMQIPREQMPHAMREL
FT                   QSQKIKGSWTLTFSWANMNMLSRLGFYDVSRHTFRLMDQDVSGGVFAPVVYEALPAAVH
FT                   EESAAEATIRGEEPVVRVAYTGRHRMHMSQYQRDDRALRERRVSLVPLHPAEAEEQSRP
FT                   ATLMVNGEFIADVHEADRGRRYRAAQWMWPPTFSPRFVPPNSFSLKDLGHTGLGVNMKF
FT                   ADPFGLVEVNLQSVSHFYPFFTSLGLKSSFYVGKTTYALRAYHEIDTGGFRYTKLGGAF
FT                   ETLTNFPMQDDRNAFFVRTAVGVDSYSCLCANGGGNGNCCGNNGGQQCCACNGQGANGP
FT                   HYYKSLESPFIQAQVEMGYSFSQRAERTGTNWFVADVTGVSLKLHVANSFDTGKTKDAV
FT                   LVQTKGSFRLPVVPLRVGVSAYVGYNAGWRGGKGNILAEHPVYGFPGPTYLPKLAGVGG
FT                   MEGSCKKSKSAGFGAEAVLTILDYDISIYDPYLPVFYRNIVWNVSCEYVLNAPDFSSPK
FT                   HLCVASTSLVLEFDLADVKVRAGVQYGFQLAETQSATTPGFSPIFSMAL"
FT   gene            322152..323885
FT                   /gene="pyrG"
FT                   /locus_tag="TPASS_0305"
FT   CDS_pept        322152..323885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="TPASS_0305"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70732"
FT                   /db_xref="GOA:B2S2Q3"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2Q3"
FT                   /protein_id="ACD70732.1"
FT                   /translation="MDPAFIFITGGVVSSLGKGIAAGAIGLLLKSRGISVVNQKFDPYL
FT                   NGDPGTMNPYQHGEVFVTQDGGETDLDLGHYERFTDVPSSRFNSTTAGSVYRAILDRER
FT                   AGGYGGATVQVIPHVTDEIQARIRAAAATTGARVVITEIGGTVGDIESLPFIEAIRQIR
FT                   RVLGKERCLFIHLGLVPYLPSCGEMKTKPLQHSVKELLGLGVQPDVILCRSERHITDAV
FT                   REKLSLFCNVERRAIVENVTARSIYEVPLLLEAEGLGALLCERLRLFDTCCGGQVARNL
FT                   GAGGAQSAVLGAGGTVRTDGGLHPAAGQGAEPDLTAWRAMVRALYYPRRELTVALVGKY
FT                   VSLADAYLSVSEALTAAGICHRARVDMRWIDAEEICSVQDAGHALADADALVIPGGFGV
FT                   RGIEGMICAVSHARVQNLPYLGICLGMQIAVIEFARNVLLLASAHSREFAVDTPHPVVD
FT                   LLPGCVDTPTGGSLRLGQYRCLLAEGSRARALYGRGEVWERHRHRYGLNAAYRARFEAS
FT                   ALRPVGVDSDCGAVEVVEHGEHPWFFGVQFHPEFCSRPNRAHPLFRALVAAGLERKDSR
FT                   S"
FT   gene            324050..324664
FT                   /gene="rpsD"
FT                   /locus_tag="TPASS_0306"
FT   CDS_pept        324050..324664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="TPASS_0306"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70733"
FT                   /db_xref="GOA:B2S2Q4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2Q4"
FT                   /protein_id="ACD70733.1"
FT                   /translation="MAVKRARGKIVRRLGINIFGNPKYTRLLGKKPAPPGKEHGVKQRA
FT                   KVSVYGEQLKEKQKFRFAYGMSERQFRNLFAQAHRMKGVTGNNMLSLMERRLDNTVFRM
FT                   GFAISRVQARQMVSHRYFLINGKTANIPSMRISAHDVITTKNRKGIHSIIRHNLTLSQG
FT                   QRGSWLNVDEEQLSATVSELPRAQDIHPVGNIQHIVEYYSR"
FT   gene            324751..325779
FT                   /locus_tag="TPASS_0307"
FT   CDS_pept        324751..325779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70734"
FT                   /db_xref="GOA:A0A0H3BIW5"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIW5"
FT                   /protein_id="ACD70734.1"
FT                   /translation="MDDGPLRVVVLTSFVILVVVCAVALCTFFVFLKSPDQVMTPHIVG
FT                   KDFVSAAIEMQAKELYPRVQLRFSTREKPGVVLEQNPPAGAIVKAGRYVDLVVSQQAVT
FT                   THVEDYRGLQVEEAVARIAAAEVERRISVKTPHLYRFSTGAAGTILEQDPAPGAVLSAD
FT                   VELRFVVSKGSEREQTTVPLLVGYSLPELYRVMAQTALTLQFTVSPPSPSGERKDGEAR
FT                   GRTRANAQDYARVSAQDHDPGSRVEAFRAMQVQVLFPERGEAHEIYGILALDLPRYPYP
FT                   MSCVLDVQYPGGVRTALAMFQHPGGRFTIPYGLPAGATLFLTVGGKELFSGEVGALPHA
FT                   GS"
FT   gene            325754..326719
FT                   /gene="hisJ"
FT                   /locus_tag="TPASS_0308"
FT   CDS_pept        325754..326719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisJ"
FT                   /locus_tag="TPASS_0308"
FT                   /product="amino acid ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70735"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK67"
FT                   /protein_id="ACD70735.1"
FT                   /translation="MHCLMQVPSRRDGALRVQRCDGCVVWRSVCCALLVALLCLAVGCD
FT                   SPDLLVDSDLSLSRVRVAKTLVMGVSDRTPPMCFRYPNGEIVGFDVDLARAVCRVLGVR
FT                   LIIRPIKWTLKRNALRCGLVDCVWTAFAVTARRRTEFLLSEPYLRTAQVLLVREGRLHP
FT                   DLAHVERELGQRMTGVSAVHTRGDILPMRSSHRQARIAVLRGGPVPGNEKWQFGFEPHG
FT                   KVVWYRHRSAMLEALRTRAVDAALVDLVEAHDAVHRQGAPLRVMRVPLGLSQYAVAFRR
FT                   EDRALRDEIQRILYRIAASGEAYRIAEKWFGVGQSVIGIE"
FT   gene            326785..327603
FT                   /locus_tag="TPASS_0309"
FT   CDS_pept        326785..327603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0309"
FT                   /product="amino acid ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70736"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK96"
FT                   /protein_id="ACD70736.1"
FT                   /translation="MLWSCTPRARVFHAQDASFDEARVRGTLVVGVGRGLAPLVDAATF
FT                   SAFSLPSSVVPPPARCSLLLQEARGYDVELLAQVARRLHMDVQVKVVHWDEKERALHAG
FT                   VIDCIADGFTYTADHARRFALTQPYVRDVRVFAVLRQAPYATVADLHGKRLGVHAVTDV
FT                   EENDAYHALFGQVKTYAHYVQALTALSRAEVDVVALNLVTLCAVTPHLRRLYRILDEPI
FT                   DTCEYVFAFRADARALRDMVVRTLSQLQREGFVSALSKRWFGSDMSIIDR"
FT   gene            327572..327955
FT                   /locus_tag="TPASS_0310"
FT   CDS_pept        327572..327955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70737"
FT                   /db_xref="GOA:A0A0H3BIK2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIK2"
FT                   /protein_id="ACD70737.1"
FT                   /translation="MAAICPSSTAKAGGGGIPVDPLNAVIVEGNVVPSASARAPEAAVC
FT                   AFCIQTQRRVQGEGRVHTEVSYFEVEAWDALARVCAQQVRPGVGLRVVGRLKQDRWQQE
FT                   DGVRVQRVKIVAEHVEFQTPFVW"
FT   gene            complement(327934..328077)
FT                   /locus_tag="TPASS_0311"
FT   CDS_pept        complement(327934..328077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI39"
FT                   /protein_id="ACD70738.1"
FT                   /translation="MTGELMLRLPCWSSFCEKTHPPLHPGTSLSSTASIACATHPHHTK
FT                   GV"
FT   gene            328061..329074
FT                   /locus_tag="TPASS_0312"
FT   CDS_pept        328061..329074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70739"
FT                   /db_xref="GOA:A0A0H3BIX0"
FT                   /db_xref="InterPro:IPR007163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIX0"
FT                   /protein_id="ACD70739.1"
FT                   /translation="MSSPVMHVWIGMLIGAANVVPGLSGGTVALLCGTWELLIAAIALD
FT                   RAHLCRQWRRLLALAGGIVVGIGVCARFMRALYEAFPHLTNAFLAGVLLASVPSLRNRV
FT                   RAASVAAEHSVQAEGTARGHVGDAARRVWCAVRIIFFVLLGFVAVCAFSRMQHARDASS
FT                   ATAPASVQTTAVLTTAHTRGFVATVCAGALAAAAMLTPGFSGSLVLLLAGVYQPLLSVL
FT                   SLRAVEQGGGVTGASVISRLCSAHVWGLLFPLCVGMGIGLLGAARVLRAWFRLYPVSAH
FT                   ACVCGLVLGSSVTLFPRGTAAGMQDQFTLFMGCVAGCVGAFALAKVCAWGARDAGG"
FT   gene            329165..331453
FT                   /gene="tprE"
FT                   /locus_tag="TPASS_0313"
FT   CDS_pept        329165..331453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprE"
FT                   /locus_tag="TPASS_0313"
FT                   /product="protein TprE"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70740"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK73"
FT                   /protein_id="ACD70740.1"
FT                   /translation="MGCMRWGSVLCVVVGVGASGGVLGQEFSPKLTGSATLEWGISYGK
FT                   GVGSHGQAPGAVMGTGPYNLKHGFRTTNTVGVSFPLVMRTTHTRRGQHPALYAELKVAD
FT                   LQADLSQGKAGFAVKRKGKVEATLHCYGAYLTIGKNPTFLTNFARLWKPWVTAQYQEDA
FT                   VQYAPGFGGLGGKVGYRAQDIGGSGVSLDVGFLSFASNGAWDSTDPTHSKYGFGADLKL
FT                   MYARAGHPLCTVELASNVTLEDGYLIGAQKDANNQNKDKLLWNVGGRLTLEPGAGFRFS
FT                   FALDAGNQHQSEATAAMRTERTRERAQEVALAIFTHAAQEQAKQAADTVGSTIDNSVQV
FT                   ARSVITQIAEGAVKQAHDQIKRTNGTQVVNIDVTVPVNVRQSPVRQPDLPSLTAIAAQL
FT                   PNVTKLFFLSAGAAAARPIIGQITGVVQNVITQQVQARVAQSTAVAIQQVLVFNQQTVA
FT                   AEKANTQKHTINGKSYAAHIGSLVSLATNRALPTIRQRVEQAVQENIRRINAVVQQKAQ
FT                   TLTSSQELEKAVYSLFVPTFENLVLGAGALLALLDMHQIAVDALFTAQWKWLSSGIYFA
FT                   TAPANVFGTRVLDNTIASCGDFAGFLKLETKSGDPYTHLLTGLDAGVETRVYIPLTYAL
FT                   YKNNGGTAVRGIQEKEYIRPPVVGKAWCSYRIPVQDYGWVKPSVTVHASTNRAHLNAPA
FT                   AGGAVGATYLTKEYCAQLRAGISASLIEKTVFSLDWEQGMLSDVPYLLVSECLTQGIGR
FT                   IVCGVTLSW"
FT   gene            complement(331510..331656)
FT                   /locus_tag="TPASS_0314"
FT   CDS_pept        complement(331510..331656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70741"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKA0"
FT                   /protein_id="ACD70741.1"
FT                   /translation="MPVQLGVQHYFSAHWGIDATATVSFGIDTKLAKFRIPYTLRFGPV
FT                   FRT"
FT   gene            complement(331679..332326)
FT                   /locus_tag="TPASS_0315"
FT   CDS_pept        complement(331679..332326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70742"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIK6"
FT                   /protein_id="ACD70742.1"
FT                   /translation="MVRGCRVGQRTGTVGVRVFPVGLCALSLQARDCRGMCGKRLGKVM
FT                   VLGCMLPGVAARVSLSPKLGVYGDARGGSDLWGICIQAPTMPDTENQAPPRYAPETPLV
FT                   GLDVAFRAENGFLLQLTVDAALTRLMFCGRCLAGYSFRPGEGSTHLSVAAGFECTALIY
FT                   DSQHFLSVLGQGLLQPSSSSYSAGNWHRPRSLLGVLTCTAKEVGAIHEESAY"
FT   gene            complement(332320..333514)
FT                   /pseudo
FT                   /gene="tprF"
FT                   /locus_tag="TPASS_0316"
FT                   /note="protein TprF; frameshift"
FT   gene            complement(333573..335843)
FT                   /gene="tprG"
FT                   /locus_tag="TPASS_0317"
FT   CDS_pept        complement(333573..335843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprG"
FT                   /locus_tag="TPASS_0317"
FT                   /product="protein TprG"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70743"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI44"
FT                   /protein_id="ACD70743.1"
FT                   /translation="MGCMRWGSVLCVVVGVGASGGVLGQEFSPKLTGSATLEWGISYGK
FT                   GVGSHGQAPGAVMGTGPYNLKHGFRTTNTVGVSFPLVMRTTHTRRGQHPALYAELKVAD
FT                   LQADLSQGKAGFAVKRKGKVEATLHCYGAYLTIGKNPTFLTNFARLWKPWVTAQYQEDA
FT                   VQYAPGFGGLGGKVGYRAQDIGGSGVSLDVGFLSFASNGAWDSTDPTHSKYGFGADLKL
FT                   MYARAGHPLCTVELASNVTLEDGYLIGAQKDANNQNKDKLLWNVGGRLTLEPGAGFRFS
FT                   FALDAGNQHQSAQDFQNRTQRAQSELTALSNNLFQGESQKQEAWLDEYAKKVLDAVTAA
FT                   TETALQSRGNAYITAVSNVKVTPPVAATLLTNLKVFITDPPTPSPLPALPAFSLMGQVL
FT                   LQYDAEQVVKGFEQVQTQIVAEINQKVQAAVAQSKAAAQAFINGLTKVIEDVADALLAP
FT                   HKGNPMSLFNLPDQQKLLKDDLADLIPKLTAEATKFFTEGQTFVTEEVKKKTDALDAGQ
FT                   QIRQAIQNLRASAWRAFLMGVSAVCLYLDTYNVAFDALFTAQWKWLSSGIYFATAPANV
FT                   FGTRVLDNTIASCGDFAGFLKLETKSGDPYTHLLTGLDAGVETRVYIPLTYALYKNNGG
FT                   TAVRGIQEKEYIRPPVVGKAWCSYRIPVQDYGWVKPSVTVHASTNRAHLNAPAAGGAVG
FT                   ATYLTKEYCAQLRAGISASLIEKTVFSLDWEQGMLSDVPYLLVSECLTQGIGRIVCGVT
FT                   LSW"
FT   gene            complement(335795..335974)
FT                   /locus_tag="TPASS_0318"
FT   CDS_pept        complement(335795..335974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIX4"
FT                   /protein_id="ACD70744.1"
FT                   /translation="MRKIRGHSVTQGDKEVQGVVSFCVCAGGRVRGLLDRAGGGGEVAW
FT                   GACGGGVCCVWWWG"
FT   gene            336003..337064
FT                   /gene="tmpC"
FT                   /locus_tag="TPASS_0319"
FT   CDS_pept        336003..337064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmpC"
FT                   /locus_tag="TPASS_0319"
FT                   /product="membrane lipoprotein TmpC"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70745"
FT                   /db_xref="GOA:A0A0H3BK78"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK78"
FT                   /protein_id="ACD70745.1"
FT                   /translation="MREKWVRAFAGVFCAMLLIGCSKSDRPQMGNAGGAEGGDFVVGMV
FT                   TDSGDIDDKSFNQQVWEGISRFAQENNAKCKYVTARTDAEYVPSLSAFADENMGLVVAC
FT                   GSFLVEAVIETSARFPKQKFLVIDAVVQDRDNVVSAVFGQNEGSFLVGVAAALKAKEAG
FT                   KSAVGFIVGMELGMMPLFEAGFEAGVKAVDPDIQVVVEVANTFSDPQKGQALAAKLYDS
FT                   GVNVIFQVAGGTGNGVIKEARDRRLNGQDVWVIGVDRDQYMDGVYDGSKSVVLTSMVKR
FT                   ADVAAERISKMAYDGSFPGGQSIMFGLEDKAVGIPEENPNLSSAVMEKIRSFEEKIVSK
FT                   EIVVPVRSARMMN"
FT   gene            337074..337229
FT                   /locus_tag="TPASS_0320"
FT   CDS_pept        337074..337229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKA5"
FT                   /protein_id="ACD70746.1"
FT                   /translation="MPPVPARGRPSSSSDFCLYGMAVVNGFCVQDIPYGSRVVLPGRMR
FT                   SSSAGA"
FT   gene            337305..338906
FT                   /gene="rbsA2"
FT                   /locus_tag="TPASS_0321"
FT   CDS_pept        337305..338906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA2"
FT                   /locus_tag="TPASS_0321"
FT                   /product="ribose/galactose ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70747"
FT                   /db_xref="GOA:A0A0H3BIL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIL1"
FT                   /protein_id="ACD70747.1"
FT                   /translation="MPYAVEMRDVTVRFPGVVANDCVSFGVQTAEVHALLGENGAGKST
FT                   LMGVLFGTCPKQSGELFVDGRSVCIRSPRDAARHGIGMVHQHFNLVHNLTVSENIVLGV
FT                   EPRARFARTDVRAAHRAVGELCERYGLAVDPYAKIQDITVGMQQRVEILKMLYRDARVL
FT                   IFDEPTAVLAPQEVQQLMQVIRRLAREGKAVVLITHKLSEIKAIADRCTVLRRGACIGT
FT                   VSVAEVGEERLVEMMVGHAVDYALPRASRKDGACVLEVRSLSVGARRVTSGQMWADASP
FT                   SAAPRAYGVRAVSFQVRCGEILCITGVDGNGQSQLLEAIAGLVPVSEGQILLDGCEIQR
FT                   TSVRERVLRGVSYIPEDRRKHGLVLDFSVEENMVLRSYFRAPFARRGILDRRVIAQHAH
FT                   ALAKKFEVQSGALGCAVRARTLSGGNQQKVIIARELHRAPRLLIAAQPTRGLDLGAVQY
FT                   VHRAIVAERNRGGAVLLFSLDMDEVLALADSIAVMYEGEIVGTVHACDATEQELGRLMS
FT                   GMRKKETAGKKTGVQG"
FT   gene            338816..340018
FT                   /gene="rbsC1"
FT                   /locus_tag="TPASS_0322"
FT   CDS_pept        338816..340018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC1"
FT                   /locus_tag="TPASS_0322"
FT                   /product="ribose/galactose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70748"
FT                   /db_xref="GOA:A0A0H3BI49"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI49"
FT                   /protein_id="ACD70748.1"
FT                   /translation="MRRNRARARASHEWDAEKRDCGQKNRGTGVIARLRGCLVHPKYHA
FT                   LLIPCLAVILGFAVGAVVMAVSGLHPKYILIALVRSMFGVNVQAFGTGRSVWNFRYMGE
FT                   GVVTCLPLILTGLAVAFTSHMGLFNIGAEGQLVVGSVCAVCVGVLWHEHLSFFTIPAAV
FT                   LAGMVGGGLWGLIPGVLRAVCGISEVVVTIMLNYVGLYGANFVVTALPGSDLMRTVSLP
FT                   PAATLHSDFLSRVSNGSRLHWGFLLVIAALVSFKFLIEKTTFGYELRVVGASAEAARYA
FT                   GIHIRRRVMLATSISGMYAGLAGVLLAIGTFSYGRVLPGFEGYGFEGIVVSLVGRNTAW
FT                   GCVFGGSLLGSLRAAGPLMQLNGVPKEVSVIIVSAIIVFLSMHNGIRAMLVRWGRQGAH
FT                   V"
FT   gene            340015..340965
FT                   /gene="rbsC2"
FT                   /locus_tag="TPASS_0323"
FT   CDS_pept        340015..340965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC2"
FT                   /locus_tag="TPASS_0323"
FT                   /product="ribose/galactose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70749"
FT                   /db_xref="GOA:A0A0H3BIX8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIX8"
FT                   /protein_id="ACD70749.1"
FT                   /translation="MNTFYSMVALTLVFSTPILITALGGLFSERSGVINIALEGLMMFG
FT                   AFSTATVTVLCEPYTIAAPWIALGVGMAVAASVALFYAYLSVRLCSDQIIAGTAINLCA
FT                   TGMTVFFAQVIFGQQGTQAYSRGLVKTSYGFFSRIPVLGPMVFTHTYPTVYLGFVLVAL
FT                   AWYVLYRTPFGVHVRATGDQPYAVDGAGLSVFRLRSAAVVISGLCAGLGGGVLILTQDI
FT                   QYTVYSTHGTGFIALAALISGRWHPFGVLVTSVLFGFSQILNVYATSVELLKHLPIELF
FT                   SALPYALTVVVLLLFGGRGEAPRAIGQPYDRARRY"
FT   gene            341069..342526
FT                   /locus_tag="TPASS_0324"
FT   CDS_pept        341069..342526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK83"
FT                   /protein_id="ACD70750.1"
FT                   /translation="MAVLPSVRRFECSLFVVLVLCALAVFDPLSGFVQQKLAGVQRVWL
FT                   GLVEEYSGLRFQYDSLSPSVLRAVTLRNVRVREAVRGEQVAVFSKIVVAYNIFSLFGSN
FT                   PVRGIRALHVHDGAVDVDLYRHRHVKEKLQKLFSKDGEMASFFADLREIDVRVHNTAVT
FT                   VRSDSRRAHLSVPQGRFSFAETGASFALSCEAEYVDTRSSSWGPLYTHLDASGVFETSF
FT                   TSGSATLELAPPSGSFFSVPTLTLVAIYADDLFKFHTARGIYPMEVSGQWNTATGACEA
FT                   SVRCENFRPLKWARLRDTHVPAQGMQELSVSGNVQVGYTPIEQWRWSADVHAHTPYVVL
FT                   APGYQLEDVVATLQAHGDPARIQVEKICARGSNLDVDGAFELTLDRWIPSGVLTVHRLP
FT                   LLSGAYLSAQVRFRPQGVGFVCTVPRIQVGEAFLEDVALSVRVDPAKTDFRLVAADSTG
FT                   RYECDGSYLAANAGSLAFLRHTWRLNR"
FT   gene            342508..345474
FT                   /locus_tag="TPASS_0325"
FT   CDS_pept        342508..345474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70751"
FT                   /db_xref="GOA:A0A0H3BKA9"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKA9"
FT                   /protein_id="ACD70751.1"
FT                   /translation="MAFESVNVGALYQMVAACTSPQGASTLVTRALVPLQSTADFYVSS
FT                   DFRDISYNCVRLVLASDEIADLYALLSVQGTAASFSVTDISLLCKGLEVQGNVMANFEH
FT                   GGDALFESVLSINSVPYRTRGVYADRTLTVYGDYDFSVVASFDERAGVTGTFQVQNLPV
FT                   PLSQSLFDCDSSFAMRSAHSWEVRFHHLHLRSGAVAAGGSEQIETVLRLAGVANQAGAL
FT                   FDQVFFGSRDRYLAGTASFAVVPRTGQHEQARYETAVRLASEDAQEQVQLNAQVTVGEH
FT                   VYVDSSGRIDNVDVGRFVAGQGERSRVTGSWTVLGTMQDMSGQVQVDSLELIAKGVPFH
FT                   LRGGCALDDGTLALLPTQVTWGSHQFADLAGEWVPGQARAWVRTTYSGAFEGQPTHATC
FT                   TLTLAGSPVDSGKATSALRTSFLTPFLQTHSQYTISAEFEHWRIATYEGEKNRILVVRD
FT                   PGVWALYAGEHDEITGFMLDDGSVSLQVAQSLPVHFFLNGSLSAQQVDVQIQDIFVDLA
FT                   RVWAFTGIRHVRVHEGVAVGNVTVSGTRARPVFEGKLRGKEVVASAPGYAPERFGPGSI
FT                   DIVAHGSTLIVPYTEFPGPTARLWGECVAQLNGFYPDEVVIKCGTVGDALGAIQTDNLL
FT                   FAMDGSAGCDLELRITPQLLSINGKARFDRGYFLLNFSGIEEFYTKYADSAQNFQMNLL
FT                   LSAGNKVEFRWPRSDFPILRTLLHAQEPFEFIADPVSGSFYVRGFAHLKGGEFFWIKRN
FT                   FYLREGTIHFARDTQTADPRISFRAELKDRDTQGRPVSLILSAEDQVFSKLAPKLRCDP
FT                   PVSEQELAKILGQVVLGDLTEENIEQNVASIASDILTQWGIMKRVEDKIRSFLDLDAFS
FT                   FRTYVLQNAIFGNLFNKDRSKPLTVGNYFDNTSLYVGRRLGRAVYADALLHLSQYDPLA
FT                   PNNLGIKKPAAGSLLFRPELGLEFATPFFSLRWASTPTRLDSLFVSDTSMRVSWSFAY"
FT   gene            345456..348017
FT                   /locus_tag="TPASS_0326"
FT   CDS_pept        345456..348017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0326"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70752"
FT                   /db_xref="GOA:A0A0H3BIL6"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIL6"
FT                   /protein_id="ACD70752.1"
FT                   /translation="MEFCVLRLKAARKEKGMLKKASAFLIASCCVMSLAWAQANDNWYE
FT                   GKPISAISFEGLEYIARGQLDTIFSQYKGQKWTYELYLEILQKVYDLEYFSEVSPKAVP
FT                   TDPEYQYVMLQFTVKERPSVKGIKMVGNSQIRSGDLLSKILLKKGDIYNEVKMKVDQES
FT                   LRRHYLDQGYAAVKISCEAKTEAGGVVVQFTIQEGKQTVVSRIQFKGNKAFTESVLKKV
FT                   LSTQEARFLTSGVFKENALEADKAAVHSYYAERGYIDARVEGVAKTVDKKTDASRNLVT
FT                   LTYTVVEGEQYRYGGVTIVGNQIFSTEELQAKIRLKRGAIMNMVAFEQGFQALADAYFE
FT                   NGYTSNYLNKEEHRDTAEKTLSFKITVVERERSHVEHIIIKGTKNTKDEVILREMLLKP
FT                   GDVFSKSKFTDSLRNLFNLRYFSSLVPDVRPGSEQDLVDIILNVEEQSTANVQFGVTFS
FT                   GVGEAGTFPLSLFCQWEEKNFLGKGNEISVNATLGSEAQSLKLGYVERWFLGSPLTVGF
FT                   DFELTHKNLFVYRAGAKGNGLPHPYVSKEHWANSPGLAESFRLKYSRFESAIGAHTGYQ
FT                   WYPRYAVIRVNGGVDFRVVKNFYDKDNNQPFDLTVKEQLNWTSINSFWTSVSFDGRDFA
FT                   YDPSSGWFLGQRCTFNGLVPCLEKEHSFRSDTKAEFYVTLLNYPVSAVWNLKFVLAFYT
FT                   GVSVQTYYGRRKSENGKGNGVRSGALVIDGVLVGRGWSEDAKKNTGDLLLHHWIEFRWP
FT                   LAHGIVSFDFFFDAAMVYNIESQSPNGSSSASSSSSSSSSSSSTTSSEGLYKMSYGPGL
FT                   RFTLPQFPLKLAFANTFTSPGGIPKTKKDWNFVLSFTVNNL"
FT   gene            348074..348592
FT                   /gene="ompH"
FT                   /locus_tag="TPASS_0327"
FT   CDS_pept        348074..348592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompH"
FT                   /locus_tag="TPASS_0327"
FT                   /product="cationic outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70753"
FT                   /db_xref="GOA:A0A0H3BI54"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI54"
FT                   /protein_id="ACD70753.1"
FT                   /translation="MKATLTFVFMLLTSLLQGQSQHITRFAVIDAARIYSTFWRDSRVL
FT                   RDYESKKARHQGEIQKMSDELVELRQKKVDAQMQQNIASVQKYEVLIASKTALLLEYSK
FT                   TSNDELTALRKTLIADDAFYAKLYAAIRRIAESEGYSIVLDLQKNAGILWYSHSVDITE
FT                   DVLRELSSS"
FT   gene            348648..351350
FT                   /gene="mutS"
FT                   /locus_tag="TPASS_0328"
FT   CDS_pept        348648..351350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="TPASS_0328"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70754"
FT                   /db_xref="GOA:B2S2S5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2S5"
FT                   /protein_id="ACD70754.1"
FT                   /translation="MRSLASDTPLMRQYHAIRAQHPDAVLFFRLGDFYEMFDSDALHVS
FT                   TLLGLTLTKRNGTPMCGVPVHTARTHIARLLKHGKKVALCEQVSHPVPGELTQRKVIEI
FT                   ISPGTAVEDDFLSQGFSQYLATVCASDATVAFSYLEVSTGAFFITSFPRAEAADALQKE
FT                   FGRVQPSEVLLSASVLRSLPELAAILSLYPRLVRTTGADALFNPEHTKNRLHHCFRTRN
FT                   LDCLTLLPHSPDLAAAGALIAYLEETTRHPLSHVSAITRYHIHDFVEIDDATRKNLEIL
FT                   QNLHDSTHAHSLFETLNYTHTAMGTRLLRYWLHHPLRSQEEIQKRLSAVVFFHHRPHIL
FT                   KTLRATLSCVRDVERLVARVALEKAHGRDLLALKESLRAILTFRSLERESPFPPDLLPS
FT                   EGDTPVLQELYGLLEQSIKEDCPVTLSDGNLIKRGFSASLDELHRVRDNANEILKQYLA
FT                   EERERTGIGTLKMKYNRMLGHFLEVSKGHLSAVPAHFIRRRSLSNADRFTTEQLSELEA
FT                   KLARAREGLVSFEQELFADIRRTVCSHTQLLRTNAARVAQLDVLQSFAHAALQHGWSQP
FT                   VFIKDGALRITGGRHPVVELHLPSGEFVPNDLTLSSSEHAVLPRFALITGPNMAGKSTF
FT                   LRQTALICLIAQVGSFVPAEKAELTPVDRIFCRVGAADNLARGESTFLVEMSETAHILR
FT                   AATRDSLVIMDEVGRGTATEDGLSIAQAVSEYLLHHVRAKTLFATHYHELSRLAHPQLE
FT                   HLKLDVLETDNTIVFLKKVTPGSCGSSYGIYVARLAGLPESVLARACELLKQLQQRAGS
FT                   APRASAAHEADAVAQTEAVHAHKAASKPCAQRVSADLFTQEELIGAEIASLNPDAITPL
FT                   EALTLIARWKRSLRGSATQQSSAMTKRKG"
FT   gene            351468..353192
FT                   /gene="glyA"
FT                   /locus_tag="TPASS_0329"
FT   CDS_pept        351468..353192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="TPASS_0329"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70755"
FT                   /db_xref="GOA:A0A0H3BIY3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIY3"
FT                   /protein_id="ACD70755.1"
FT                   /translation="MNNSALRAYLSTRAPDQIHSAFVAYLANLDLVAHQFPQIASDIVQ
FT                   ELIDQRSYVKLIASENYSSLAVQAAMANLLTDKYAEGFPHHRYYGGCQNVDSIESAAAA
FT                   EACALFGAEHAYVQPHSGADANLVAFWAILSRQIEMPTLSSLGVTAATHLSEEQWEVLR
FT                   QKMGNQKLMGLDYFSGGHLTHGYRQNVSGRMFRVVSYAVDRDTGLLDYAAIEAQAKRER
FT                   PLILLAGYSAYPRSINFRIFREIADKVGAVLMADMAHFAGLVAGGVFTGDEDPVRWSHI
FT                   VTSTTHKTLRGPRGAFILCKKEFAEAVDKGCPLVLGGPLPHVMAAKAVAFREARNAAFK
FT                   TYAHAVRDNARALADACIQQGMQLQTGGTDNHLLLLDVRPFGLTGRQAERALIDCGVTL
FT                   NRNSLPFDPNGAWLTSGLRIGTPAVTSLGMGPEEMKRIARLIARVLGAATPVRTKTGAL
FT                   SKSAAEVPGEVRSSVCSEVRELLARFTLYPELDEPFLRAHFTRRPAGQNTCRRRDLNPY
FT                   GVTPTDFESVVSASFTTSARAQPITRGTKGTAVHVVFLREAPCLPLREPLFFSHEEF"
FT   gene            complement(352992..353074)
FT                   /locus_tag="TPASS_t0016"
FT   tRNA            complement(352992..353074)
FT                   /locus_tag="TPASS_t0016"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA-Leu3; codon recognized: UUG"
FT   gene            complement(353166..354962)
FT                   /locus_tag="TPASS_0330"
FT   CDS_pept        complement(353166..354962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0330"
FT                   /product="possible cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70756"
FT                   /db_xref="GOA:A0A0H3BK87"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK87"
FT                   /protein_id="ACD70756.1"
FT                   /translation="MHSGQQLLEKNSIIISGLPPWAQELSKKYCSKTVNLYFVHGNIRD
FT                   FLPHRDIQGSFSFVRINDYISEVIFGNRDIIVFYDKSAGLTFCLQEMLSAYLERMHAQY
FT                   PTEALADFLSRDPVKAFAYLERYFIMNMKQNKRMVLIIDYSESLVPSEDIANLSETDRY
FT                   CFVTLNRWANDPVFTNEDISVVMLTENITDINSRFTASPSTVKIHIPLPNEETRIRFLE
FT                   YLKTQEEILVLERGLNTEKIGKLTSGLNLVNLHQLAAETYQTIDANGKPEDNISRLSHT
FT                   DSATLQFLKRKKQEIIEHEAGGLLEFVDTSCDLSYVAGNVFVKKRLYNAVRAIKQGRAD
FT                   VLPMGYLISGPIGTGKSFMVSAFAGEIGIPMVRLCNFQATQPGITQSNLEKTLNILKAL
FT                   TPVAVMVDEADAVFGRRNAPAGESRIFAQIAGFMGNTQHRGNIIWFLITSRPDLLPIDL
FT                   KRQGRAEEHLALFYPETTKEKTEIFEALKKKLRIKLKDVHVPAIIRRIKFAVSGSDLEA
FT                   ILVRAQLTAAMESRTMVTTQDITRTIEDFIPPAYPHEIELQNLVAVLECTGKEMLPARY
FT                   QHLDRSKLVADIRELKLLMGEK"
FT   gene            complement(355027..355098)
FT                   /locus_tag="TPASS_t0017"
FT   tRNA            complement(355027..355098)
FT                   /locus_tag="TPASS_t0017"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA-Gly1; codon recognized: GGA"
FT   gene            complement(355192..356658)
FT                   /gene="gnd"
FT                   /locus_tag="TPASS_0331"
FT   CDS_pept        complement(355192..356658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="TPASS_0331"
FT                   /product="phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70757"
FT                   /db_xref="GOA:A0A0H3BKB4"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKB4"
FT                   /protein_id="ACD70757.1"
FT                   /translation="MGADIGFIGLAVMGENLVLNIERNGFSVAVFNRTTTVVDRFLAGR
FT                   AHGKRITGAHSIAELVSLLARPRKIMLMVKAGSAVDAVIDQILPLLEKGDLVIDGGNSH
FT                   YQDTIRRMHALEAAGIHFIGTGVSGGEEGALRGPSLMPGGSAQAWPLVSPIFCAIAAKA
FT                   DDGTPCCDWVGSDGAGHYVKMIHNGIEYGDMQIIAEGYWFMKHALGMSYEHMHHTFTRW
FT                   NTGRLHSYLIEITAAILAHQDTDGTPLLEKILDAAGQKGTGRWTCVAALEEGSPLTLIT
FT                   ESVMARSLSAQKQARCKAHRVFGSPVKVSKAETLSAQQREELVSALEDALYCAKIVSYA
FT                   QGFELLSHTAKRRGWTLDFSRIASLWRGGCIIRSGFLSKISAAFAQQHDLENLVLAPFF
FT                   AEELKRACPGWRTIVAESVRQALPVPALSAALAWFDGFTGAALPANLLQAQRDYFGAHT
FT                   YERTDAPRGEFFHTNWTGTGGDTIAGTYSI"
FT   gene            356674..356799
FT                   /locus_tag="TPASS_0332"
FT   CDS_pept        356674..356799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70758"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIM1"
FT                   /protein_id="ACD70758.1"
FT                   /translation="MRAECSAFRYFLKGDGDLVLSVYIRVLCVFLEPVQRGSCSL"
FT   gene            356837..357529
FT                   /locus_tag="TPASS_0333"
FT   CDS_pept        356837..357529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70759"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI60"
FT                   /protein_id="ACD70759.1"
FT                   /translation="MRRRRRFLTLCACAVHLLPLFPQTITTASVFFASVSEHYARLKDY
FT                   AADLAMSTGSGTRAHLMRAKVIFKYPDRLRLDFSSPAEQTIVFTGDSLTIYLPTSRVAL
FT                   VQSVAKDDTVSAASLASPHGLALMKRFYTIAYETSSSPVPLGPDSGEMVVALVLNRKSA
FT                   AETFKSLRVLVSAHTKLIRRIEAWPLSGEKITFDFSHYRLNVGIPDTRFLYDVPPTANV
FT                   VHNFLFAD"
FT   gene            357554..358771
FT                   /locus_tag="TPASS_0334"
FT   CDS_pept        357554..358771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70760"
FT                   /db_xref="GOA:A0A0H3BIY9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIY9"
FT                   /protein_id="ACD70760.1"
FT                   /translation="MPDIGELLKTTRERKHLSLEQAAHETSIARRYLEALENDEYDVFP
FT                   GEPYILGFLRNYCEYLQLDTEQCIARYKHLKIQEMSLPTETLLPSKRWGSFPLLKGVAC
FT                   VLFLGGVLGVYYARHRALGFLSRIVFFGRAQRTPRELSPPDATGAVRETVSLSSAQHEE
FT                   RARRTRSSASRYTLAEEKFEHTVFPGDVLVISSGGNAYELTVSRTTPHLYLDTPIGTQV
FT                   ISLGQRLVMDLNTDVQPDVEISVEDIEAHQADGGARVRVFTGSLVQTLRDRSAQSFVPT
FT                   SGVNVSGQTGVAAGARYQVLFEGGVAYPVTMNATFRSYCLFRYEADRTRREERYYQKGE
FT                   QLTVQANNGIRVWASNGNVVQLQIVAGGKTVDVGLSRPGEVLVKDIKWIKDEDAGRFKF
FT                   VVMEVD"
FT   gene            complement(358768..359310)
FT                   /locus_tag="TPASS_0335"
FT   CDS_pept        complement(358768..359310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70761"
FT                   /db_xref="GOA:A0A0H3BK92"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK92"
FT                   /protein_id="ACD70761.1"
FT                   /translation="MAITTAGDICALYPLCPILLHCSTLMHLSPLRNTPHVLHAAAAVT
FT                   EYAFVLSTLVFPSFCFSLPSPFPFPEGEGGAFYVRLFLNALSEEVLFRAYIPERLCHHA
FT                   TSCTARACGEVLSVLLFALAHRPAGSATLFAGAAGAALRVLFVREKKRSGSRARASALC
FT                   TAVHALWNAYAIAAAAR"
FT   gene            359153..360853
FT                   /locus_tag="TPASS_0336"
FT   CDS_pept        359153..360853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0336"
FT                   /product="possible protein ComE"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70762"
FT                   /db_xref="GOA:A0A0H3BKB9"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKB9"
FT                   /protein_id="ACD70762.1"
FT                   /translation="MLSTNAYSVTAAAACSTCGVLRKGERCISVEQCNRIGQRGYRAHI
FT                   SPAVVMAIAAVGGFYGTHVYEVPFPYAFFGAVQACVLCIGCLLVRSGVRFFSRWGAVRI
FT                   WRRWGIAYTSVCRCCNTLFFVFCGLCVACVARTSLMVQQAPLQTLAQPQKLRVLTIHLL
FT                   QEPKPAGTRFRVRARVLGAGYIDGASFSARGVCTVLFPAEVILQQYATDMTDDADARVC
FT                   QYYARGLRCQIRGRFASSAPKLFISSSTPPRFVGWSSYFAQMRAQMRVALMRFLSPWGR
FT                   AGGLLLALLSADSVFLSDEMRVAFRHAGLAHVLALSGMHLSLVGASATFLGRFIGTRHR
FT                   GMQGAFFAMLVFVWFAGISPSLARALGMTLVLMGGQMAYVRVGLFSVLCAVLSIHMLIA
FT                   PHDVQTLSFMLSYGALAGIVLLGSEITEMMSGLIPRPLASLLGTSCSAQFFTAPIVLSV
FT                   IGYFAPIGVLASCVVSPLIALFLIGGSVALCCSLAVPAVAPFLSWGVYFFGEGLCAVVR
FT                   FFACAPLVYVQSACGHVCAALFSFLLGGGLLEAARRVRVHKDTYVLPEL"
FT   gene            360834..361691
FT                   /gene="ksgA"
FT                   /locus_tag="TPASS_0337"
FT   CDS_pept        360834..361691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="TPASS_0337"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70763"
FT                   /db_xref="GOA:B2S2T4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2T4"
FT                   /protein_id="ACD70763.1"
FT                   /translation="MCCPNYNSARALAQFLTERGLRMHKKWGQNFLLDPVLRTQLVKIL
FT                   APERGERVWEIGAGIGAMTALLVQNSDFLTVFEIDRGFVQTLRKLFDAHVRVIEGDVLQ
FT                   QWHAAAAQEQPACVLGNLPYNIAARFIGNTIESGYIFKRMVVTVQKEIGLRMTALPAQK
FT                   WYSYFSVLCQWQYEVRVIRNVAPVCFWPRPHVVSQALVLTKRNAVPSCVDPALFLHVTK
FT                   TLFSARRKTVRNNLLTWQKRMPGGAAVCVEELCARAGIDARARAEQLSIYDFITLSDTL
FT                   RALL"
FT   gene            361709..362197
FT                   /locus_tag="TPASS_0338"
FT   CDS_pept        361709..362197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70764"
FT                   /db_xref="GOA:A0A0H3BIM6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIM6"
FT                   /protein_id="ACD70764.1"
FT                   /translation="MARVYILFFSVFFVFPLFSEDAARDVEPSDAPVPYEDTEFSLWQK
FT                   ELYRFEALSIGAFPIVTLLSFITYDIIRLIQQWSTKPPTWWALIIPGAELPPLSTKERA
FT                   IVFGVAVGISVTIGLIDVTYRAVKRAIHRRSLERSQLVPDPIELVPLDSFVEGTDDST"
FT   gene            362209..363204
FT                   /locus_tag="TPASS_0339"
FT   CDS_pept        362209..363204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70765"
FT                   /db_xref="GOA:A0A0H3BI64"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI64"
FT                   /protein_id="ACD70765.1"
FT                   /translation="MSYSCSAESTSVCSVHFSVFRIPGATCRCDVFCAEHVFFCARSQL
FT                   KRIVRALCVNGHTAKFSRPLHVRDRVSFEWVRSVPPALIPENISLSILFENEDIIAVNK
FT                   AQGMIVHPGAGHWTGTLVQALSFYRVYRARFEDEFSRQFQKGFPDFFSTLRQGIVHRLD
FT                   KDTSGVLLTSRNMHAHEALVRSFKKRQVRKVYLALLQGVPARGVGVIETTIVRDRRRRT
FT                   RFVASEDFSKGKYARTRYKVMKICGACAFVQFLLDTGRTHQIRVHARYLGCPVVGDPLY
FT                   GSRNICGIPTTLMLHAYAVRFVLPRTKKRITLVAPIPLRFVRLIHRLSVR"
FT   gene            complement(363190..364662)
FT                   /gene="folC"
FT                   /locus_tag="TPASS_0340"
FT   CDS_pept        complement(363190..364662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="TPASS_0340"
FT                   /product="folylpolyglutamate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70766"
FT                   /db_xref="GOA:A0A0H3BIZ3"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIZ3"
FT                   /protein_id="ACD70766.1"
FT                   /translation="MSDLSNVHQFSFPARIAASSVPHIIVRPSAHGVSHIPVHSFQDFY
FT                   AWVERIRTLEKMPPSGTPPLHRMTALARALCNPHNAYQSIHVAGTKGKGSSARMLAAIL
FT                   NEIGFNTGLYASPHVMDPRERITRAGVFFSPAEYASACTHVYHTVKKTENLRDYGQATW
FT                   FELITLLAFMLFAQQRMEWSVFEVGLGGRLDATNIICPSICLLLPIEQEHTRILGTRIK
FT                   SIAKEKGGIIKPYTPIFCFDQPEDALHVFKHIAREKHAPFFYLPDMVTHIESSIKHFTH
FT                   TATLSFNAAHPVGRLFARNIHCTLALCDIVQAKNAALAACAAKYLFPTVSETLIERGLS
FT                   RAYVPARFEIMQEDPLIVIDGAHTTQSIRCACRTFSSLLPSAQYILLFACAADKAVSQF
FT                   PPLFSHAASEIFLTIPGTSKHADIQKTYHAFRTTFHQTVPIFWSEDFASIISRALYASF
FT                   AQRKALLAIGSFYLAAEVKRIYARTCHTLPNR"
FT   gene            364681..366126
FT                   /gene="murC"
FT                   /locus_tag="TPASS_0341"
FT   CDS_pept        364681..366126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="TPASS_0341"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70767"
FT                   /db_xref="GOA:B2S2T8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2T8"
FT                   /protein_id="ACD70767.1"
FT                   /translation="MKRGTLPKDVSGIKIHMIGIKGTGMSALAELLCARGARVSGSDVA
FT                   DVFYTDRILARLGVPVRTPFSCQNLADAPDVVIHSAAYVPEENDELAEAYRRGIPTLTY
FT                   PEALGDISCARFSCGIAGVHGKTTTTAMIAQMVKELRLDASVLVGSAVSGNNDSCVVLN
FT                   GDTFFIAETCEYRRHFLHFHPQKIVLTSVEHDHQDYYSSYEDILAAYFHYIDRLPQFGE
FT                   LFYCVDDQGVREVVQLAFFSRPDLVYVPYGERAWGDYGVSIHGVQDRKISFSLRGFAGE
FT                   FYVALPGEHSVLNATGALALALSLVKKQYGEVTVEHLTALRKVLALFQGCRRRSEVLGE
FT                   VRGILFMDDYGHHPTAIKKTLRGLKTFFPERRIVVDFMSHTYSRTAALLTEFAESFQDA
FT                   DVVILHEIYASAREVYQGEVNGEHLFELTKRKHRRVYYYEAVMQAVPFLQAELKEGDLF
FT                   VTLGAGDNCKLGEVLFNYFKEEV"
FT   gene            366247..366807
FT                   /gene="cmk"
FT                   /locus_tag="TPASS_0342"
FT   CDS_pept        366247..366807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="TPASS_0342"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70768"
FT                   /db_xref="GOA:A0A0H3BK97"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BK97"
FT                   /protein_id="ACD70768.1"
FT                   /translation="MSNRCDVSGNKAVRIAVSGASGCGNTTVSALLAERLGLPLVNYTF
FT                   RNIARELGISLSEVLERARTDNHFDKAVDARQLCLAMRSSCVVGSRLAIWLVKDAALKV
FT                   YLLASLKERVKRVLQREGGDVQDVERFTSMRDAEDMSRYKKLYRIDNTNYSFADLVLNT
FT                   EGCDQETVVSIIIEMLRARGIAW"
FT   gene            366801..367634
FT                   /locus_tag="TPASS_0343"
FT   CDS_pept        366801..367634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0343"
FT                   /product="possible A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70769"
FT                   /db_xref="GOA:A0A0H3BKC4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKC4"
FT                   /protein_id="ACD70769.1"
FT                   /translation="MVGLSQSAGDIEKFQNAILDFYAQQGRDFPWRSTCDAYAILVSEF
FT                   MLQQTQTERVCPKYAEWLHRFPSLESLACAPFAHVLQAWIGLGYNRRARFLHQSAKLIV
FT                   ERYCAVVPDDPSELKKLPGVGDYTAAAVACFAYNKATVFLETNIRAVFIRFFFPDTHQV
FT                   SDRELLSLVRCTLYEENPRRWYYALMDYGAVLKRKITNPNRRSKHYVKQSPFEGSLRQV
FT                   RGAVLREISGMQHAVREKTLFAKLSFEHERLSRALDSLVSEGLVVKTEAGYSIAD"
FT   gene            complement(367639..371061)
FT                   /gene="trcF"
FT                   /locus_tag="TPASS_0344"
FT   CDS_pept        complement(367639..371061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="TPASS_0344"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70770"
FT                   /db_xref="GOA:A0A0H3BIN1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIN1"
FT                   /protein_id="ACD70770.1"
FT                   /translation="MRGILHSWNELQHALRSLRAARFPYRVEGCTGGLRSYFFGEYVRT
FT                   CCAHIVLVVPTEQDVAAVCTDLAHAAVPTRVLPWWGSLPYRPVSPNAHVFSHRVEALCA
FT                   LAQRDATAPCAFVFTQRALLTPVPPLDYVRTLKRSFRVGEHIEIHTLAAQLMQWGYARV
FT                   DHVSACAEFSLRGEILDIAAAAQAADNTQAYRIVCDFNTIERIHILAVSTCAVLQEVSA
FT                   CTLYAAKEILWSEERIAFLHQNLQKLSECPAHCVPCIEELTHRKTYEGEEMFYPLCFER
FT                   PTCVLEYFRHSPSPPSVFYLDYERQHNGARALQDECRNLYHKMQLAHEHVPARWYPQPE
FT                   HIVLDFSAVCALHLHTVYFTHFFPQLPACESICLASDPARSFFGNIPYFKEELLRLSKD
FT                   GWHVFVFAESEQQALRIRALVKGCDVTVLPCALSAGFSIPALKILIVQEGEIFGRRRKT
FT                   PQSVQRARSTPIDTFVELNPGDYVVHAQYGIGLFKGIERIKTAQSERDYVNLLYAQEET
FT                   ILIPIEQAHLVQRYIGNEGNKPHLDSLGSKSWETRKARVKKSVENIAQKLVELYSLRKT
FT                   TRGHAFPKDDEWQYAFEAAFPYEETDDQRICIEEVKQDMQEAVPMDRLVCGDVGYGKTE
FT                   IAMRAAFKAVMGGKQVVFLTPTTLLVEQHFRTICNRFKHFPVRIEKLSRFVPKSEQKDI
FT                   LAKLAHGDIDLIVGTHRLIQKDVSFKDLGLMILDEEQRFGVQDKEKLKQMKTNVDCLSL
FT                   SATPIPRTLHMGMLKIRDMSLLTTPPEGRLPIETVIQQFDPNLVATAIRKELDREGQIF
FT                   YLHNRIENLESVKCMLQKLVPELSICVAHSLMGSEELEDIFERFYQKTFQLLLSTTIIE
FT                   NGIDVPNANTIIIDRADMYGVSQLYQLRGRVGRSDKKAYAYLLYYHDVALSDLAIKRLQ
FT                   VISDFTDLGAGFKVALKDMEIRGVGNLLGKEQSGDIYSVGFDLYVQLLEEAIERLQHAP
FT                   NEQRIETVIDLNYRGFIPHTYIAADEIKMELYKKIAAAHTHEELERIRTETITRFGPIP
FT                   EEAAGLFTVAEIKVRCEKLAILSLKETHESLLIEFDKVCDTAFKKILRLVQTSNDRVRL
FT                   DAKQPNMLILTSDAIEIKEKGIFICEILKRLES"
FT   gene            371214..372305
FT                   /gene="mraY"
FT                   /locus_tag="TPASS_0345"
FT   CDS_pept        371214..372305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="TPASS_0345"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70771"
FT                   /db_xref="GOA:B2S2U2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2U2"
FT                   /protein_id="ACD70771.1"
FT                   /translation="MGLIFFRYDRCYMLSVLSYLHVYFGPFRLLQSYAVLMGIALYAGF
FT                   FFTYGVLPSAYRFLPQDRGRAFAPCAQEAAGKPTGAGVIFVSVFVLLVYLLMRPSFVHA
FT                   LILLLTWGVMLTGYLDDCAQVCWGEYRKGALDFLFAVLTAALLGHFYFHDQVFWWFPFF
FT                   SDPVFVSPFLFFAGSVVILWMSINATNCTDGVDGLSGALVLMALLSMGTIFYFLLGNVR
FT                   AAQYLLVPFVVDGAQWALMSFALAGALMGYVWRNAHPSTVLMGDAGSRALGFFIGVLVL
FT                   ISGNPFLLLMTSGVILVNGGTGLLKVVLLRFFHVRILSRVRFPLHDHMRENWHWSTAQV
FT                   LLRFMILQGLLTIGLLGVLFKLR"
FT   gene            372462..373163
FT                   /locus_tag="TPASS_0346"
FT   CDS_pept        372462..373163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70772"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI70"
FT                   /protein_id="ACD70772.1"
FT                   /translation="MCMVPVRRFIAVCAVTACAGPCFCVQAFISSRIGYGHFGIYGNEI
FT                   KDSYYKHVPMTGLGVDVVTSSGVAMVFNVETALTQLMFRAQALLGYAFEVGRFRFTPAI
FT                   GGSFLASHDHAAGVALSLDFQYFFNDWVGLDLNIGAGVDVPVNSNLRYLVRVGTPELAK
FT                   ILITHTVTHGLANRWISGPHWWNSLSSWVGNTAGKVAGFVARLIANYLLKGSQYSMLVP
FT                   VVVRLGAVYKV"
FT   gene            373132..373962
FT                   /locus_tag="TPASS_0347"
FT   CDS_pept        373132..373962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70773"
FT                   /db_xref="GOA:A0A0H3BIZ8"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIZ8"
FT                   /protein_id="ACD70773.1"
FT                   /translation="MFAWGRYTRCEGVGIRGACAEMKWSGLCLFLRTGGGGCEQMNGKR
FT                   VFLGIVVVVCAARCFCADVFFSSHLGYGRFYAVGKDIEGQHMHVPSIGGGVCVVADSGF
FT                   AFACTVDAALTRIMLKTQALFGYAFRWGAFSLIPLLGMDVIVSSDHAFGVAAQVSFQHL
FT                   ISEWWGFALSVSGGVDFPLNPNTRFLAGKLPAETVQRVALVALRQKLISEGIIKALDLG
FT                   WFITFALTVVAEGFSWIVSQSAWIAQKAVNYFLSDTTRCLILPVTLRAGPTFRI"
FT   gene            complement(373696..375105)
FT                   /locus_tag="TPASS_0348"
FT   CDS_pept        complement(373696..375105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70774"
FT                   /db_xref="GOA:A0A0H3BKA2"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKA2"
FT                   /protein_id="ACD70774.1"
FT                   /translation="MRLVRSRLPLDVRDELVSLLGGMCFFLSTVEHVIPKPLPFFRVGL
FT                   ANLPLLISPDLLPFCAYARLVFLKVIGQALVSGTLFSYVFVLSLAGSTASGALMYALRF
FT                   VPCRYLSCVGISVMGAFCSNVIQLTLARVLVFGAGVWYVLPLFCALGAVSSTLLGALTG
FT                   HFLSHSQWYAHLQNAACGQQDTAPPASLFFPVQAGCECTAPCSEHGLRPRVLRYVRMGT
FT                   GLLLLLILLCVPRLSVQASVCGIALLLYAATGGRIRWMTLAGLWVGTLACYLRPPVGRV
FT                   WATVLGVPLTSGALSAGARQACMASGMVYLSKWILRVPPHLPGKFGQTVVHALSLMHRL
FT                   SSFKCAAHDGTLHKKSTAFFSRSGQLDSGRQRAAKSAPPRTLYSKGRTGPQRDRENETT
FT                   RGVAQKVIHRLLRNPSALRHNPTESLGNNGQSEGNKPAQIQCLDNPFANKLLPQRNERH
FT                   ALHRFCRQLTC"
FT   gene            complement(375075..375605)
FT                   /gene="slyD"
FT                   /locus_tag="TPASS_0349"
FT   CDS_pept        complement(375075..375605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="TPASS_0349"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70775"
FT                   /db_xref="GOA:A0A0H3BKC9"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKC9"
FT                   /protein_id="ACD70775.1"
FT                   /translation="MKIANECVVNIEYTLRDDTGEIIDSSDVMGALEYVQGHGMIIPGL
FT                   ETALINREEGEEFSVTIPPVGAYGEVQEDLRMTVGRDQFPPNVPIEVGMRFDAGSGGDS
FT                   RPVTVTDVQGETIIVDGNHPLAGKTLHFEVAVRSVREATDDDLAALLFRESTSGGGCGS
FT                   GAGGCGSCGAGCH"
FT   gene            375819..377105
FT                   /gene="proA"
FT                   /locus_tag="TPASS_0350"
FT   CDS_pept        375819..377105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="TPASS_0350"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70776"
FT                   /db_xref="GOA:B2S2U7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2U7"
FT                   /protein_id="ACD70776.1"
FT                   /translation="MVEVYARLRAAVARLAVCSAAEKDGALRAVRDALHAQREDILRAN
FT                   AQDLARAREAGLAAPLVARLALSEHLLEDMLRSLTVLSLQRDPIGEIIEGYTLANGLEI
FT                   RKVRVPLGVVAVIYESRPNVTVDAFALAYKSGNAVLLRAGSAASYSNAPLLRAIHVGLK
FT                   KAHGVVDAVAVPPVLEEKYGDVDHILRARGFIDAVFPRGGAALIRRVVEGAHVPVIETG
FT                   CGVCHLYVDESANIDVALQIAENAKLQKPAACNSVETLLVHRAVARPFLHRVQEIFATC
FT                   EETTRKPGGVDFFCDAESFSLLTERGARKNVFHAQAETWDREYLDYQVSVRVVPNLEEA
FT                   LRHIARHSTKHSEVIVTRDRARARRFHQEVDAACVYVNASSRFTDGGQFGMGAEIGVST
FT                   QKLHARGPMGLCALTTSKYLIDGEGQVRP"
FT   gene            377102..377992
FT                   /gene="proB"
FT                   /locus_tag="TPASS_0351"
FT   CDS_pept        377102..377992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="TPASS_0351"
FT                   /product="glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70777"
FT                   /db_xref="GOA:B2S2U8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2U8"
FT                   /protein_id="ACD70777.1"
FT                   /translation="MIRALFAAAKKIVIKIGSNTLAQADGTPDEEFLAECARACAALMR
FT                   DGKQIVVVSSGAQVAGISALHCLSSPPQGAGLERHESRGVIPGDGASCKQALCAVGQAE
FT                   LISRWRSAFAAHQQCVGQFLCTKEDFTDSDRAAQVRYTLSFLLERRVVPILNENDALCC
FT                   SDVPSVPADRRVSLSPQKRIGDNDSLSAFVALLWQADLLLLLSDIDGVYDKDPKAHTDA
FT                   QHVPLVTDVSALVGKTSMGSSNVFGTGGIATKLDAARLVTRAGIPLVLANGRHLDPILS
FT                   LMRGDARGTLFVPVS"
FT   gene            378124..378381
FT                   /locus_tag="TPASS_0352"
FT   CDS_pept        378124..378381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70778"
FT                   /db_xref="GOA:A0A0H3BIN6"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIN6"
FT                   /protein_id="ACD70778.1"
FT                   /translation="MREKEGGVVNDDFHYEVTRNWGTLSTSGNGWSLELKSISWNGRPE
FT                   KYDIRAWSPDKSKMGKGVTLTRAEIVALRDLLNSMSLDPY"
FT   gene            complement(378378..378887)
FT                   /gene="rnhA"
FT                   /locus_tag="TPASS_0353"
FT   CDS_pept        complement(378378..378887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="TPASS_0353"
FT                   /product="ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70779"
FT                   /db_xref="GOA:B2S2V0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2V0"
FT                   /protein_id="ACD70779.1"
FT                   /translation="MNAHAALTLYTDGACLGNPGPGGWAFALVPSDVPFLETGQXAPEA
FT                   AAFTRSGSAYPSTNNRMELCAVINALQEAHGRAAEAVVVVTDSQYVRKGITQWIHTWKH
FT                   NGWKTAAKQPVKNKDLWEALSALADALSVEWRWVKGHAGDPYNELCDRLATDAARRAAQ
FT                   STADCP"
FT   gene            379150..379776
FT                   /gene="tmk"
FT                   /locus_tag="TPASS_0354"
FT   CDS_pept        379150..379776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="TPASS_0354"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70780"
FT                   /db_xref="GOA:A0A0H3BI76"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI76"
FT                   /protein_id="ACD70780.1"
FT                   /translation="MNILHNFVVFEGIDGTGTSTQLRALERHFQARKDMVFTQEPTGGE
FT                   IGTLIRDVLQKRVIMSSKALGLLFAADRHEHLEGAGGINDCLAEGKIVLCDRYVFSSLV
FT                   YQGMAVSGSFAYELNKEFPLPEVVFYFDAPIEVCVERITARGLQTELYEYTSFQEKARK
FT                   GYETIFRKCRHLYPAMKVIEIDAREEIEVVHERILHHLREYRRLK"
FT   gene            complement(379743..380126)
FT                   /locus_tag="TPASS_0355"
FT   CDS_pept        complement(379743..380126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ03"
FT                   /protein_id="ACD70781.1"
FT                   /translation="MQGSVQIQKGNISSSYTPEKHPSHPTSANGSMSPKRICELRKEDP
FT                   SSLHKQLLKNSLEKGTEHCDRTTKTYGQIFQLFCLCCAGAAPFYRARAFRLQSTFLIYT
FT                   LHCSSDSVSTSTHYFRRLYSRRW"
FT   gene            380331..380648
FT                   /locus_tag="TPASS_0356"
FT   CDS_pept        380331..380648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0356"
FT                   /product="possible RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70782"
FT                   /db_xref="GOA:A0A0H3BKA7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKA7"
FT                   /protein_id="ACD70782.1"
FT                   /translation="MERGNPIAVERRRFCVMSAKIYVGNLNYATTEAGLASLFSQFGEV
FT                   LSVAVIKDKLTQRSKGFGFVEMESAESAELVINELNEKEFEGRRLRVNYAEEKPRFPFK
FT                   N"
FT   gene            380750..381490
FT                   /gene="birA"
FT                   /locus_tag="TPASS_0357"
FT   CDS_pept        380750..381490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="TPASS_0357"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70783"
FT                   /db_xref="GOA:A0A0H3BKD3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKD3"
FT                   /protein_id="ACD70783.1"
FT                   /translation="MCVAVCLVPVRNPFGASVYFAPKTASTMDEAASRAQGCEEGAVFC
FT                   AGEQVAGRGRGDQRKWQSEPGKNLLCTVVLRRVAFPAFSLCVGYAVALAYMAFLGGVCA
FT                   PRIKWPNDVLVCDRKIAGVLCQVRAGALLVGIGCNLLQVKFPPELSHACSLAQIVGGER
FT                   CPDPFAFLPVLLDRLYACVMAPPSIGVLESCLWKQGEYVCFRECAGTRPPILGRVVGLA
FT                   ADGALCIDSAGSMRSYYSGEIAFW"
FT   gene            complement(381495..383075)
FT                   /locus_tag="TPASS_0358"
FT   CDS_pept        complement(381495..383075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70784"
FT                   /db_xref="GOA:A0A0H3BIP0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIP0"
FT                   /protein_id="ACD70784.1"
FT                   /translation="MKKMPVHSLAFVLDCNLPFVRGAGASSLLAESRFFLEISYTYLPL
FT                   LRLCETLERERVPFNISLAIGPVLCEMLANRVLMDRYRRALDALIEFGEREAIRLRNSL
FT                   QERVQAEAVLRSLRSHRDYFDHCDGALLERINHFFRTGSIELLATTAVNCFLPFYQDMP
FT                   ESISAQIXMGLINYRKHFSSIPRGFYLPELGYAPALERTIKSYGFSYTILETHSFLFGT
FT                   RVPRRGIFEPAQTSNGLWCLGKDRVATAEVHGATHSFCTQAVYGNTEQDAGFILPEEAL
FT                   YPLFEPHKERMATGYLYQARSGTPYEQEKAQRTCVADARAFVRNRTEIFEKVVHATAPF
FT                   EAMSVCVFPASLFGVAWAEGMDWLEAVFRTVAESAQMRVSCTAALTCPAVGVSIIEPFF
FT                   GSSLGGGYADELINSANDWMHPAIQKTTERMIDLTERFAHDTGFRERLLNMAARDVLLC
FT                   QSLFWPLLGNHCRYPEYAASECADHLKAFTRVYEALGSGEVSAQWLMRRERELPLFSEI
FT                   NFRFFSKKK"
FT   gene            complement(383087..383722)
FT                   /locus_tag="TPASS_0359"
FT   CDS_pept        complement(383087..383722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70785"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI82"
FT                   /protein_id="ACD70785.1"
FT                   /translation="MALTKSFLESRSTGELFALADELGLCLPEDLNRRLVIGEILDCYH
FT                   SALDLNPPCAPQSLESKGTSCAYNTTEIHILARDPLWFFVFWDIHEQLFCTLTQSPQFR
FT                   SFFLRVHSLGGHGWHTSLDHFDIDVPLKDRKRYVHLSLADDANRIDLCCKMLQRERILA
FT                   QSRVVTLQRSVIERSLNPEDPTGAEVLSLCGLPLLEETYPSTSLPVCS"
FT   gene            383933..384109
FT                   /locus_tag="TPASS_0360"
FT   CDS_pept        383933..384109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70786"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ08"
FT                   /protein_id="ACD70786.1"
FT                   /translation="MKMAGASKNSRTAAATQRFNCPCGGEVVLRSIVDNGKVKNIAECP
FT                   KCRRVERRPRDFN"
FT   gene            complement(384106..384954)
FT                   /locus_tag="TPASS_0361"
FT   CDS_pept        complement(384106..384954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0361"
FT                   /product="possible lysophosphatidic acid acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70787"
FT                   /db_xref="GOA:A0A0H3BKB2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKB2"
FT                   /protein_id="ACD70787.1"
FT                   /translation="MLPCAVVNQRRRSALMCGILSIVVSIAVLAPLAVANTLCYALYRP
FT                   GCRWVNHAVSTWGARTIFAVLHTYGRLKFYSDYTHAEHLPTQYLVVSNHQSVLDTPALM
FT                   RYFGYIDAPRLRFVAKRELARFVPLVSTMLKSGRHCLVDRHQSGAQAMQALETFTHHVM
FT                   RERWLPVIFPEGTRSRNGALRIFHAAGFRALTARLPLPVVVCALDGGWNLRPLLKIGQK
FT                   LKGSAYRVKVLGVYPAPHNKDEQLSLLREAKALIQAQLDVWRSETTCPQDECLTRASKD
FT                   S"
FT   gene            385030..385266
FT                   /gene="rpmB"
FT                   /locus_tag="TPASS_0362"
FT   CDS_pept        385030..385266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="TPASS_0362"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70788"
FT                   /db_xref="GOA:B2S2V9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2V9"
FT                   /protein_id="ACD70788.1"
FT                   /translation="MARRCGLCGKGTISGCAVSKSMHHCKRVWKPNLLAVRVVVDGSAL
FT                   NMRICARCLRSNPLMKKAQPRANAPLRAAAPKL"
FT   gene            385758..388196
FT                   /gene="cheA"
FT                   /locus_tag="TPASS_0363"
FT   CDS_pept        385758..388196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="TPASS_0363"
FT                   /product="chemotaxis histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70789"
FT                   /db_xref="GOA:A0A0H3BKD7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR010808"
FT                   /db_xref="InterPro:IPR035891"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKD7"
FT                   /protein_id="ACD70789.1"
FT                   /translation="MPMSDYLDAGNEELLKDFFSEAEQQVEQLESNILVIEQDPTNRDA
FT                   VDEIFRAAHTLKGGAATVEMHELSGFTHAVEDLLDGIRSEKVTVDGAVVDLLLTSLDVI
FT                   KAMLESRAGGGPYAEDVSDLVARLRSYLPASGTVPGAARGLSVSSPNAAEAAKGTAVGE
FT                   DGTEAPQVGRVPPLSLLSEYDRLELREIVPPEHSVYALTVRFDESNLMNTVGGIQVFTA
FT                   LKSCASVLKTVPDFDALYQDMFHEYVVYFVSTVQDSVCVSQVASIPDVTLSVSVAEVAL
FT                   ADLCTPLSEHGELGVCADAGTGGVSEGSGAAVRSGGERVPNSLPKQVAGCAVPSAKDSS
FT                   KATSSGYGSGSVLRVDAKRIDYLLNLVSETVIIKASLNQSALEFGEVYTLFQNANGAYK
FT                   ERLRKFFDRVPAYLEKVKNGQDADAVRKGMIAEAVGVFDIFSSFENGLKQSVTKFRSSA
FT                   QNLGRISGELQEGVMKIRMVPISQIFSRYPRVVRDLSRDLRKEVRLVIEGEETELDKSV
FT                   VEDLLDPIMHCVRNSLDHGIEAPEVRARSGKPAQGTLLLRASNEGNMIVIEVADDGRGI
FT                   DVEAVKTKAVERGVLHPGKNLTEVEAFQLIFAPGFSTSRSVSNVSGRGVGLDVVKTHIE
FT                   RLNGTVSVFSEVQKGTRFVIKLPLTLAIIQGLLIRVGQEVYSIPIASVIESHRIKSEEI
FT                   NRIDNYEVFNVRNEVISLLRLDRLFGISCDDEVTGQYHYVVIVGAAEKKVGLMVDALIG
FT                   EEDVVIKPLRDQFTSSPGIAGASILGDGSVSLIIDVGQLLELGLKREILARERREATVW
FT                   "
FT   gene            388190..389557
FT                   /gene="cheW1"
FT                   /locus_tag="TPASS_0364"
FT   CDS_pept        388190..389557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="TPASS_0364"
FT                   /product="purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70790"
FT                   /db_xref="GOA:A0A0H3BIP6"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIP6"
FT                   /protein_id="ACD70790.1"
FT                   /translation="MVGDLGHGLGTMIEHMEAEIGIRESFDGGVREPLAVIDFKMVTFS
FT                   LAGKDYAVDIMQVKEIAKAGSFTYVPNTSPFVLGVYNLRGDIIPIIDLRRFFNIPAPRK
FT                   SRQAIENMVIVTVEDQTFGVVVDGIDKVIGVSKTTIQPPHPIFGDINIKYIRGVVEEAG
FT                   KLYILLDVHRIFSFRLGEEERTAVVDRGVVPSPSPPAVSVPPGDEENLNVGFISDTLAA
FT                   FGRFFTSAVNEGWLRSRYLVWRDVRSGAEVQLQHEEDVAEFLSTFPSPDTGVFWSGEYA
FT                   ASVGSVLSRMQVGKVVTVWNIGCGAGHESYSLAVLLRKTFPDAVVRVHASDSDLFSISN
FT                   APMLTVPEHVIGDWYKPYVVKGVSGSYTFSQEIKEMVLFEYHDCTHPSALPDVDLIVAR
FT                   DVLSSLAVPVQHTLLKEFSEKLKATGVVLLGQNEVMPKDTGWLRQIEGTVAVFSKE"
FT   gene            389579..390043
FT                   /gene="cheX"
FT                   /locus_tag="TPASS_0365"
FT   CDS_pept        389579..390043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheX"
FT                   /locus_tag="TPASS_0365"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70791"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI88"
FT                   /protein_id="ACD70791.1"
FT                   /translation="MRVEYINPFSEAAYVVLSEVLAGETKRGDLYLKSTCMPVMGVAAI
FT                   VGLAGDVEGRVVFDMTLDTALKIASSMNEEKLAAFDELARATITELANLITAKAVTTLH
FT                   ELGFKFDLTPPALFTGDNMEISSSDIEALIVPMETPQGKVEINVAIRDKV"
FT   gene            390056..390490
FT                   /gene="cheY"
FT                   /locus_tag="TPASS_0366"
FT   CDS_pept        390056..390490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="TPASS_0366"
FT                   /product="chemotaxis response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70792"
FT                   /db_xref="GOA:A0A0H3BJ14"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ14"
FT                   /protein_id="ACD70792.1"
FT                   /translation="MISKQDFPTINDRVPAGQKPNGAPYRVLVVDDSMFVSKQIGQILT
FT                   SEGYEVADTAVDGVDGVEKYKAMSPGVDLVTMDITMPKMDGITALEKILEFDKNAKVVI
FT                   ISALGKEELVKKALLLGAKNYIVKPLDRKKVLERIASVLK"
FT   gene            390794..393619
FT                   /locus_tag="TPASS_0367"
FT   CDS_pept        390794..393619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0367"
FT                   /product="possible chromosome segregation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70793"
FT                   /db_xref="GOA:A0A0H3BKB7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKB7"
FT                   /protein_id="ACD70793.1"
FT                   /translation="MLFLKTLEVFGFKSFADRVRVEFADGVTALLGPNGCGKSNVVDAI
FT                   KWVLGEQSSRALRADRMEDVIFNGTESRRSLNVAEASLTVCDEAGILSLDVPEILIKRR
FT                   LYRSGESEYFLNGNAVRLKEIRELFWDTGIGKVAYSVMEQGKIDQILSNKPEERRYLFE
FT                   EAAGVTRFKVRGAEAARKLEKTAENLRHLEVILQEVEKSYESSKLQAAQTQRYRMLKEE
FT                   IFARDRDLGLLRLRGFLENQARADGALQRNRARRDALQTQVEEAQQTLSARIGEINDME
FT                   KRVDALQKEIYGLAIEQKAKQNEASLHRKHLSELKESIGQIEMRKIGVESRVQNLEEEV
FT                   AEQDAHVYQLGSALSSVEEHIESFARSLHVASEHVSENDQTLRDIQGQMQEISAACVEL
FT                   EASLRDVAEDIAAELDTRLSAAGYSARNRAEAERTLVAGVQRLRTFVEGRARIVSDFLV
FT                   VDTHTEGELCRMLTTVVDAFNEAVKIVHCVESDIAEYARVSARFIDEFVAPQGIMTKKR
FT                   EFERQLEQHRAQLERHAARQRTLQEENKLLVGKIEACRKTLESLRVDQARLRAEAEAGQ
FT                   KQAAGTRGEVARQRAVIKELEGELFTEGERVAALEERLLEVEGEIGQLEQRGVLLTKSL
FT                   ENCEGEIRVRNAAVTSEEHALQEARVELAQVGRQLEQAHRELMQCETEIRNLREHFREQ
FT                   HTRDLSEFEDLIPGIEKTASDLRQERGELQARVKEIGAVNFMAVEEFQEVKERYEFLVA
FT                   QVADLEKARADLQRVTDKIKAESAELFLATYRRIRKNFHEVFRRLFGGGRAEIRLSDPA
FT                   AVLSCGIEILAQPPGKKLEHIGLLSGGEKAMTAVALLFATYMVKPAPFCLLDEIDAALD
FT                   EHNVARFVGMLDEFSDVSQYIVITHNRRTVLGARTMLGVTMEEPGVSKVVSIALESASE
FT                   RPANGEAGGAI"
FT   gene            393619..393954
FT                   /locus_tag="TPASS_0368"
FT   CDS_pept        393619..393954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70794"
FT                   /db_xref="GOA:A0A0H3BKE3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKE3"
FT                   /protein_id="ACD70794.1"
FT                   /translation="MRLRGVAGALLGAVVLVALGLMGVWWVFYPKKGDRGAAVAREPVL
FT                   LHIDPAQMEAADEPLTLPPIERSRERMSAWSEQECLRQLEYPTEKAVQALEHANEKRIQ
FT                   QMLEAVP"
FT   gene            393951..395501
FT                   /locus_tag="TPASS_0369"
FT   CDS_pept        393951..395501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70795"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIQ1"
FT                   /protein_id="ACD70795.1"
FT                   /translation="MSVWVALALLGMCVSCTHVPPPRALIVSKEPPPALDSAPRPAIPE
FT                   AVPLPSPVEEEIAGRLPPAPAAAPERVPESSQEREQKPESSKPQVVEPVSLASPVKPRE
FT                   AGSVPDVLPVPEVSSPHVAPPAPPAPTAPRPHRPSPPPVSPSASKPKQRAVPPSPPPAS
FT                   EPPREAEVQAEPEPAEDSPRAMVPEEPPEDEVPRVSRAVQLAVGQKLEVLYPGEGWVYV
FT                   GEHTAQPGLRYHQRKLEESHSLFTFSAEREGDFVLAFSYFDVFRGDFVSDALAVKVVPK
FT                   REGLARVVRAPEYRRTVSSPPDTVVSELSPAGTGTERRAEESGTSGSQRAAAHTGAPVR
FT                   QDQTDTAVAEKAQHGTPRPDEKKDREPTVGGRDPVPSDAVAQGVSERYSPRKISPASQP
FT                   SAPSAAPIEAHVPASAHKEGQEKRDHLAEARQFCAQGNARDALASLGDFFAQFPSHERM
FT                   DEAWFLRGQAYEINGAQRNVRLALEAYKTILERFPHSPYWKKADERARFIKNFFIKIS"
FT   gene            complement(395569..395985)
FT                   /locus_tag="TPASS_0370"
FT   CDS_pept        complement(395569..395985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BI94"
FT                   /protein_id="ACD70796.1"
FT                   /translation="MSAQTQRLHPPFYDKRTQRVNSPFSLPAPKTQEKKYLCLLGTVDS
FT                   VCAPLYDPPLAFTIPQAEVSHMNERNKLLARALYSCVPHVQGSDDYEDDFEDSDFQDGD
FT                   FDDFEDEDGFDDDDDFEDDDFEYEDEDNDLDFDE"
FT   gene            395959..396834
FT                   /locus_tag="TPASS_0371"
FT   CDS_pept        395959..396834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70797"
FT                   /db_xref="GOA:B2S2W8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2W8"
FT                   /protein_id="ACD70797.1"
FT                   /translation="MQSLSLRAHAKVNMHLWVGARRADGLHSIESVMQRITLADSLSLS
FT                   RLDIPGRCEVCSPYMALPRENTLTRAYARFCQVTGVHDGVRVRVVKRIPAGSGLGGGSA
FT                   DAAALLCGLDTLFGTTLSARVLREVAYSVGSDVPFFLASQAACVLGGGEQLVPLVPKTG
FT                   YLGLLVWPGLHSGSAQAYEDLDRLRACGVHAADGEQYSLRGATALSAHYAQDCARWRFF
FT                   NSLDAPVQRRYPVVALARWDLARAGACFTAMSGSGSXVFGLYRDEEELRRAHKLLAKRW
FT                   CWCVRVRLCG"
FT   gene            396843..396915
FT                   /locus_tag="TPASS_t0018"
FT   tRNA            396843..396915
FT                   /locus_tag="TPASS_t0018"
FT                   /product="tRNA-Gln"
FT                   /note="tRNA-Gln2; codon recognized: CAA"
FT   gene            396956..397546
FT                   /gene="ctc"
FT                   /locus_tag="TPASS_0372"
FT   CDS_pept        396956..397546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="TPASS_0372"
FT                   /product="general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70798"
FT                   /db_xref="GOA:B2S2W9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2W9"
FT                   /protein_id="ACD70798.1"
FT                   /translation="MDERRLKGKRRVQLGKYAAVRGRKEGRLPAVMYDHRGVSVPLELA
FT                   QQDFDRLFRALTRSTVLSLELDGGEVFCVFVKDYQHNMVSDRVEHVDFYAVEESVPLRM
FT                   RIRLQLCGSPEGVRYGARLEKGLSYIEVESLPRNLPDRVVLDISGLGAGDVRRVRDVPL
FT                   PASVVVLSDPDAVIVALSSSASEAGSPAGARTG"
FT   gene            397606..399039
FT                   /locus_tag="TPASS_0373"
FT   CDS_pept        397606..399039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70799"
FT                   /db_xref="GOA:B2S2X0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2X0"
FT                   /protein_id="ACD70799.1"
FT                   /translation="MSESRQKLHPLLVHVARSFGHFLVPRKPSCLLVAVSGGADSLALL
FT                   YAAHELAPDFGVCACAVTVDHSLRAQEGALDARFVRALCARFSPPLPCFVQQISAGAVH
FT                   ACAKIRGRGVQDAARALRYKVFDHVAARCGAQVVLTAHTRDDQYETLLMRLFQGAAASA
FT                   LQGIRAARGRYVRPLLKVSRTCVEDFLQTRGVRWREDASNTCRKYVRNRIRHELIPALD
FT                   AVLAGWRSGLDKTFAGISAEHSFCVAALTRWREGCSHAWEPVPRALGTRLRMPRSDFLA
FT                   AEFILRFFLLQEACVRLGVSHRVPRGALERCARFDGVRRIHVSGLQLERAGAYVLFSCI
FT                   HASDTARETKKQDAGSPPSSEKQGVSAIYVARPGAYPCACGTLLVEVRPAGVFVCCAQD
FT                   HVGVGPFSFPFYIRTHRTGDTISIRGGHKGIRKMFSEWHVPLSDRTVLPMIEQDGVLRA
FT                   LYGAALGYQNRYAERTPHE"
FT   gene            398975..401350
FT                   /locus_tag="TPASS_0374"
FT   CDS_pept        398975..401350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70800"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ17"
FT                   /protein_id="ACD70800.1"
FT                   /translation="MRSMAQHLVTKIVTRRGLLMSKGMCPRMGRLCAVSIFCAFSGIQD
FT                   ASCVSEPAPPQDLERNHPGVAARYLQEGRWQEALSQAEQGVASAPQIADFLFIAARASY
FT                   ALQQPRARALQWMARAVAKDMQWCVYDIEEVRLFYARLCVDTLQHARALELLATAEQVS
FT                   ADADWLRARARYGLGQVEHAQELIEKALERWALDARFAKLFFAQERSRRPSSRSKKIAD
FT                   SILSRLSVWQEQDPSLLVEAALFEPRTNMAFRYLQTYFTLRPLDAPGESSAQSSYEQST
FT                   RAGDSAPEQELYARAQSIVLGLQYGVLDEQRAMEMFCTLNSPLAVPAVDPTDDVSSFGV
FT                   HASSVSSSTPLQRVVVLYADLLHEFSRLLASRPIRARFARFLAEFEGVLYTDENRDGIV
FT                   SARVFFKAGRPSRAQFDTNQDGILEYEVYANDGAPTCVHTMHSTQKTELSRASVFPIPQ
FT                   NIAAHDHERAAERWIAPRVSLPADNGVEGETQARVPLTQQGYRVCYDRYPEVHQVGWED
FT                   KTYVLRPRALRWQPVRMQSLDLARDLEGVRSHDFFTMVLTNEPLPTEQQITVSSLYYEK
FT                   PDSLFERARVRTYLDEGLPLFSETHVGSRFRARTHYVDGRATRRDSDRDDDGFFETREY
FT                   YNAQGAVRALSVDVHKDRSFAYQEEYGAKGQKVQKWYGRGRVTISHTELPTGHARTEWL
FT                   HPVTGRHVTVDFVQGVPKRLLVDGEVHALTKDPRNAALYWVRRIPRNGDEVGQRIVESF
FT                   RAATSPVVSEYFRTGGSVVRAVRSGGVVFAEELEPGKE"
FT   gene            401508..401717
FT                   /locus_tag="TPASS_0375"
FT   CDS_pept        401508..401717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70801"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKC2"
FT                   /protein_id="ACD70801.1"
FT                   /translation="MASVFSFLLMSAAGFPTLSTDSSIRSSRNALTLLRWICEAVSAAV
FT                   PVSRPSANCVTYKAVISKFIARIA"
FT   gene            complement(402033..402938)
FT                   /locus_tag="TPASS_0376"
FT   CDS_pept        complement(402033..402938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKE7"
FT                   /protein_id="ACD70802.1"
FT                   /translation="MFFREDKSVAFRLRSAALSGCATGQSDAVTDPLSVLEVSQTETRE
FT                   ALMLFVSYNETGASVTIFTPELVARLSKSYRFLRVEAPHSAYTLSPEARERNRLLFSEY
FT                   EVDGLPFLVLQSAQGDAYFAQRIHSTLSSEQELWALIRSADASRKKVLAARDRIAQTEA
FT                   AEKAIAIDAFLKTVRYPRSARYDALRKEALQADHENVSGLHGDYMFHLARRRAEKFIKQ
FT                   ENLVAAGNAYKDLAQSPFLSASQKQEAWYLTAYTYALSEKVSTEDVVACLRKAVAAHPH
FT                   AARVAQIKQTIKKLLTERGI"
FT   gene            403007..403132
FT                   /locus_tag="TPASS_0377"
FT   CDS_pept        403007..403132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70803"
FT                   /db_xref="GOA:A0A0H3BIQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIQ5"
FT                   /protein_id="ACD70803.1"
FT                   /translation="MLCVLQCPMTEETAQRVIRALRTVAALIVCVLLLGTAGRSV"
FT   gene            403129..403509
FT                   /locus_tag="TPASS_0378"
FT   CDS_pept        403129..403509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0378"
FT                   /product="possible flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIA0"
FT                   /protein_id="ACD70804.1"
FT                   /translation="MRTHSAPRETQTRRTTRGIAQRESAHAVYAELGRLRALSADKQPV
FT                   SVIITPLLQYPAADHALYEELVQKKEQLRRASLAWCAQHTAQELHMLGPEQLKIALRDA
FT                   LNTQLSLGRVTHVFLEEFIILF"
FT   gene            complement(403584..406334)
FT                   /gene="secA"
FT                   /locus_tag="TPASS_0379"
FT   CDS_pept        complement(403584..406334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="TPASS_0379"
FT                   /product="preprotein translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70805"
FT                   /db_xref="GOA:A0A0H3BJ22"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ22"
FT                   /protein_id="ACD70805.1"
FT                   /translation="MLVRTALRLIFGSQHERDLKNLLPLLNAVNAQESWVLPLQESEFK
FT                   QKTAEFKARAAAGEALDAFLPQAFALAREAARRVLGERPYDVQILGSLVLHHGKIVEMK
FT                   TGEGKTLMSVAAAYLNSLSGRGVHIVTVNDYLAERDARWMRPVYDYLGVSVGVILSSMG
FT                   SQERRCAYACDITYGTNNELGFDYLRDNMQFLTEEKTQRDFYFAIIDEIDSILIDEART
FT                   PLIISGPAENDTQHYAEVDRLVGQLQEVERNPATGDYPNEVDGEEVRGDYIVDEKNRKV
FT                   SFSGPGMLHIQDVLTHAGLIQGSLFDEENFKYIHYFTQALRAHLLYRADVDYVVKDGQV
FT                   QIVDEFTGRILEGRRYSDGLHQAIEAKEHIRIAQRNRTMATITFQNFFRMYKKLSGMTG
FT                   TADTEALELNKIYKLEVVVLPTNLPVARVDEHDVVYLSEEEKWSAICDEIKEAHTRGQP
FT                   VLVGTISIEKSEKLSALLRTRGVKHEVLNAKNHAREALIIAEAGAKGSVTIATNMAGRG
FT                   TDIKLGGNPEFRARQSATAIASKHGSSSVTVQEHMQACYEAEYTRWRADYEEVKQLGGL
FT                   YVIGTERHESRRIDNQLRGRSGRQGDPGRSKFFLSLDDDLMRIFGGERLKRFMSRVGME
FT                   PGEPITHSWLNKSIERAQTKVEARNFDVRKHLLEYDDVLNEQRSFIYAQRAQILIDEHV
FT                   VERVYTTIEEYLNREITALRQELKRRGRLSLGAFQQNLSTLFDYALGGEDASGWNETRL
FT                   GTLKQEILAHLKKNIESKYLLAGAQNMDTFIRYQYVQAIDKKWLDHLELLEILRESVYL
FT                   RSYGQKNPLTEYKLEGFDLFYTMLDDIRLSIASQVVRVTVHMEEQRVPRPPHVAQAAHE
FT                   FQALGQPGRGHGSLSALPIQAGAKVGRNTPCPCGSGKKYKHCCGR"
FT   gene            complement(406441..408261)
FT                   /locus_tag="TPASS_0380"
FT   CDS_pept        complement(406441..408261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0380"
FT                   /product="possible DNA repair helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70806"
FT                   /db_xref="GOA:A0A0H3BKC7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKC7"
FT                   /protein_id="ACD70806.1"
FT                   /translation="MTSVPKPLIIQADRSILLDVHAPEAVAARKALVSFAELEKSPEHL
FT                   HSYRLTPLSLWNAASAGFSPQMIAQTLTRFSRFTPPQTVLDWVVDIMSRYGKIRLREDT
FT                   THSTLLRLQVRDAHIAREIAASKSLASHLSPTTACLQDGPLPTPDTARIAQPDTTPQVQ
FT                   GAQTGCSYDFLLPRLHRGTVKQLLLRHGWPVHDEVPLREGTPLSLRLRISPASCPPPST
FT                   AYPCCHTPGTPSFVPRDYQWEAADAFVGNRTQGSGFGVVVLPCGAGKTVVGLLVMGLLQ
FT                   TDTLILTPNSAAAQQWKRELCEKTDLDGTSIGIYSGECKEIRPVTIATYQILTWRAHAD
FT                   APFSHFRLFMERSWGLIIYDEVHLLPAPLFRITAELQVVRRLGLTATLVREDGCAQDVF
FT                   SLVGPKRYDVPWKDLEARGWIARVRCVEVRVTMDRSLQYQYMTAPVRLRHRLASENEAK
FT                   VAVVQRLLRAHAGAPTLIIGQYVQQLLHLAHVLQVPLVSGRQTYAAREAIYQRFREGTL
FT                   QVLVVSKVANCALDLPDASVAIQVSGTFGSRQEEAQRLGRLLRPKICDAHFYSLVTEQT
FT                   VEEDCALRRQRFLVEQGYTYETLRVSEVHE"
FT   gene            complement(408399..409115)
FT                   /locus_tag="TPASS_0381"
FT   CDS_pept        complement(408399..409115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70807"
FT                   /db_xref="GOA:A0A0H3BKF2"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKF2"
FT                   /protein_id="ACD70807.1"
FT                   /translation="MLGAELADTGLFVRFGALHFAIASVAVLLSALFVLLPFALPRLLA
FT                   HKNLARAGVAILFLRLGLMLCGTLLDGRSWRNELPFHLCPAALISGSLYFITRRPIFFN
FT                   LLYFWHFGSFVVVLYPDLTRAHTILYAYLFMLTHCLEPAMVVFSLLHLRERISKRGLQC
FT                   AVLGFLLLAANALFWNRRLGANYLFISKYPLEILRVIRPFFVYQLLFVSALCLLMLVLY
FT                   LPFRPSQHGRNQLFVI"
FT   gene            409199..409321
FT                   /locus_tag="TPASS_0382"
FT   CDS_pept        409199..409321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIR0"
FT                   /protein_id="ACD70808.1"
FT                   /translation="MGAAGKEGAQCQGGDVCELVRHRLTMQADVLESGGVCGRI"
FT   gene            409349..409798
FT                   /locus_tag="TPASS_0383"
FT   CDS_pept        409349..409798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70809"
FT                   /db_xref="GOA:B2S2Y0"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2Y0"
FT                   /protein_id="ACD70809.1"
FT                   /translation="MEDNAFTGAYSYNLDEKGRLMLPARLRVALSDTRLVLTCAIESCL
FT                   WVFPRAQWDRFSSQISARASLFHAPSRAVLRRLIAPAQEVELDRAWRLFIPPSLREYAA
FT                   LEKDCLILGLSHCLEIWDRARYRAYLAESEADFRAGTETLQDLCL"
FT   gene            409795..410934
FT                   /locus_tag="TPASS_0384"
FT   CDS_pept        409795..410934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70810"
FT                   /db_xref="GOA:B2S2Y1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2Y1"
FT                   /protein_id="ACD70810.1"
FT                   /translation="MSLSGHTHTKEEVQAEVEAGEVQCPALCHQPVLVQECLTLLEPAI
FT                   VGISRGADSTRDGAGAFFIDGTLGDGGHTQAFLHAYPALRALGVEIDPSMLARARARLT
FT                   PFGKRLRYVLGWSDVFFASAYASAPASPATGRTAAGAAGVPGAYPAPQAVLLDLGISFF
FT                   HYRGAMRGFSFAEEHMLDMRLDPQASQTAADLLNRLPQARLAQLFFEGGEERYARRIAQ
FT                   AVCAQRRQAPFCSARAFAEVVARVVPPMRTARFGKRRGVLGVLPKLHPATKAFQALRIA
FT                   VNRELERLPRLLTAAFTALAPGGRLAVISFHSREDRIVKVHFRHWAKRCSCPARVPICS
FT                   CGGVARASLITKKPLVPSCVERAANAASRSATLRVIEKR"
FT   gene            410947..411321
FT                   /locus_tag="TPASS_0385"
FT   CDS_pept        410947..411321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIA5"
FT                   /protein_id="ACD70811.1"
FT                   /translation="MREKGAMREKQRRGIPRRQRGMTVQKVSALFFTVSIPVLLCAGVW
FT                   QASRYQAVERVVREYDAEQHRIIAENKRKISGIAILSKPDRIEKLAVEKLHLHRASHAE
FT                   IVRIKLRPAHKDSSPHASEF"
FT   gene            411305..412684
FT                   /gene="murF"
FT                   /locus_tag="TPASS_0386"
FT   CDS_pept        411305..412684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="TPASS_0386"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanine"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70812"
FT                   /db_xref="GOA:A0A0H3BJ28"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ28"
FT                   /protein_id="ACD70812.1"
FT                   /translation="MLLSFDEVCAAVQGARVCDARGARGFDGVSFDSRAVVPRDLFIPL
FT                   RGAHVDGHTFVEEALQKGAVATLIDQRYPHAGEYVAWCTRFGAACIAVHDTLRALQDLA
FT                   SFYCKKFPALIRIGITGSSGKTTVKEMARAVFSERYRVVATPGNLNSEIGLPQSLFFVR
FT                   AEHEVGIFELGMNRRGEMRTLAQILVPHYAIITNVGCAHVGILGTQQAIAEEKKEIFSQ
FT                   FTEHSVGFVPDDAYRVFLSNIPYGRVVVYDQGGRGLATEVIDEGLRGSRVLYQGRWIRV
FT                   PLPGVHNAKNALAVIALAAQVGLPAEEIQRGMERVKPPFGRSHVVCASLTFLLDCYNAN
FT                   PDSMAAALHLCAHISAVSKVYVLGDMGELGVTAAEAHYRVCVLAAASDARAVYVFGPEF
FT                   CRAVRKVSWGRKRVYAFALEELSALQETLDAQLRRGDFVLVKGSRSVALERLEPLLRKE
FT                   R"
FT   gene            412681..413835
FT                   /gene="ftsW"
FT                   /locus_tag="TPASS_0387"
FT   CDS_pept        412681..413835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="TPASS_0387"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70813"
FT                   /db_xref="GOA:A0A0H3BKD2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKD2"
FT                   /protein_id="ACD70813.1"
FT                   /translation="MRPMISIEKNVHQERYSFVFILLVALMVGVGFVTLYSGSVHYAQR
FT                   FFRYPGYFLVRQGVSIGIGLVCLLFFTFVRLASLRKALSPLILVAFALCVCTFFPGIGS
FT                   TRNGATRWIKVFDINFQPSEFVKLVLIVFLANFFDKHREHFDTPIRSIFPPFVVSVIFV
FT                   SVVFFQNDFSTAMFLLFITVVMFFIAGAPLWWFLRGIVVLAPIAVLMIVTSTNRLRRVL
FT                   SFLYPDRDPLGAGYQVNAALEALMDGGLWGRGIGNGVRKIASVPEVYSDFIFVVIGEEM
FT                   GFIGVCLYLMLLFAFTLTGISIALRCANRFNTFLAFGASAAIVLQSILNVAVVVRLVPA
FT                   TGIPLPFFSSGGSSIVVTLSLCGLIINVSGDEKIRREREETVFV"
FT   gene            413813..414628
FT                   /gene="ftsQ"
FT                   /locus_tag="TPASS_0388"
FT   CDS_pept        413813..414628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="TPASS_0388"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70814"
FT                   /db_xref="GOA:A0A0H3BKF7"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKF7"
FT                   /protein_id="ACD70814.1"
FT                   /translation="MKKQFLCRNTEACKYPLVGYMSMRVRVAVLKVVIVILLLVLCVEF
FT                   VFYLFVVPATSFAKVEFSGNVTISPEYLMKAAGLTGKEKWMSLDGFTISERLASVPLLA
FT                   QVEVLKKFPDTMHVHVVERVAIALGFVHVQGRAMPVQIDKTGTVFSVGTAPLDTVLPVV
FT                   SGLEFRNPRVGLRVHDQLVPLFVQLDNLSKRNPLLLGEISEISIEQKRHGGYDLALYLV
FT                   RAPIRVRMDKNLSEEKLRYVILLVDALREWQTQRRIKELDVRGGTAVYR"
FT   gene            414641..415885
FT                   /gene="ftsA"
FT                   /locus_tag="TPASS_0389"
FT   CDS_pept        414641..415885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="TPASS_0389"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70815"
FT                   /db_xref="GOA:A0A0H3BIR6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIR6"
FT                   /protein_id="ACD70815.1"
FT                   /translation="MGEVIVGLDIGTESIRAVVAERLEGGALQVVGVGVGHSKGLRRGV
FT                   VVNIENTVVGIHHAVEAAEMMSGIEIAHCVVGLGGTHIEGRNLKGVVAVADKGKGHREV
FT                   DQSDIDRVLEVACAVSLPPDRKILHVIPKVYSVDDQHGITDPRNIIGVRLEGEVHMITG
FT                   SATCMRSVIDCVKRANLHIDFLMHNGLAAVRSVLNDDERNVGCVLINIGGGTTDVIAMY
FT                   KGSPVLITSIPVGGSQVTSDLAKVKNLPLETAERIKIKDGCCWIPLLEGEGSVLISSQG
FT                   NRIPVEISKREIAEIIEARMCEVFTIVRDRLSTVETQSGRGIIENIILCGGGAQLTGAV
FT                   ELASAIFDTPRVHLGIPGTLGGLAGEYRSPEFAVVLGLILEYTHKQGQRAYQGRAEMER
FT                   AGVFTKVKDIWRNLF"
FT   gene            415931..417187
FT                   /gene="ftsZ"
FT                   /locus_tag="TPASS_0390"
FT   CDS_pept        415931..417187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="TPASS_0390"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70816"
FT                   /db_xref="GOA:A0A0H3BIA8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIA8"
FT                   /protein_id="ACD70816.1"
FT                   /translation="MMNIELAPSGEEFTLSPTVIKVIGAGGGGSNAVNRMMSCGLQCVE
FT                   FIAANTDVQALSYSTAPKKLAIGTKVTRGLGAGGDPEIGEKAAMEDAEAIASALQGANM
FT                   VFITAGMGGGTGTGAAPVIAKIARELGALTVAVVTKPFRFEGRAKMMLAERGIEKLRTH
FT                   SDTVIVIPNQNLLSVVDKRCPIKETYLVADDLLRKSVQSISDLITLPGEVNLDFMDVKN
FT                   TMEGQGYALIGVGEGEGENRAVDAATAAINNPLLEETRIEGATRLLVAVRGSENLSMGE
FT                   VDGVMSVVAKTIDPDAIIIHGTSIDASMQDRVRVTVIATGVPQASISIAGDTHSSQKIK
FT                   TSSYGAVSTGVYISSDEWNRAKSSKQPNLPGLATRNSAVQETRMEKNGVKGHTFGVPLP
FT                   SVNEDLDEPTFLRNRNKGL"
FT   gene            417184..418104
FT                   /gene="codV"
FT                   /locus_tag="TPASS_0391"
FT   CDS_pept        417184..418104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codV"
FT                   /locus_tag="TPASS_0391"
FT                   /product="integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70817"
FT                   /db_xref="GOA:A0A0H3BJ34"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ34"
FT                   /protein_id="ACD70817.1"
FT                   /translation="MKDVDIRVQSFYAYLISAEAHALLTARTYVTTLMLFQKNLDPPCN
FT                   IESANAHDCVRFIEKRSAAGVSGKTIAKDMAALHAFYQFLILEQVRPDNPMQDVDAPRR
FT                   AYSLPRVLSPEQVNTFLQSIPLCTPGGVRDRALFELIYAAGLRVSEAVSLSLSDIFFAE
FT                   RLLKVTGKGNKERMAPFGEQACYFLMQYIREARVRFTSAKHPENSEKKGAVFLNRQGGR
FT                   LSRKGIWKRLQDIEIRSGVETHVHTFRHSYATHLLAGGVDLHSVQCLLGHADIATTQVY
FT                   THVENGQLEACHRACFSSEGLRDEN"
FT   gene            417887..418846
FT                   /locus_tag="TPASS_0392"
FT   CDS_pept        417887..418846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70818"
FT                   /db_xref="GOA:A0A0H3BKD8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKD8"
FT                   /protein_id="ACD70818.1"
FT                   /translation="MKSAQGWRRTFIRFAIHMRRICLQAVSIYIRFSVCSAMQILQLPR
FT                   CTHTWKMDSSKRVTARVFLQKVFVMKTRRCASYVGGALCAAFFFFHSCKERRTVQRVQD
FT                   LEKGVPHPTSIEELRRAVKLHEQRLERLHAVQDQVGVWYKMLALRYFDRKMYTHALDAF
FT                   TQAITFAPENKHLFFYQALCAAYAAKYVAPIDPEKKMQQQAAYRALAVSAYVRALSLDA
FT                   QYSHALYGLSVLYVFELNQPQNAVPHLQKLLELKENTEAALFVLARAYYTLGRYAQAIE
FT                   CYDRILVQSSDSHQRDRARQNKELVTNVSQRATRGDRG"
FT   gene            418843..419751
FT                   /gene="smf"
FT                   /locus_tag="TPASS_0393"
FT   CDS_pept        418843..419751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="TPASS_0393"
FT                   /product="protein Smf"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70819"
FT                   /db_xref="GOA:A0A0H3BKG3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKG3"
FT                   /protein_id="ACD70819.1"
FT                   /translation="MNTDTVLTETHKIALALSYCHFLKGGERLRVSKAVGSFQELTAWK
FT                   VRDFERVVERHIRTAGAQLSALPHLVRHGIQTMRCYQIKMVFKDDDAFPSWLREISDVP
FT                   FVLFYRGTLPCATQPIVGMVGTRTPTGEGVRNSLAFSKACAESGIAIVSGLARGIDGFC
FT                   HKGALAGGGYTLAVLACGVDQLYPRSNSALAARIIETGGCILSEYAPSEHVMRYRFPER
FT                   NRLISGLARSLVVMEAPKKSGALITALCALEQGRDVYVYEPLLESLQNEGGRLLHAEGA
FT                   RALTCVQDMFDDWEYACTGRT"
FT   gene            419784..421979
FT                   /gene="topA"
FT                   /locus_tag="TPASS_0394"
FT   CDS_pept        419784..421979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="TPASS_0394"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70820"
FT                   /db_xref="GOA:A0A0H3BIS2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIS2"
FT                   /protein_id="ACD70820.1"
FT                   /translation="MEVRGLQPKRQKTFARKHLVIVESPAKAQTIEKYLGTQYVVRASM
FT                   GHVIDLPKSRLAIDIEHDFQPEYITVRGRAQCLKELRTLSKQSLQVFLASDRDREGEAI
FT                   AYHLAQSIQAYCDTPIKRIVFNEITPHAIRAAIGHPVPIDTAKVNAQKARRVLDRLVGY
FT                   HLCPLLWHKVKNGLSAGRVQSVALRLICEREVEVKRFVPEEYWTVEGTFEKDKKSFSAL
FT                   LILIQGKKAVFKSKQEATSAIGLFSQSEARVSQIRSFEKNVRPKQPFTTSTLQQCAANR
FT                   LGFTSRKTMQVAQQLYEGVSLGTHRVGLITYMRTDSVRVSEAAVKEVRAWIATHFSDAL
FT                   PGTPNRYAAKGKSQDAHEAIRPTYVAHTPERIKAHLTRDQIRLYTLIWERFVASQMTDA
FT                   RVRSLTFEITAGPAVFSATETQVIEQGFYRVLKMLSPKDLSKAVLPPTKEGEVVALHNV
FT                   QSVQHFTQGPVRYTDASIVKMLEEKGIGRPSTYAPTISVLLDRYYVTRIQKQLMPTPLG
FT                   KVISDLLTTYFHDVVDVSFTARMESKLDEVEEDKIKWNCVIADFYPAFSEKVSTVMKDL
FT                   NSMRGVFDEKTDVVCSQCGDTMVKKLGRFGFFLACGKFPECRNTQPVPLAKCPRPACDG
FT                   NIVGKKTRGRKEFYGCTRFPVCDFVTHFKPTSAVCPQCRCFLVEKSNRRVGTYTACVNP
FT                   ECRYVSPTRKNLSLGKEAVLDGSHRGAQDKGAVQHYE"
FT   gene            421972..422865
FT                   /gene="xprB"
FT                   /locus_tag="TPASS_0395"
FT   CDS_pept        421972..422865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xprB"
FT                   /locus_tag="TPASS_0395"
FT                   /product="integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70821"
FT                   /db_xref="GOA:A0A0H3BIB2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIB2"
FT                   /protein_id="ACD70821.1"
FT                   /translation="MSNEQFTQYLEYLFRVRRLSAHTVSAYARDLNLFERWLQHAQRAC
FT                   ARVTVSDMRLFVCELGRRGLSAASINRVLSVVRGFYVFAKKKHWCADNPARLVRNIKGP
FT                   SKLPRFMFPPQAKAFYTLPSRTDILWQERDAALFAMLYSTGCRVSEIAALSLKDVHPHL
FT                   SSAIVRGKGDRERTVFIAPFAQNFLHVYMQARAQRCARYASCTPALFVNQRGRSLSVRG
FT                   IQYLVSRYVLLAQDVHALSPHAFRHSFASTLIRRGADVRVAQELLGHASVSTTQRYVHV
FT                   TSEQLQDLYHRAHPRG"
FT   gene            423013..423423
FT                   /gene="flgB"
FT                   /locus_tag="TPASS_0396"
FT   CDS_pept        423013..423423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="TPASS_0396"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70822"
FT                   /db_xref="GOA:A0A0H3BJ39"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ39"
FT                   /protein_id="ACD70822.1"
FT                   /translation="MNSFTRTVDLLHRALDVNALRYEVTANNLANAEVPGFKRTDVNFE
FT                   AELKRALDSQRNETSFFKQATAGTNMLSSDVIDYRSVRPRRVLDYLTDVKANGNNVDAE
FT                   QEAMHVLKIQMHYQMLSQMVGFQYRQVESVLR"
FT   gene            423508..423897
FT                   /gene="flgC"
FT                   /locus_tag="TPASS_0397"
FT   CDS_pept        423508..423897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="TPASS_0397"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70823"
FT                   /db_xref="GOA:A0A0H3BKE2"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKE2"
FT                   /protein_id="ACD70823.1"
FT                   /translation="MISDNIANASSTRTQEGGVFRRSRVVLAQKNPGIDWRIPFVPEQL
FT                   DRGVGTGVRVVSIEKDNAPSRLVYDPTHPDAILSGPKAGYVEYPNVDIVTEMVDLISAS
FT                   RAYEANISVISGSKEMFQRALEIAR"
FT   gene            423953..424327
FT                   /gene="fliE"
FT                   /locus_tag="TPASS_0398"
FT   CDS_pept        423953..424327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="TPASS_0398"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70824"
FT                   /db_xref="GOA:B2S2Z5"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S2Z5"
FT                   /protein_id="ACD70824.1"
FT                   /translation="MTPVGTITNSANVYKVPSLRKVPEIGPVSVESVRQRMRGNTDAVD
FT                   QAVNKKAMSFEQTLLRAFDQVNQKQQKTAELTEQMIVDPESVDVHDVTVAMAEASMSLK
FT                   IAQTVIDKVLKSWNDVTTAR"
FT   gene            424444..426147
FT                   /gene="fliF"
FT                   /locus_tag="TPASS_0399"
FT   CDS_pept        424444..426147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="TPASS_0399"
FT                   /product="flagellar basal-body M ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70825"
FT                   /db_xref="GOA:A0A0H3BKG8"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKG8"
FT                   /protein_id="ACD70825.1"
FT                   /translation="MGEWLGQLGVKLKTQWKKWTLVQKSVLAGAALVSVMGVVVLLTWS
FT                   AKPTLVPLIDTPITDETVREKIILRLNEENVRATVSSVGLISVSDEKTARRMRSILIRE
FT                   DLIPKNVDPWAIFDVERWTRTDFERRVDVRRAINNTVTNHIKALDDIDDAHVVINVPED
FT                   ALFQADQKPITASVVIFPKPSSTIASERKKIEGIQKLLKLAVPGLKDENITIVDSDATV
FT                   LNDFEGFKDADRLSLIEKQQKMIAKLESQYEAKVLALLQKTYGKDRVRDLNIKIEMDLS
FT                   EKTSQTTKYLPIEIRQDNPDTPWDDSQVVPSVTSISETATTTWQGTGLNPEGPPGVEGQ
FT                   TPPAYKDMSNQVGLSNQSVVKKQEAISKSEINEVVSPVLGRRTVSVNIDGEWRKKRDEH
FT                   GRFIVKEGHIEREYIPISAEELREATKAVQDAIGFDAGRKDSVSVLNIKFDRTSEFDRE
FT                   DEHYLRVQQRNMIILYSLASVAIVLFIFMVYKVISKEVERRRRLREEELLRQQQLMRER
FT                   ALWEAEQAGMNVSMSVEERKRLELQENVLNMAREHPEDVALLVRTWLMEE"
FT   gene            426152..427210
FT                   /gene="fliG2"
FT                   /locus_tag="TPASS_0400"
FT   CDS_pept        426152..427210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG2"
FT                   /locus_tag="TPASS_0400"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70826"
FT                   /db_xref="GOA:A0A0H3BIS8"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIS8"
FT                   /protein_id="ACD70826.1"
FT                   /translation="MAVTSVKDKLATGEKKQRDIKSLNGRQKAAIFLVSIGEEISAKVM
FT                   GELKEDEIEKLVFEIARTESVDAELKDAVLEEFQELMTAQNFITSGGIDYARGLLEKSL
FT                   GSQKAIEIINRLTSSLQVRPFDFIRRTDPTHLLNFIQQEHPQTIALILAYLEPNKASVI
FT                   LQNLPDEIQSDVARRIATMDRTSPDVLREVERVLEKKLSTLSSEDYTAAGGVQNIVDIL
FT                   NLVDRSSEKSIVEALEDEDPDLAEEIKKRMFVFEDIVMLDDRAIQKVLREVNMEELAKA
FT                   LKVVDTEVQDKIFRNMSKRAGSMLKEEMEYMGPTRLKDVEEAQQKVVSIIRHLEDSGDI
FT                   VIARSEEDEMIV"
FT   gene            427258..428187
FT                   /gene="fliH"
FT                   /locus_tag="TPASS_0401"
FT   CDS_pept        427258..428187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="TPASS_0401"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70827"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIB6"
FT                   /protein_id="ACD70827.1"
FT                   /translation="MPKMIFRNHEVKNLDQFLLLDLSRSFGVEPQIEEVQSEPVCPVPD
FT                   MREVQEEVELFRKSWEEEQVQLRARAEREAQDLKERVEEEITAYREQCTQEADRILAQA
FT                   KEQSELQISEAQQQAERMIAEAETSRQKICDHSKAEGIRLGKEEGFRAGQEEVRYLTER
FT                   LHKMIEEVMGRRQGILRETERQIVDLVLLMTRKVVKVISENQRAVISANVVHALRKVRT
FT                   RGAVTLRVNLADVELVTQHKQEFIAAVERVDDLTVVEDTSVGRGGCVVETDFGEIDARV
FT                   ASQLHELEQRVLEVAPIVVSSMSASKGS"
FT   gene            428215..429558
FT                   /gene="fliI"
FT                   /locus_tag="TPASS_0402"
FT   CDS_pept        428215..429558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="TPASS_0402"
FT                   /product="flagellum-specific ATP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70828"
FT                   /db_xref="GOA:A0A0H3BJ46"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ46"
FT                   /protein_id="ACD70828.1"
FT                   /translation="MEADLLCKYEVALRESEPVKYVGHVTAVRGLLIESRGPHAVVGEL
FT                   CRIVLRRQGRPLIAEVVGLAGSTVKLMSYTDTHGVEVGCAVVAEGAALSVPVGDALLGR
FT                   VLNAFGKAIDGKGEIYAPLRSEVLRASSNPMERLPITRQMVTGVRVLDSLLAVGCGQRL
FT                   GIFSGSGVGKSTLMGMIARNTDADVSVIALIGERGREVMDFVAHDLGPEGLKRSVIVSA
FT                   TSDESPLARVRGAYTATAIAEYFRDQGKQVLLLFDSLTRFAKAQREIGLASGELPATRG
FT                   YTPGVFETLPKLLERAGSFSMGSVTAFYTVLVDGDDLDEPISDAVRGIVDGHIVLSRAL
FT                   AQRNHYPAIDVLQSVSRLAHRVLGADMKEAVRIVRRALAVYAEVEDLVRVGAYQQGSDA
FT                   ELDRAIAMRAELERFLTQGAQERVRFQDTVTSLSMLTGLSIAQPPSGV"
FT   gene            429587..430039
FT                   /locus_tag="TPASS_0403"
FT   CDS_pept        429587..430039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0403"
FT                   /product="possible flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70829"
FT                   /db_xref="GOA:A0A0H3BKE8"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKE8"
FT                   /protein_id="ACD70829.1"
FT                   /translation="MKRFCFSLERVRRLRAFRVRELEVELSKVLAEYGSIDTQIRSIAG
FT                   EYRARMQDVAPKRGAVFSAASVSAVQDQIDVLQLRREQLLHKQAHLSFTLEQLRERYAH
FT                   ARRAHEALLMLEEKEKTRWREQRLRAEDRACDDLVSARVPGAPSKH"
FT   gene            complement(430036..430569)
FT                   /locus_tag="TPASS_0404"
FT   CDS_pept        complement(430036..430569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70830"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKH3"
FT                   /protein_id="ACD70830.1"
FT                   /translation="MKVYIHPAEQHTQRTSYLLCNLSLNEALLIDAGHVSTHLIHTIEK
FT                   NSCTLTAVFLTRTDDATQAGVRTLLRVYSPHIFCGEKCWNAHESTLLQGDCSLNCAGFT
FT                   VTCFASPAYGCYLYRIAHLAFTGDLCSAGYEEAGNEADTILERACTAHETLILFHGHGP
FT                   PSSYTRARTQRASH"
FT   gene            complement(430566..431015)
FT                   /locus_tag="TPASS_0405"
FT   CDS_pept        complement(430566..431015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0405"
FT                   /product="possible protein McbG"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70831"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIT4"
FT                   /protein_id="ACD70831.1"
FT                   /translation="MYAPRMRLNRVDFSGFHFVGCNFFNTVFNACVFANVVMRMCFFER
FT                   CYLVNSSFTEADIQFSSFEGSILHTVSFAHAVLLSDNFNRIHAQDVSFQESDLSHTRFL
FT                   HATLATVRFENCTVQHTHFMPSHTTHCTFKGSSTEHARIYLSDLP"
FT   gene            431206..432012
FT                   /gene="murI"
FT                   /locus_tag="TPASS_0406"
FT   CDS_pept        431206..432012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="TPASS_0406"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70832"
FT                   /db_xref="GOA:B2S303"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S303"
FT                   /protein_id="ACD70832.1"
FT                   /translation="MSDRREQFQYAFLDSGIGGLPYAHALRVRVPEASLVYVADRVYFP
FT                   YGNKSSAQIIARASAVLQKVQTNFSPHIVVLACNSMSVNALEFLRAQVSVPVVGVVPAI
FT                   KQAVACSHKKHIGVLATQCTITHPYTACLRAQFGAGCVFQMRADARLIECLERGLIFEV
FT                   EDMQREAVARSVMPFQEAGVDVLVLACTHFVHVRHLFQDCVGTSCTVVDSLEGVVRRTL
FT                   RLCPPQSQLRGNAACYVTGARDAVCAARYARYAQHFGLRWAGFLDV"
FT   gene            432140..432814
FT                   /gene="gph1"
FT                   /locus_tag="TPASS_0407"
FT   CDS_pept        432140..432814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph1"
FT                   /locus_tag="TPASS_0407"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70833"
FT                   /db_xref="GOA:A0A0H3BIB9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIB9"
FT                   /protein_id="ACD70833.1"
FT                   /translation="MAFDIDGTLYPGWRLALRVMPFMIRNARLMRAFRAVRQELRREQR
FT                   TALIPFEDFFFAQATRIAPRVGLSAEEVRAFLDTALYRGWRRHFLHIKPFPHVLSSVLE
FT                   LRRHGLKIALLSDFPPSQKGCLWGVRALCDVTLGTEEIGSLKPSPRAFYALAQRLNLRC
FT                   EEILYVGNSVHDVEGAHAAGMRIACVRRPFTSLRVRRTRGLALFRLSHIVRICDSMSAG
FT                   AG"
FT   gene            432893..436147
FT                   /locus_tag="TPASS_0408"
FT   CDS_pept        432893..436147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ51"
FT                   /protein_id="ACD70834.1"
FT                   /translation="MEYFLTVVIACAISLVMVAFSRQLDKGNRSLEKVKRYADYIKEDL
FT                   ESFSAEKIAMLKDAAIELNVKQEQAIASVKKMDHLYDQFMKKSTALAAANMAVEKIHRE
FT                   VQASEKDVCTLREQVAVAQGLIAEVNKESSFVDSLSKRVAAAKTQLQQVSAAIPDMQNA
FT                   FTRENTALLHRVRDGVLADVHKELAVLQTRLEKAQGESQSLFEVSAVKLRELYEGAFSE
FT                   ATVRAQVLEENGFGQLKVQAENRLLQLQEEFEGSLLSLQQHVMQRVEQTDQHIQDCASQ
FT                   WSVRAQTCESDLSIRLADVTACVDESVAQLKEQITTQEREVRAHLEGIEQSLSGAESGL
FT                   RERVHKSVTSFHENLNKIAEASDAQLQQYRKEMDGRCSKFDRELEGIDVLESQLQLARE
FT                   RTEQKVREEFEAYAQDRERKQLAFEAQLQHSMDTVEHRMKQLNDELRELKASAYANASE
FT                   KLQSVEDNFFEVLTKRSDSLHARFSEWSEGIEGRLTQLALESESARKDLEDTYRKELHT
FT                   RLKDFVEEYKGQCTKLGEQILAIESNVKQHMRANDDLFQRHTEKFTIDVAALHDKAHNL
FT                   IERELEAVRQRLRDSLHVHSSMIETEVRDMNVLVQEIKQEAQGGCGSVKRDIEAWKAHT
FT                   DKQFADAKQLFEGKIAHLVNLSERAIENLSARYDMQYEDFSQKNGESLQSLRDEIGKMC
FT                   DTMRTVKEELGGYVNTVTGQLHADGRRESEALHKTVKEARAQVDRTLQETRDLVQDLRA
FT                   EFGEAQVGLLTKLQGESDRFSQVLQEIERKQHEFIGQTRIFDRADELRENLEKDIERLT
FT                   ETVTRFEVYREAMDKLSLQYEKVKHFGEEAEQRVEKFMQERKNIDLLEGEFSKLAALSD
FT                   AMDKKIVELTLANDDLQRYQVQIRKVKEGLGDISTRYERLDKKGAVLDQTVQDVDRAFE
FT                   NLKELEKTLKNFRGELETVDPQLQRVRAEIAVLLDNQEKAERVRSRIECADALLGEMES
FT                   RIEKMQHAREWLAGTETRLQEISKVSEGQLRLLGDLMRQDPANKIPGAGAPPLATRQNV
FT                   VKLHKSGWSDDAIAHALKISKGEVQLILELPDMDSF"
FT   gene            436187..436372
FT                   /locus_tag="TPASS_0409"
FT   CDS_pept        436187..436372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKF4"
FT                   /protein_id="ACD70835.1"
FT                   /translation="MIDWIVFFALAWGRARVSCALKDENNAPSNSFANHYGERWLDPTA
FT                   RYRRRMSDLLPFCFCA"
FT   gene            436637..438388
FT                   /gene="secD"
FT                   /locus_tag="TPASS_0410"
FT   CDS_pept        436637..438388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="TPASS_0410"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70836"
FT                   /db_xref="GOA:A0A0H3BKH8"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKH8"
FT                   /protein_id="ACD70836.1"
FT                   /translation="MSKKARFGVVLVVLAACSGFLFPTLQWYFLTDAQTRQRALSSREQ
FT                   IKEYAVQSAERDLADLTRLARAGSDEDISARYAPLVAAARQNLSYSGRPAPSRWTAAAL
FT                   VSAFPVKSEQGFVLYARPLMEQTYREAVLKMKRRQAQAVKLGLDLSGGTSVVIKADLSE
FT                   VTKGVPDAERAAIRSEAMALVLSTLENRINRFGLSEPVIRRQGEDRVYVEIPGLTDRDR
FT                   VHSIVMGRGVLAFHLVDDDATQKLLDHYRNNPQGTFDAAHQLHDLSLVPEHTSVLGVYR
FT                   KDSYGLDVRDGFLVVKKEPALEGRHIRDATVSSGRANEPLVLFDLDHEGARIFSELTTK
FT                   EIGRRLAIVSDGKIRSAPAIREPITAGSGSISGFSAEEAQNLKTALRSAWLNVALEIEN
FT                   QQVVGASMGEESIRQGTRALVWGLCAVLLFMLVWYQEAGVNACVAQLLNLYIMFGVLSA
FT                   FNLTLTLSSIAGMILTIGMAVDANVVVFERIREELALGKSRGAAVCSGFERAFWAIMDS
FT                   NVTTFIAALFLSVLGTGPIKGFAYSLAIGVVSSVFTALFVSRLMFDYGTEVLHKKTVRI
FT                   GWRIARV"
FT   gene            438385..439647
FT                   /gene="secF"
FT                   /locus_tag="TPASS_0411"
FT   CDS_pept        438385..439647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="TPASS_0411"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70837"
FT                   /db_xref="GOA:A0A0H3BIT9"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIT9"
FT                   /protein_id="ACD70837.1"
FT                   /translation="MRQVVRFSLLFLPCAILSVVLIGAGVLRWALWGMSFGIDFQSGLI
FT                   ERLRIAPPAFSLVYTGTQSMQFFQDEQKVVFTVSSPGVLGERYEFLYTEYPTLRAFSEG
FT                   AKKVEHLSVTLHAPETVYMRDTFSGAEGSTLSSASCFVHYFSEDVRAPGVEELRRVLKD
FT                   VPSAVVQQVGVRAEHTFQVRVAAETAFPSSLLPEQGGTALAQSDAPDLVTPQGAVESVV
FT                   YAALVRAYGADHVVRLAMDFVGSRFSHLLVRQALLLVLGALVLIFLYVALRFRWFFALG
FT                   AIVALVHDACIMVSFMVWFGLEFNSASIAAILTIIGYSINDTVVVFDRVRQTILLDPIA
FT                   SVTTVLDRSQTDMLTRTVVTTVTTLLAALMLYVFTEGGSRDFSLALMVGMVSGVYSTIY
FT                   IAGGCIALISRGKSGGQLLGL"
FT   gene            complement(439723..440028)
FT                   /locus_tag="TPASS_0412"
FT   CDS_pept        complement(439723..440028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70838"
FT                   /db_xref="GOA:A0A0H3BIC4"
FT                   /db_xref="InterPro:IPR006628"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIC4"
FT                   /protein_id="ACD70838.1"
FT                   /translation="MGIRGELFTTEVQAENRTYFFNVKENRVGDVFLQVVESKNVDGAG
FT                   FDRHAVVVFEEEMQKFLQGFNRSLDFLEKNKKERLHLRQARSLHTRGERKTIVRKK"
FT   gene            complement(440047..441945)
FT                   /locus_tag="TPASS_0413"
FT   CDS_pept        complement(440047..441945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0413"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70839"
FT                   /db_xref="GOA:A0A0H3BJ56"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ56"
FT                   /protein_id="ACD70839.1"
FT                   /translation="MSLLNSLITSLTLPQPAQPLHLSLTRSPSGWRKVFPYAFTPERTV
FT                   TLTQKADAVLSAQVALSYARFLKKKVPKPRVVIARDSRPTGEIISSICTAILHLEGCSL
FT                   RCVGVGPIPEIASYARNYDAFLYISASHNPIEYNGFKFGLNDGGVLSPTQAQQLSEDFV
FT                   AQCLQPASFQKIREHCATLNASILEPLLYNKTHKQESLHSYDLFIREVIANSPKETEHR
FT                   AFFHRFTQQRAAYSEQGTPLSILIDFNGSARAASIDRRLLESLGVALFSIAETPGDIRH
FT                   RIVPEGSSLTACAQALTEAATRGSSPEERSIAFGFVPDCDGDRGNIVYYDQTLNRAVIP
FT                   HEQAVFALSVVSEICELSRNLRMQPHRAPPIALVTNGPTSLRVEAIAQLLDVHVFRTEV
FT                   GEAHLIEKAHLLRKEGYCVRILGEGSNGGSILHPAAVRDPLHTVFALLKLLLLRGDGKQ
FT                   PGLFAWWCAHSHQTERAQHAFTISDLFASLPAYTTTPTHDTRALLQIRTTDHALLKSAY
FT                   QRVFERRWAQEKDTLKKRFGICSYRPILYRGREQQDAAGDFSRSADGGLKIQFYNEHQE
FT                   AVAFVWMRGSKTEPIFRISADLKGNDEAGEAALLQLHADMVREADRCALSCADTTS"
FT   gene            442048..443403
FT                   /gene="dagA"
FT                   /locus_tag="TPASS_0414"
FT   CDS_pept        442048..443403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dagA"
FT                   /locus_tag="TPASS_0414"
FT                   /product="D-alanine glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70840"
FT                   /db_xref="GOA:A0A0H3BKF8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKF8"
FT                   /protein_id="ACD70840.1"
FT                   /translation="MGVVEWVGEWMHAVVWSFPMVVLLLGTGCYVTVCMKFFPVVRLWY
FT                   VLRQTIGGRGGKKGGSGEVSAFRAVSTALAATLGSGNIVGVATAIAIGGPGAIFWIWVT
FT                   GIFGMGTKFVEVVLAVYYRRQTGDGRFVGGPMYYLKDGVGVPGAGVLASLFCIFSVIAS
FT                   FGIGNMTQSNSVALVFEDVFCVDVRVTGAVLMVLVGLVSVGGLKSISWVTGVMVPGMAI
FT                   LYVCVGVVLVCCNTRQLVPVCWDIVSGAFAGTAAVGGFAGSVVRQAIAVGISRGVAVNE
FT                   AGLGTAPIAHAAAITDHPVRQGLWGIFEVFVGTMVVSSVTAFAILLTGVWQGGASGAAL
FT                   TVQSFERGLPFGIGQYVVGVSVPLFAFTTMLGWLYYGERCAEFLCGPRVCPLYRAVWLP
FT                   FVYVGAVGSLSSVWNISDAFNGLMALPNLVGLLFLARQGMRLREEFFAQQEG"
FT   gene            443384..443917
FT                   /locus_tag="TPASS_0415"
FT   CDS_pept        443384..443917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKI3"
FT                   /protein_id="ACD70841.1"
FT                   /translation="MRSRKGRGARRWMSHENGVAVHGNVGVEGARKFLESRCVLKEAEG
FT                   GEICWSVIVEKKVDDIRVKGEQHGGFLCAGMWGDFVGTGEERIAGRDRTEEAHVTGKEG
FT                   KVFRRQGVEGGTLRVRLEKCRIVGWGMYGGPGVVRVFCARSGAHSALSAKRAQAAYLAM
FT                   WPSIGCISFRVCPA"
FT   gene            complement(443864..445222)
FT                   /gene="ffh"
FT                   /locus_tag="TPASS_0416"
FT   CDS_pept        complement(443864..445222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="TPASS_0416"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70842"
FT                   /db_xref="GOA:A0A0H3BIU4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIU4"
FT                   /protein_id="ACD70842.1"
FT                   /translation="MFEQLSASFKRIVGALGGRATISERNIQEAVESIKRALLDADVHV
FT                   RVVRRFVNQTIQHAQGQTVLASVSPAQQFIKIVHERLTAFLGEHTRSLHLKGPDTQSII
FT                   LLLGLQGSGKTTSAAKLAAYLKDAGRSPLLAACDHVRAAASAQLAVLGTHIGVPVYQHA
FT                   LPHEQQPCALDTARGALQYARSHGNDVLIIDTAGRLHVDAALMQELILLKETLVPVETL
FT                   LVADALTGQTVVRIAEEFHAAVGISGVVLSKFDSDTRGGAALSLKSITGQPLLFVGTGE
FT                   RPQDFEPFHPERAAGRILGMGDIVSLVEKAQKAFDAQEHARAQKKTQSHERFTLSDMLD
FT                   HLQTIEKMGPLHSLVEMIPGLAVAVSADALDARAFKRQKAIIQSMTVQERDNFLIIGPS
FT                   RRRRIAAGSGTSVADVNRLIKNFERMRTLMRKTAWQSRRAHPKGDTPYGWPHR"
FT   gene            complement(445215..446894)
FT                   /gene="cutE"
FT                   /locus_tag="TPASS_0417"
FT   CDS_pept        complement(445215..446894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutE"
FT                   /locus_tag="TPASS_0417"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70843"
FT                   /db_xref="GOA:A0A0H3BIC9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIC9"
FT                   /protein_id="ACD70843.1"
FT                   /translation="MLCTAPLVSSAASAVLLAFAIPNEFWLAGSSVLGLGALVPLYVGF
FT                   LLSPAKKHVACSYGLFVALVHACSSFWLKNFQGFALFTLGASTVGYFFYALPFGVAFAC
FT                   ILRKQAPARACAFALVWTLWEWVKSTGILAYPWGTVPMTAHSLSHLIQIADITGVWGLS
FT                   FLIPLANACVAESLHFFIKKRDSVPVFRLWLLTGCLYCLCSLYGAYRIATLGAPRTTLA
FT                   LAIVQQNADPWDTXSFEKNLTTAIHLTETALRTQTAPPLPTTPYRKEKTLTHASARAPV
FT                   DMVVWSESSLRYPYEQYRHVYNALPAARPFSAFLRTLGAPLLVGTPLRLSGNSTKGGYA
FT                   NAVALLRPDGHVAQVYGKMQMVPFAEFIPWGHMTSVQRLAQMLAGFSESWTPGPGPRLF
FT                   HVPCAAGGSVRFATPICYEDAFPSLCAALHTQGSELLINLTNDSWSKTASAEWQHYVVS
FT                   LFRAIELRTTLVRSTNSGYTVVIGPEGKTRAAFPLFQATSAVLHVPVYPVVRTYYARMR
FT                   DWVIVLCALIFFAEGVRMAVHTRRHSTTQAESSLQQIRGEHV"
FT   gene            446921..448114
FT                   /locus_tag="TPASS_0418"
FT   CDS_pept        446921..448114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0418"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70844"
FT                   /db_xref="GOA:A0A0H3BJ61"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ61"
FT                   /protein_id="ACD70844.1"
FT                   /translation="MLYYFNTLAMMLRMQRVESCHTEEYGDEPEAIAVVPGRFHLLGEY
FT                   LWFAQGNTLSMAIDQTLTLCVSRRKDSTFRLFSLTLGERRKISTANLRYRKEDRWANSV
FT                   KAVILSFMDGGYHLTGLNCTILSQIPPDAGLGTPNALKVAMALVLGRLFAATLPKESVV
FT                   SIVEHANERYLKTHAHRADILCVLFAKQGSCVRTDHRKKQAELCQFPSEGKRIVLTDSR
FT                   VPRFIAREEFTARLKRCVDAYELVKRNPDMPRAMSKLMAAALEEIDVPEGIRRRVISLV
FT                   RESLGVDEAIEALRKRDFAAFSRVVNRSHERLRDRFEISCPELDWLVKRALEFVDPDAP
FT                   DVVCSRLTGRGFGGCTYAILRDQDFEPYLERLDEYERIFGFKAAAYEVQCSEGARVL"
FT   gene            448111..448674
FT                   /locus_tag="TPASS_0419"
FT   CDS_pept        448111..448674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0419"
FT                   /product="possible survival protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70845"
FT                   /db_xref="GOA:A0A0H3BKG2"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKG2"
FT                   /protein_id="ACD70845.1"
FT                   /translation="MRILLTNDDGYQAAGIRALHAALKAAPEGYEVTVVAPDRDRSAVS
FT                   HGITTLEPVTVKEVEPGIWSCSGTPVDCVNRALRQVCVGTPPDVVVSGINEGENLGTDI
FT                   VFSGTVAAARQAVMYGIAGIAASLLPVSDFGTGCRFQALARFVARHVRALAALSSEDVL
FT                   VNINARSAQAYARACYARVASSDI"
FT   gene            448655..448882
FT                   /locus_tag="TPASS_0420"
FT   CDS_pept        448655..448882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70846"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKI8"
FT                   /protein_id="ACD70846.1"
FT                   /translation="MRRRIYEERGAVRQAGLAHVFEYQGGAAHTGAVQDSDWAVVMRGD
FT                   IAITLVYAQPVSMPPVLPLPDFAFQACCSY"
FT   gene            449016..451067
FT                   /locus_tag="TPASS_0421"
FT   CDS_pept        449016..451067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70847"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIU9"
FT                   /protein_id="ACD70847.1"
FT                   /translation="MRGGWCLSRRSVGCAGALLLLFAVGAQEHAPPVVRDTALAAGEFR
FT                   RGVLAYYRGAFNDAIQLFERALSAAPRNPLILEWLGNAYYRSGIEGAALHQWGAARDLG
FT                   YGGALLRNKIEVVQQRRDFAPDSADALHFSESESFHAVRRGTVLFRRPLSLCALADGTF
FT                   WMSAYGSNELLRFDVNGRVIARTRGPVEGFDRPFDVIQTRSGDLLVSEFASDRICRLTK
FT                   EGRFLKSFGGKGRGVGQLIGPQFLATDRYDNIYVTDFGNARVAVFAPDGAPLFHFGQKS
FT                   ARFFGFSAPGGIAILDELVYVADALKGAIYVFDTAGNYVRTLVAEGTLKHVESVRAWNG
FT                   RLLVSLPNEVMVVDVGLASLHTIARLGNAPIRLTAAVPDANGNVLLADYKNERIEIVSR
FT                   ISELAGGLFVHFERVHADRFPSVTVNVSVHTREGTPVVGLDVSNFFLTEEHRPVSEMRL
FT                   QGAAYLNDTCSLSILVDRSPATEQEMRLVTRVIGELAQAVGEQGTLSVVSAAQSPVLEG
FT                   TFTAAQLQAQPLRLRAKSSSQWRFDLGLRLAAGTLVNADYKRAVVFLSLGELQTQDFAQ
FT                   YGVTDLAAYLTNNETSFYVIQLQRTVLPVELGYLVQKTRGAVYSVYAQEGLGALVAHVR
FT                   SGAAGTYALSYRSRLPTDFGRAYMPVEAEVRVLSRSGRDETGYFAPLE"
FT   gene            451051..452076
FT                   /locus_tag="TPASS_0422"
FT   CDS_pept        451051..452076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID5"
FT                   /protein_id="ACD70848.1"
FT                   /translation="MRRLSDRLRGMTGKGWSAWVRLCVLSTQVGLAAEPALARLAGVWE
FT                   NATRIVAIAPTADAMRFSLMLVHKPYYAYVYERVAVFSLSSLSDARADVLPPPAAQKAE
FT                   RVDLVLSFEGRVRVQPLVLCRWGDALFCSFFQRVSYGTRSGSVSSEQIPVRTDDPLFGF
FT                   WIEEGSAEALRAYSSQAPGELNAFFFTEANFYRFRYWRDDALAFAAQRAYFTADDGVTY
FT                   EIPQYVQRGAAVYSCTTGRSRVVRNFQTGTYEVRTSSDGSKRLMLRRRGAGPGSYAVGA
FT                   VYPRQGFLDESALALRVDGQFLAIGEPFLRKSAVHDVTAFIDAHNARKRAPRAPLLVPD
FT                   F"
FT   gene            452101..452907
FT                   /locus_tag="TPASS_0423"
FT   CDS_pept        452101..452907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ65"
FT                   /protein_id="ACD70849.1"
FT                   /translation="MRVFVSWHKQKDKGERERAGALQGACIGTPEHRQVFALVGRSGSG
FT                   KSFRAQIVMRRFDIAFVIDDGLLIREDKIIAGRSAKQERTLLAAIRVALFENTMHRRVV
FT                   ARVLTYFLCGSQNKKVLILGTSERMVRRIALRVGLPEPGHIIRIEDIASSEEIACALRT
FT                   RHVEGTHVIPVPSGEVRKSYPKIFYERIKLLLRREAGAERIGRWAHAIWHEGLKRACSG
FT                   AHAHVFEKSIVRPPFSCNLRVVAATEGTQDASPVVVPPHEELALQQ"
FT   gene            453110..453808
FT                   /locus_tag="TPASS_0424"
FT   CDS_pept        453110..453808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0424"
FT                   /product="possible V-type ATPase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70850"
FT                   /db_xref="GOA:B2S321"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S321"
FT                   /protein_id="ACD70850.1"
FT                   /translation="MLGESREEAERIVRAAREEAERIVRAAREEAERIESSSLAALSQA
FT                   SRNVLLSFQDSVTRSLRAIISMETAQAYDAGVLRELIPRVVSAWVQAEGDKLELILSPA
FT                   DLRTLEGVFCAALQEQLSAGVELRSDDCLTAGFRIVPAEGGSYYDFSAAAVAQLFSSYV
FT                   SARVAEVLSLLRRSCDVFLLLPYNAATISSMRRGASFALSGFFGLCATFLGSAGCCGAW
FT                   KYLVVSRAGA"
FT   gene            453786..454046
FT                   /locus_tag="TPASS_0425"
FT   CDS_pept        453786..454046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKG7"
FT                   /protein_id="ACD70851.1"
FT                   /translation="MCPVPARDSTGSRVLDRWGEFEYALRCALARERADRLRWDTPVEV
FT                   RQCPVAQESVARAARVAVSLDDPLEAGVFFERRALFLCRGV"
FT   gene            454188..455957
FT                   /gene="atpA1"
FT                   /locus_tag="TPASS_0426"
FT   CDS_pept        454188..455957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA1"
FT                   /locus_tag="TPASS_0426"
FT                   /product="V-type ATPase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70852"
FT                   /db_xref="GOA:A0A0H3BKJ3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKJ3"
FT                   /protein_id="ACD70852.1"
FT                   /translation="MTQTKGIVSAVNGNMVSVTFEGVVSLNEVGYVHVGNARLKAEIIR
FT                   VRGREAQLQVFEITRGVSVGDRVEFTGDLLSVELGPGLLGQVYDGLQNPLPLLAEKVGY
FT                   FLERGVYLPALSRTSEWMFTPHVSVGERVVRGDVLGYTPEGALKHRIMVPFHMGDSYEV
FT                   VFIQTAGTYRVHDVIARVRDAQGHEHELTMAFRWPVKRPVHCYAERLKPTEPLVTSIRT
FT                   IDTFFPVAKGGTYCIPGPFGAGKTVLQHSTSRNADVDVVVIAACGERAGEVVETLREFP
FT                   DLTDPRTGRSLMERTVIVCNTSSMPVASREASVYTGVTLAEYYRQMGLDVLLLADSTSR
FT                   WAQALREMSGRLEEIPGEEAFPAYLESCIAAFYERAGVVRLRSGEKGSVTIGGTVSPAG
FT                   GNFEEPVTQATLKVVGAFHGLSRERSDARRYPAVHPLDSWSKYPSVLDARAVAYGRSFL
FT                   RRGAEVEQMMRVVGEEGTSMEDFLVYLKGSFLDSVYLQQNSFDTVDSAVPVARQKHCYA
FT                   IVMRVLGSVLAFESKDDARAYFSKLGHMFIDYNCCAWNSEAFVEKEKEIRAFLQGESTK
FT                   IDSEAEGIIRGME"
FT   gene            455961..457253
FT                   /gene="atpB1"
FT                   /locus_tag="TPASS_0427"
FT   CDS_pept        455961..457253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB1"
FT                   /locus_tag="TPASS_0427"
FT                   /product="V-type ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70853"
FT                   /db_xref="GOA:A0A0H3BIV5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIV5"
FT                   /protein_id="ACD70853.1"
FT                   /translation="MYKVYEKIESINGSVITVRAKGVHYGELARVKTAFGDSLAEVNKL
FT                   EGDVVSLQVFAGGRGISTGSEVRFLGRGMLVSFSDYLLGRIFNGSGVPRDGGPALKEGR
FT                   VEIGGPSVNPAKRVIARRMIRTGIPMIDVFNTLVVSQKLPIFSSSGEPYNELLARIAMQ
FT                   AEVDVIVLGGMGLKHDDYLYFKSALEEAGALSRAVLFVHTASDPTVECLMVPDMCLAVA
FT                   EQFALKGRDVLVLLTDMTNFADAMKEIAIIQEQVPSNRGYPGDLYSQLASRYEKAVDFD
FT                   DAGSVTILAVTTMPGDDVTHPVPDNTGYITEGQFYLKNGRIEPFGSLSRLKQNVNGRTR
FT                   ADHRALMDNMIKLYAAYRDALEKRSMGFAMSEWDEKLLTYGGLFEAQLMDLSVNIPLEE
FT                   AFDTGWKILGRCFTPEETGIRSDLINTYWPA"
FT   gene            457265..457885
FT                   /gene="atpD1"
FT                   /locus_tag="TPASS_0428"
FT   CDS_pept        457265..457885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD1"
FT                   /locus_tag="TPASS_0428"
FT                   /product="V-type ATPase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70854"
FT                   /db_xref="GOA:A0A0H3BID9"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BID9"
FT                   /protein_id="ACD70854.1"
FT                   /translation="MAVRLTKNELKRQKETLKTFRRFLPTLQLKKQQLYAEIRAVEARA
FT                   SEVRSRADALRQDVQQWVAVFSESGVFDARLLRVQEVKKTYASIAGVRIPCFLEVHFAC
FT                   PPYDLYRVPLWVDTAVRKMQEVLSLDLEAHVLDEQALLLGAELRTTTQRVNLFEKVKIP
FT                   ETRACIRKITVYLGDQQVAAVVRGKMSKKNLVDVSRMEQEDTR"
FT   gene            457882..459750
FT                   /gene="atpI1"
FT                   /locus_tag="TPASS_0429"
FT   CDS_pept        457882..459750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI1"
FT                   /locus_tag="TPASS_0429"
FT                   /product="V-type ATPase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70855"
FT                   /db_xref="GOA:A0A0H3BJ68"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ68"
FT                   /protein_id="ACD70855.1"
FT                   /translation="MIVPMKKVTLLVLGSEQERSLQALRSFGAVHVQLRECASEQLAEL
FT                   HALDARCVQAIALVTDAQTKNVTRGEECRVAGQVVEAAEAVEQIVRTHSDRVELAQRIA
FT                   QCIAHLERCEPWGDFDPADVRALAQRGIHLIPVELSERSYRCLPDELQTLCLARRGGLV
FT                   RCVLVADKPGLPPSLPADARALELPDVSPADLFVRLRQLREECATLTQRLLAYSEYQGA
FT                   IRALRQKIAADIEFERVHLSMVSVDVSQWRETGETLRIAHVSGYLPVSRVRAFSECARK
FT                   EAWAYCCVDPMPEDPVPTQLRNNRWVNLISPLMNFLGTVPGYWEVDISGFFLLFFGVFF
FT                   SIIFADAGYGAVLTLVSLGGIVLSKRKHAVVSPAWCLGLYLGTLTMVWGALVCNWFGVP
FT                   VQYVPASLARIAVWEISGFADAAQRNKNQMHVCFFLGLLHLCLGHLIVVRRTFRSLRVL
FT                   AEFGSLLMLGGMYVVVLNLIVDKERYPLTGMIVGSIIAGFVLNFIFVNYRVSVRQSVAD
FT                   SMKNVINALLGIVNVFADVMSYIRLWAVGLAGGAISATVNEMTHPLFANFLAFLGIVLL
FT                   LFGHGLNYVMSILSVIVHGVRLNTLEFSNHVGLMWTGIRYTPFRER"
FT   gene            459787..460209
FT                   /gene="atpK1"
FT                   /locus_tag="TPASS_0430"
FT   CDS_pept        459787..460209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK1"
FT                   /locus_tag="TPASS_0430"
FT                   /product="V-type ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70856"
FT                   /db_xref="GOA:A0A0H3BKH2"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKH2"
FT                   /protein_id="ACD70856.1"
FT                   /translation="MNFGMFGAAAVLGISAVGSALGLALAGQGTIGSWKRCYLNNKPAP
FT                   FILLAFAGAPLTQTIYGFLLMKAMLSSEKDPWYLLGAGVACGLGIAASALSQGRAAAAG
FT                   ADALAETGKGFSQYLTIVGLCETVALLVMVFGIINC"
FT   gene            460243..461064
FT                   /locus_tag="TPASS_0431"
FT   CDS_pept        460243..461064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70857"
FT                   /db_xref="GOA:B2S328"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S328"
FT                   /protein_id="ACD70857.1"
FT                   /translation="MLLIDVGNSHVVFGIQGENGGRVCVRELFRLAPDARKTQDEYSLL
FT                   IHALCERAGVGRASLRDAFISSVVPVLTKTVADAVAQISGVQPVVFGPWAYEHLPVRIP
FT                   EPVRAEIGTDLVANAVAAYVHFRSACVVVDCGTALTFTAVDGTGLIQGVAIAPGLRTAV
FT                   QSLHTGTAQLPLVPLALPDSVLGKDTTHAVQAGVVRGTLFVIRAMIAQCQKELGCRCAA
FT                   VITGGLSRLFSSEVDFPPIDAQLTLSGLAHIARLVPTSLLPPATVSGSSGN"
FT   gene            461107..461658
FT                   /locus_tag="TPASS_0432"
FT   CDS_pept        461107..461658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKJ8"
FT                   /protein_id="ACD70858.1"
FT                   /translation="MSGGVGVGKRLCCIALVMRAFWYLSAKGVSIAYVPVHRSGGSQDS
FT                   SMSTAVGDTLLNAFFDEGMVVTAVPPGVHDGQTIAEIAACFEVMPDYALLVQFHSARLP
FT                   GGESPTSRARGAWSSERFRAVWTLVDLHTQRACVYACVAPYRESIPVSECVDVVTRCIA
FT                   EQAISYIRVGTSTDTAGVQL"
FT   gene            461713..463527
FT                   /gene="arp"
FT                   /locus_tag="TPASS_0433"
FT   CDS_pept        461713..463527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arp"
FT                   /locus_tag="TPASS_0433"
FT                   /product="acidic repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70859"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIV9"
FT                   /protein_id="ACD70859.1"
FT                   /translation="MIKRHMFAKRGVKGRSYLVRVNTAFLVLCVASVTPLWAVWEGNAE
FT                   IGPQGSFLQDGMFVRSDMFPKNTAVEISNLEKNAKAQAVVIGHAGIPGLLVSLAPAAAA
FT                   QLGIGVYQAVRVRVRTLGTVRGGSQTSQDGLSLASLPSRVPARPAQRDPLSSPPAGHTV
FT                   PEYRDTVIFDDPRLVSPLSREVEDAPKVVEPASEREGGEREVEDAPKVVEPASEREGGE
FT                   REVEDVPKVVEPASEREGGEREVEDAPKVVEPASEREGGEREVEDVPKVVEPASEREGG
FT                   EREVEDVPKVVEPASERXGGEREVEDAPKVVEPASEREGGEREVEDAPKVVEPASEREG
FT                   GEREVEDVPGVVEPASGHEGGEREVEDVPKVVEPASEREGGEREVEDVPKVVEPASERE
FT                   GGEREVEDVPKVVEPASEREGGEREVEDVPKVVEPASGHEGGEREVEDVPGVVEPASGH
FT                   EGGEREVASQHTKQPSHSVSNSAPNQFRNPEGELPFTLPDLSESEIVVPEEQKGRAHPQ
FT                   VIPEGAPRGLQPGEYYVQIAVFHDAIQVQSIVHRYGVEYPIAVEQDIHEGKVRFTVCVG
FT                   PVQKDERGAVLENFQRFGFKDAFLKKAR"
FT   gene            complement(463624..464094)
FT                   /gene="tpp17"
FT                   /locus_tag="TPASS_0435"
FT   CDS_pept        complement(463624..464094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpp17"
FT                   /locus_tag="TPASS_0435"
FT                   /product="lipoprotein, 17 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70860"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE2"
FT                   /protein_id="ACD70860.1"
FT                   /translation="MKGSVRALCAFLGVGALGSALCVSCTTVCPHAGKAKAEKVECALK
FT                   GGIFRGTLPAADCPGIDTTVTFNADGTAQKVELALEKKSAPSPLTYRGTWMVREDGIVE
FT                   LSLVSSEQSKAPHEKELYELIDSNSVRYMGAPGAGKPSKEMAPFYVLKKTKK"
FT   gene            complement(464225..465307)
FT                   /locus_tag="TPASS_0436"
FT   CDS_pept        complement(464225..465307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70861"
FT                   /db_xref="GOA:A0A0H3BJ73"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ73"
FT                   /protein_id="ACD70861.1"
FT                   /translation="MFSSSPPSSLPKSVSSPSPCAARTGDRGRGLSGLIEFIDAHRAFA
FT                   VVGHEKPDGDCVGSSLALASFLRRIGKEVELLSAGPFKRREIAAYATLFRPSLSAQIRP
FT                   SDQTAVIVVDCSELSRVGAELASQLAPFARAFIDHHETCGDHCAHSFVVKTAPSTTTLV
FT                   QTLIETMAGSLEAAEARALFLGLATDTGFFRHLDEHSADTFASAARLVRAGANPKDTFL
FT                   AMNGGRSLASRMLIARVLSRLTPYYGGALMTSYETCEDAVQLGLDVRDSDALYQLIQSI
FT                   QGVEAIVVVRQESPTHCSVGFRSRGSIDVSVIAARFGGGGHRCAAGLRIEGTVDELLPR
FT                   FVAAFEAQMRAPAAGAQVRS"
FT   gene            complement(465273..465803)
FT                   /locus_tag="TPASS_0437"
FT   CDS_pept        complement(465273..465803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKH7"
FT                   /protein_id="ACD70862.1"
FT                   /translation="MIQTLVLRDTPRLESCRRGGFAMKFSTRCLRLVLCASAVALSAQD
FT                   ASDTAGRVLEPPPPGLTESNSSRMYYVNLPVVKVFSHRLGYRVIYRRANFEMAEIYLPS
FT                   AWFSPRVGKALLRHAPVRVDPYLSFFMEGNTLTYVKLTLPRSLSSPVWGTLKSPSEYDD
FT                   KFDVQFQSPEFSS"
FT   gene            465833..466642
FT                   /locus_tag="TPASS_0438"
FT   CDS_pept        465833..466642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70863"
FT                   /db_xref="GOA:B2S334"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S334"
FT                   /protein_id="ACD70863.1"
FT                   /translation="MRAVDFLRRATVCWYMRIYLASNNAHKHAEFSSLFPMHTILLPKD
FT                   EGIDFFSPEDGSTFFANARQKADALYDVVHAPVLADDSGLCVDALDGDPGVHSARFGAQ
FT                   HGVHTDTARMQLLLERMHGRQDRACSFVCVAVLKLGSVPLCVGRGVCRGVLTTEMSGVE
FT                   GFGYDPIFLLPHLGRTFAQLSIEEKNRVSHRALAALRLAQVLAMMQLPRALRYELKLLR
FT                   GARRMTRGGVLRPGAPCAQRKGQTAQTARRHKFYARARRCARRIHRA"
FT   gene            466729..467241
FT                   /gene="cheW2"
FT                   /locus_tag="TPASS_0439"
FT   CDS_pept        466729..467241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW2"
FT                   /locus_tag="TPASS_0439"
FT                   /product="purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70864"
FT                   /db_xref="GOA:A0A0H3BKK3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKK3"
FT                   /protein_id="ACD70864.1"
FT                   /translation="MYHGPTLHHRRVPMAVNDEQFQLVTFQLGEELYGIDIMGVKEIVK
FT                   VQDVRPIPCAPAYVEGIFNLRSEIIPIINLHKRFHLREATLESGDEYLGGFVILNVEDS
FT                   KLGIIIDRIARVIAVSQEDVQSPPQVITGIGAEYIHGVVRQGTSYLIVLDIHKLFSSKE
FT                   LQKLANL"
FT   gene            467331..468482
FT                   /locus_tag="TPASS_0440"
FT   CDS_pept        467331..468482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0440"
FT                   /product="possible spore coat polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70865"
FT                   /db_xref="GOA:A0A0H3BIW3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIW3"
FT                   /protein_id="ACD70865.1"
FT                   /translation="MDAVLTCLVDEKIGPGSLGSTLIQLVREVFSPIDAYVLRSPAIAL
FT                   SFALRALKLPPASPVLLSALAPFWHYREVLHQGLQPLVLDVDIHSGLLSRDVVETGIAR
FT                   GARALLVPETLGNVPPAAVFLELGIPVIEDSSQSVGAVLGEKKVGTFGSCVIVGLEAHD
FT                   MLTAGGGAVLMAFEAACARRLQALVPEALAVDMLPDMNAALACVQVKQQEKNIALRRAI
FT                   YDRYSSALLRTRHGTLHRCEQLEHSAYAFPVVLASDLKEVTRYVRQASIEISPAFEHSI
FT                   VAAFQLPAMRRRWPFPQFLPTSASHTAPFQGEDREVLETTQGAEKTCQDSSWEREVRAS
FT                   EITPEMCWPHASALLLRCVRFPLYPRLAPAHAQEIARILGTLP"
FT   gene            468479..469396
FT                   /locus_tag="TPASS_0441"
FT   CDS_pept        468479..469396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70866"
FT                   /db_xref="GOA:B2S337"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S337"
FT                   /protein_id="ACD70866.1"
FT                   /translation="MSSRVCPQRPVAKSSGDAKVLLIVSTYKPRAAVLAADVVNFLSIR
FT                   GFQCHTIEYDGLNKESCARAGYMFAVSIGGDGTTLFAARCASPSGIPILAINLGRFGFI
FT                   APIEPRYWQQALSDYLAGGVRPAERALISCTVTRAGKEIASCLALNDVVLSSGRVARLT
FT                   RAEVCFNDISFGVYEADGIILATPTGSTAYSAACGGPILDPDLDAFVLTPISALCLSNR
FT                   PVVVPSSGVVRIKVLSMRHKETVLSVDGHELCTLQEEDQLLASRSSCSARLVFCTPHVF
FT                   YHALCSKLAWSGSIFSRRGRRHDD"
FT   gene            469389..471110
FT                   /gene="recN"
FT                   /locus_tag="TPASS_0442"
FT   CDS_pept        469389..471110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="TPASS_0442"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70867"
FT                   /db_xref="GOA:A0A0H3BIE6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIE6"
FT                   /protein_id="ACD70867.1"
FT                   /translation="MIEQLSVRNVALIQSLALEFGAQFTALSGETGAGKSMILGALSFL
FT                   CGQKVGPDLIRKDENEAWVSAVFRCDHAPRAVHTWLAERSIEPEHHRVLLRRVMRRTGR
FT                   GTAWIQNVPVSRADLEFFTSFFIDLHGQHEHQSLFRVAEHRRFLDTYGGLQQEVDAFTA
FT                   CYAALAERRAQLQRLASCEHNRQERLEFLSFALEELEHAALDVHEERALEGEEQKLCQH
FT                   EKLCDVMQRVDAAIRGVDLQEGALLSSLKKALGALESACGIDGSLEPARARLESAYYEI
FT                   EDVAHVLRTYTDGIQFCPDRLQHVQERLALIYRLKKKYGGTVAQVLEYRARAQQEMQDL
FT                   SQAVGDKEALEQDVQRLMAQVLHAGRALSLKRHAVAEAFRTRVEGVLHRLGMASTRFHV
FT                   QICTRDEQCAKQRTGPYGFDDVEFLISANAGEPARPLAKIASGGELSRVMLALKTVLSS
FT                   VDEVGTLIFDEIDVGIGGETARAVAEHLQALSEHKQVVCITHLAMIAAHADAHVCVKKE
FT                   SSGEHTNTSAAHVVGERRVQEVARMLAGDTHSATSLAHAQELLRAGARQRRGECGD"
FT   gene            471052..471906
FT                   /locus_tag="TPASS_0443"
FT   CDS_pept        471052..471906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70868"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ77"
FT                   /protein_id="ACD70868.1"
FT                   /translation="MRRSCCAQVRGREGGSAVTEEEQNALYQKKLNVYQGTIDQIFTRE
FT                   KNILELIRRDGTGAAYKKLALVDDMIYLSTLYAAKYQTQVVVVGGKQEDLLNEARKTLY
FT                   KALIYLEEIVTNLIDAPFSDYQEQVAQIANVSQQQRYYLIRKMGLAIDSIISAYGTNTK
FT                   WYWSFVELQARYATVAKNILDLANSSEIGLNPQADEYETVVYHLRLVKKLLLQAAERYR
FT                   EKYEMTSSSFEDFKLAVCYLHALRRVHLLLNERQDAEEVKKKAKVWSERMEKDQRKRDR
FT                   SDK"
FT   gene            471912..472940
FT                   /locus_tag="TPASS_0444"
FT   CDS_pept        471912..472940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70869"
FT                   /db_xref="GOA:A0A0H3BKI0"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKI0"
FT                   /protein_id="ACD70869.1"
FT                   /translation="MRAPAGCGVSRLRVNVCYLRQGERARIGDAHAFFLSAEKGAGMGG
FT                   FFLSLAGCFLLAAAYGAAQTVHVIAKGETLFSLSRRYGVPLSALAQANNLANVHQLVPG
FT                   QRIVVPRGYTVRRGDTLFSIARMLNCSLAALLAANGISAAHTIHPGDVLVIPPREKSPP
FT                   TVAGADRILSVSSLPDGDQWARARADPVQTPVSPPAAVPAPERREISLRDPRQYISKKV
FT                   DKNARWPVSPTSLAYVRGKTYGVVIDSERNAAVRALMSGKVISRGTHRGYGQVLFVESA
FT                   GKHVYVYGGLERILPKSGDYVSAGDVLGNLGFDAAAARSRLYFMVYKKNKPIDPAQAPR
FT                   GF"
FT   gene            473076..473705
FT                   /gene="thiJ"
FT                   /locus_tag="TPASS_0445"
FT   CDS_pept        473076..473705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiJ"
FT                   /locus_tag="TPASS_0445"
FT                   /product="4-methyl-5(b-hydroxyethyl)-thiazole monophosphate
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70870"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKK9"
FT                   /protein_id="ACD70870.1"
FT                   /translation="MSVRVYLFVAHGFEEVETITPLDYLRRAGIALTLVGVGAEQVVST
FT                   RGLRVSCDCSLEALCASPGIADAACAADAVLLPGGLENCHTLAACAAVRDFVMRVHLRG
FT                   GLVAALCAAPARVLSAWNLLGSRRYTCYPGMEPAVFSAHDDGVGKRTEEEKSRALRKPE
FT                   RARVVRDGNLLTACAAGAAEEFSFAVIEALCGVEVAQSVRAQVVAR"
FT   gene            473747..474961
FT                   /gene="gcpE"
FT                   /locus_tag="TPASS_0446"
FT   CDS_pept        473747..474961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcpE"
FT                   /locus_tag="TPASS_0446"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70871"
FT                   /db_xref="GOA:A0A0H3BIW8"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIW8"
FT                   /protein_id="ACD70871.1"
FT                   /translation="MDSSAGVSPCNSPYGSGLLDVPLKLRPRASHYRARSLVIGGKEHV
FT                   RALPLGGDAPIPIQTMWKEPLIGADLQSIVDRLLELEQLGCDVVRFAVPDRESAELFVA
FT                   LCARTRMPLVADIHFDYRLALRCMDGPVAKVRINPGNIGVRERVRAVVEKARATGTALR
FT                   IGVNTGSLPGVVKRAVAARYADGMQSVNARAEALVQTAFAEAAYLDQLHFDRVVLSLKA
FT                   STVAETVRANELFAQQSDIPLHLGVTEAGPLVSGIVKSTLAFSQLLSRNIGATVRVSLS
FT                   DSMEHEVLAAREILAECGKRAGGVRLVSCPRCGRIGFDVHAFVRRWQKELFSLKKDITV
FT                   AVMGCVVNGPGEGKHADLGISGAEDSVIFFKRGKIVRRIQVRDLCADERTRIIDAAFKE
FT                   ELSSL"
FT   gene            474958..476082
FT                   /locus_tag="TPASS_0447"
FT   CDS_pept        474958..476082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70872"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF0"
FT                   /protein_id="ACD70872.1"
FT                   /translation="MNNLIKAYAAGVMSAAFLFGSEGRVRSESDRVRGEDPWHLLQWAQ
FT                   VVYEREEFGDTLRYAQRARALRREQVEHQCRVLLRARTRAESAGIPETLSDLYALLKSR
FT                   GETDACEVLDAIFLTHAPHVFQNSVSKLLQWLKDSAAFPEAELLLGKVFEGEGEYAQAL
FT                   QHYRNAWDTRAQLVVPDARFDIIYAMANVSRLLSQQDEREKYLLLVLSEDPLYSAREVW
FT                   GKTLHAMLRTIRSSNTVEKFFKLYRHRNVLALRAYQELTEMYVRTDNIERALPVSVLAA
FT                   DIAISALDSFLQKIELTYQYKDLADLFLRTGSHPTILKWANEHGVWQTLLHFADLLYKK
FT                   GLHAQARDMYYNLAEKCPAFEYARRAAYKLSLTL"
FT   gene            476140..477222
FT                   /locus_tag="TPASS_0448"
FT   CDS_pept        476140..477222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0448"
FT                   /product="possible uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70873"
FT                   /db_xref="GOA:A0A0H3BJ81"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ81"
FT                   /protein_id="ACD70873.1"
FT                   /translation="MEGQTARRVITEAKFLDDCLTERDSYYLSKLDELYSSAMSSFAQF
FT                   EDQQNGARSARAEENIIATYDSIGNLMQEICKELPALKVYSFETQRENHAEVSRVVSKL
FT                   RNIHTGYSEFIYYTQRAFEMLFRLAYGGSHEEHKTYLITKTPVAFPVQNYAVHKIANVD
FT                   YKIENTVMCVMLRGALLPSMIVSKEIEEYSSHGYVTPFALFKIKRDDLRDERDMQYVFD
FT                   LDKSYFSARELDGKDLVFADPMNATGGSLVTIVRYLQDLGVKPKSISCFHMISALKGAI
FT                   RVVRSLENCTVYTLWMDPVLNARAYIMPGLGDAGDRVNGVDVEDYPRNIIQLLADYGSN
FT                   ISGLYRSQLRKIEETVLGSR"
FT   gene            477226..477816
FT                   /locus_tag="TPASS_0449"
FT   CDS_pept        477226..477816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70874"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKI6"
FT                   /protein_id="ACD70874.1"
FT                   /translation="MNGKQCFCFFLFHLFYTGLFACGKPESSLAPEYFDLAHAYVQLHR
FT                   YDEARDYYMRAARDPAYYHAAQYNFARVCGLQNDWKTAVHALQPLYDADSANATIAAAY
FT                   AYALLSFGETARALLLYQQLYERDQKNTQRILEYANVLMHAKKYIQAVEFLRQKKSLLS
FT                   EAEDVRVLQSIVRKLKDSVPPHLIADFVSTDDL"
FT   gene            477953..480004
FT                   /gene="fusA1"
FT                   /locus_tag="TPASS_0450"
FT   CDS_pept        477953..480004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="TPASS_0450"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70875"
FT                   /db_xref="GOA:A0A0H3BKL4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKL4"
FT                   /protein_id="ACD70875.1"
FT                   /translation="MRQQQMRNIGIMAHVDAGKTTTTERMLFYTGKIHRMGEIDDGATT
FT                   MDWMVQEQERGITIQSAATTVRWREVDITIIDTPGHVDFTAEVERALRVLDGVVVVLCA
FT                   VGRVQPQTETVWYQADRYDIPRVCFVNKMDRIGADFFSVLDQVHNKFGIDAVALQIPIG
FT                   SGTSFEGVIDLITMKEIFWDAASSGEQMEYRPIQSARIAQAREAREKMLDVISIYSDEV
FT                   TECVLAGEHVPVQLLHAEIRKAVRERRYVPFLCGSSRHNLGVQPLLDAVVEYLPAPQER
FT                   KAVEGFHVQKKEPVFIAPTAEGPLLALVFKIQYEREAGLLCYVRMYSGKLRTGDSIVNI
FT                   GKKKRERVYRILRMHSNKSETVECIQAGDIAVIVGLKSAQTGDSVGDGSCPVVLESMHF
FT                   PEPVISVSLEPMDASSRDKLQETLGILSREDPTFSVREDAETGQLLISGMGELHLDVLT
FT                   TRMREDFNVQVRVGKPHVTYRESIRKTVERTLRVQRVIGGKEYMAGLTLRVEARKRGAG
FT                   NEFFCQVKELRGTVCTAHTAPAEIIGAVEHAIRGAWDGGIQSGYPCVDVGVHLLSVEYQ
FT                   ELTSSPFIFEAAAVQAFGEACVAAEPYVLEPIMSVELSCAQENVGDVMNVIIQRGGIIL
FT                   GMDSKHGRELVHAQAPMKKMFGFSTDVRSASRGGASFTMRFSHFESCA"
FT   gene            complement(479993..480175)
FT                   /locus_tag="TPASS_0451"
FT   CDS_pept        complement(479993..480175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIX3"
FT                   /protein_id="ACD70876.1"
FT                   /translation="MLSMQLVTVTVQGAMVADIAVAVRTAPHPFLYASVLQDSPQARKP
FT                   VRETRYQKMSAFLCT"
FT   gene            480454..483729
FT                   /gene="ileS"
FT                   /locus_tag="TPASS_0452"
FT   CDS_pept        480454..483729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="TPASS_0452"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70877"
FT                   /db_xref="GOA:B2S348"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S348"
FT                   /protein_id="ACD70877.1"
FT                   /translation="MYTPVDPKVDFVAQERRILAFWRERRVFEQSVAQRAQGKSYVFFD
FT                   GPPFATGLPHFGHFVPSTIKDIIPRYQTMRGAYVPRRFGWDCHGLPIEHLIEQELNLNS
FT                   KSDVESYGVSAFNAACRSSVLRYVKEWQRTLTRLGRWVDFDNDYKTMDVCYMESVWWVV
FT                   AQLWQRKLLYEGYKILPYCPRCATALSNHELNLGGYQDVSDPAITVRFECTSVVPGSPA
FT                   AREFCAAASWGSASLPAHTCFLAWTTTPWTLPCNAALALGPQILYVLIEANDEHYILAR
FT                   SRLEFYYPDSSAYRVVWEKRGEHLAGIRYRPLFSYPVFGQGPDPSVQGDSEEGLFCTRV
FT                   ADFVSTEDGTGVVHVAPAFGEDDYEVFKDAGISIQCPLDAECRFTAEVADYQGLFVKAA
FT                   DKAIIARVQKQGALFRREQISHAYPHCWRCASPLIYRAVHSWFVAVEKIKDKMLAANAS
FT                   ICWQPSHIRDGRFGKWLVCARDWAISRDRYWGNPLPIWRCVHCGATDCIGSRTQLYERS
FT                   GMLLEDLHKHVVDMVTIPCACGSVMRRVPEVLDCWFESGAMPYAQQHYPFEHATDFERY
FT                   FPAHFISEGLDQTRGWFYTLTILAVALFERPAFENCIVTGLVLASDGKKMSKALRNYAD
FT                   PNEVMDRYGADALRLFLVRSAVVRADDLKYSDEGVKDILKTVIIPLWNSYSFYVTYANI
FT                   DGIDPPVCAKVDGMGQAVTRLATHLNNPLDRWILSLTEKLVQDIACALDAYDVSKVADP
FT                   IVSYVDQLNNWYIRRSRRRFWKSINDEDKRCAYNTLYCVLKRCVLAIAPVVPFITESIW
FT                   QNIRAADDVQSVHLADYPVCTPMVRDDALEFKMETVQRVVSMARAIRAQCNLKVRQPLK
FT                   AMQVITRNPMERSALLEMEEDVLDELNVKELVFHEKEDEIVEYRAKANFRVLGKELGSK
FT                   TKRAALSIERLSSAEIQEILEGTTLYLDVDGDRLELTEEKILVQRIERESLKAINEGTL
FT                   TVALDTTLTEDLLLEGAIRDLVRGVQNLRKERGFSLVDRICLRVFSSDQDIVCARKAYD
FT                   LHRSYIVGETLAAHVQWARVRDGASAVYVKSDAVLWEVSIDKA"
FT   gene            483716..484579
FT                   /locus_tag="TPASS_0453"
FT   CDS_pept        483716..484579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70878"
FT                   /db_xref="GOA:A0A0H3BIF4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF4"
FT                   /protein_id="ACD70878.1"
FT                   /translation="MIRRRYRGCTQGAWIVSVGMLFASCTSGAWKASVDPLGVVGSGAD
FT                   VYLYFPVAGNENLISRIIENHESKADIKKIVDRTTAVYGAFFARSKEFRLFGSGSYPYA
FT                   FTNLIFSRSDGWASTKTEHGITYYESEHTDVSIPAPHFSCVIFGSSKRERMSKMLSRLV
FT                   NPDRPQLPPRFEKECTSEGTSQTVALYIKNGGHFITKLLNFPQLNLPLGAMELYLTARR
FT                   NEYLYTLSLQLGNAKINFPIQFLISRVLNAHIHVEGDRLIIEDGTISAERLASVISSLY
FT                   SKKGSS"
FT   gene            complement(484929..485618)
FT                   /locus_tag="TPASS_0454"
FT   CDS_pept        complement(484929..485618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70879"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ84"
FT                   /protein_id="ACD70879.1"
FT                   /translation="MMKALLVADDPVSVNLVFENHTQCGYEVIHYRSALKALDNMEEIQ
FT                   PQLLFINASDFPRHWRVLTQFFKHQSVCGARVILLVNTPSSSLSARQVAQAGVHALIDY
FT                   TLSPEEGRKALCGVLTPSACAGSVDVGHAHTCQADFVFTNPCSGSIVTGTVREVSEEGV
FT                   DFIPDFPASVNNLQEQDVLEHCALKVAHDILGVRCSFHSSDGRILLRFIDPDASLVHAV
FT                   RSVTGTT"
FT   gene            complement(485615..486619)
FT                   /locus_tag="TPASS_0455"
FT   CDS_pept        complement(485615..486619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70880"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKJ1"
FT                   /protein_id="ACD70880.1"
FT                   /translation="MPTLRWQGWRMKLKRSLIVGGGLLLCCAHGYAQAKGARASVHIAY
FT                   HNRTIYFPGTHESEPIWVKVSLTNTGKDTLRFKLADDRTFSVDFSIRTMKNRALAHTDE
FT                   WIRKRSTHRPVYFREISLEPGESYSFVENVKHYLDVQSAGLYFLTLLFYPELKRERTGD
FT                   EDHLASNTLTLEVQPAPAAAALGALPVSPPVGEVLQPQRLSPDRVIEYVLNARQKSHWE
FT                   RFFLYLDLAKMLSRDAGRSRRFNAESEAGRYNMIDTYKHELRQERVDKDIAAIPVEFRI
FT                   EKTVYTATDAEVRVLEWFEYRDFREKKRFTYHLSSRDGIWYVHDYVVENLGTE"
FT   gene            complement(486676..487992)
FT                   /locus_tag="TPASS_0456"
FT   CDS_pept        complement(486676..487992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKM0"
FT                   /protein_id="ACD70881.1"
FT                   /translation="MNTRLALVLCAVGSGVLSFSCARTAEPTPAASTHVPVTTAGALSV
FT                   TPPSSTDRWYQFSRTDGRVHLRACPAPSQPSAPEHFVPWTEAVRLSAVDAQQELLLINR
FT                   AGVLPATQLARMQTAPVPRKAPSTPAAETTSLTLTPPALLATQSAEGFYSEPIPNSSPH
FT                   PCQGTGAVFVRLYTDPLFTTSPQDSAAPFLVRYDVRTARWTSVAYTRALGLPRNAQCTA
FT                   LTHTRGTWYASFKSSEAERVSFAYFSFPSLSSLENLGPTQRREHPIGGKVQVPRPISAA
FT                   AFRAACTPQRLHLPTASTSSDHHSDLHELLVHRLLARVPLSPLYLSARSPCWASDRSFL
FT                   KTAHRTADERAHHANALIFHPPRARLSAALLTDSGHLYFVREDGSEGHARLSALPPQFV
FT                   YTSFTLSGPSLIAGWEEQDFFQVGSTGLLCTEVESLTGT"
FT   gene            488060..489841
FT                   /locus_tag="TPASS_0457"
FT   CDS_pept        488060..489841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIX9"
FT                   /protein_id="ACD70882.1"
FT                   /translation="MHLPRGLWAMGTVRSCFFPPTRAPIWGRMSCLGARARGVLRISLV
FT                   IMLQGLLRASEVDEELSKKYSIEIMVDSGVSETGERLPLLPFERIPDSHHVRRVIAQDW
FT                   FLDEPSRVALRAPRSYTDETGNSFRVEAYVIAATDHLAVRVTPLLADRAPRDGVHSAPV
FT                   AAAPRLHLALEAPTGTSRAGRTGADTPQSPVTDAAPSQAVAQGTWVLYRHMHTGAPVCI
FT                   RVYPRESASLYVQLSAPTAVEMQGKTHLDVCLFNVHVRKHVALGLSFEQLYTYSLLQLR
FT                   ALTEHAVPWRIFDPPRTYSAVESMASIIKRRSYRLAPLEDGCFNEWGRPVHISDGSSQS
FT                   DQEIIRALRVDQVPREIIGGVGSLGFAKWVVDGIIAPVAGQGVYLSALKKQTTMPRTHF
FT                   NAAHERARAPFFGIDWIRNLAAAALSLNVRRTVYPAQGGVDVTVEPFAVEGVPKGRIKQ
FT                   EARHPGIAPPSTPAGAVPPRVTQGETAAGPSRYLGYLPHAGYQTGYVRALFYYLAVMEP
FT                   GHFYLGVLNEERGVPRLREYQRAAVFLPYFDRSGRFQVEVFEAARLSTLEEFVAQYPQQ
FT                   MLALVRVRAPEIGHFNP"
FT   gene            489932..490510
FT                   /locus_tag="TPASS_0458"
FT   CDS_pept        489932..490510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70883"
FT                   /db_xref="GOA:A0A0H3BIF8"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIF8"
FT                   /protein_id="ACD70883.1"
FT                   /translation="MDQAEPCTLHGAPAPDLALLEAILFVEGVRLSYACLARKLGLSEQ
FT                   AVGECVARLGEALASGARGGGGLELHCNEQGVALLPAATVRERLATLYGKRSEGRLSRA
FT                   AMETLSIVAYAQPVTRAEIEAIRGVGADTMIRLLSERRLICEVGKKDIPGKPAQYGTTE
FT                   EFLTAFRLRSIADLPKLDEEEQRRFELTR"
FT   gene            490539..491324
FT                   /locus_tag="TPASS_0459"
FT   CDS_pept        490539..491324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70884"
FT                   /db_xref="GOA:A0A0H3BJ88"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ88"
FT                   /protein_id="ACD70884.1"
FT                   /translation="MCRLQPFFRLRLQVYLARSGCASRRACEALIASGRVTVDGQTVTT
FT                   QGRTVCAQNVVCVDGTVVQLERVQRYVLLYKPVGYICSLAPQFPAGYAHTQVRAGPSKQ
FT                   EYARAIDLVQPAYQERLYHIGRLDVRSEGALLFTNDGSFAQALGHPRSGIEKEYIVETR
FT                   EPVPAALLSSFVRGVWVEGCRYRCVRARHLAAQCVQLVLVEGKKREIRVVFEAWGQDVV
FT                   RLVRVRIGRVRLGPLRPGAFRTMRLQEVAQLLQCAGCAR"
FT   gene            491367..492074
FT                   /locus_tag="TPASS_0460"
FT   CDS_pept        491367..492074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKJ5"
FT                   /protein_id="ACD70885.1"
FT                   /translation="MGCARCSYFAGAAGILRAHTRSRRGGGRLVNQFFEEFECPEHGRQ
FT                   PRGVQETAESLNCLALSCARKGWYEETVACLRKGLGLSPFNGLLWLNLALGYYALKRTV
FT                   DSAGALYHALRCTPHHAAVWNMLGVVLHDMGDTEASRNAYEHAIRLETKNGATWNNYGL
FT                   LLHTEQKYDQAQRAFETALSLLPRSGSALYNLSRTYHALGDARKAAVCRRILAQMPAGE
FT                   KKPGPITPFALHP"
FT   gene            492075..492434
FT                   /locus_tag="TPASS_0461"
FT   CDS_pept        492075..492434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70886"
FT                   /db_xref="GOA:A0A0H3BKM3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKM3"
FT                   /protein_id="ACD70886.1"
FT                   /translation="MLQAAACGAMRGGVLEYTGKMEGMGVRVERVRCEQNLSKTAFARE
FT                   LGIGVEELDAIERGTMPLSRDLTLLLCVVFAVNRLWLESGEGEPFSASAVSPQETVQPE
FT                   EEAREPPIPPPRWRG"
FT   gene            492639..493481
FT                   /locus_tag="TPASS_0462"
FT   CDS_pept        492639..493481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIY4"
FT                   /protein_id="ACD70887.1"
FT                   /translation="MRRIVCPPVLFLSASLLTGCDFSGIFASIQSEVPLKIPSIRGVVT
FT                   GLVKCGNKLYACAGQLWEKDASKSEGKWTAVDFLPGKTITSIVSKGTCVYACVSGDGVY
FT                   TYTSNGAGRTGGTTTPSTVLDKTNGAIRIGGSDNPFLQMPCELSSGSSGGGGGGSGSSS
FT                   DGGIKNGSDENVLGSGTGYVVTTKAVYTKSNSSGTSCTYTKDGTFTATTSPILGCTSDG
FT                   KGCFYVLDGTDVHCRTVQASGGGNGAHCAVASGSATSCKVAHTVTNPLCIAHVKNGQH"
FT   gene            493486..493818
FT                   /locus_tag="TPASS_0463"
FT   CDS_pept        493486..493818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG1"
FT                   /protein_id="ACD70888.1"
FT                   /translation="MLIGGSQGYKEIKLETGSGSGTGCLKAENVRGPEQWGEDSVTPKD
FT                   RVSQYEGTIGRFAISDIYTVESTSGAGGTNGGTNKPDVYVVVGDSQDGYTGLWRFDAQK
FT                   KEWNRE"
FT   gene            complement(493877..494629)
FT                   /locus_tag="TPASS_0464"
FT   CDS_pept        complement(493877..494629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70889"
FT                   /db_xref="GOA:B2S360"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S360"
FT                   /protein_id="ACD70889.1"
FT                   /translation="MTNDSARMRKVLTFTRRSNRMTACQKRDYQHLASRWIIPYQNTVF
FT                   DYAAVFCSPAAPSAPAGAFPAPQGKTDAVAPACAPAPLVVEIGFGMGSATAAIAARNPH
FT                   LSYLGIEVYRAGIGRLLRKIEAERLHNLRIIEHDALDVLRTMIAPQTLAGLHIFFPDPW
FT                   PKTRHHKRRLLYRPRTDLLARALAPGGYLYAVTDWAEYARRAQEELARTPSLTWAPQGA
FT                   RPWRPATEFERKAQTQGRAIHELFFIKA"
FT   gene            complement(494626..495498)
FT                   /locus_tag="TPASS_0465"
FT   CDS_pept        complement(494626..495498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70890"
FT                   /db_xref="GOA:A0A0H3BJ92"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ92"
FT                   /protein_id="ACD70890.1"
FT                   /translation="MSQVLTVLHALSSPPWICLLSFNRMVLARQCAFVLVSCVVPCVAG
FT                   AVLSSCMPFYARTEGLTLKRVYFEKAGKTDATLALHVTLEYPAPPEEYFYLEVEELRTG
FT                   MRWVFGEKDTRVYIATDELHPGRRMLRVGGMQYPWGDFPAGTYVVYVRDSTGTYAQQRV
FT                   TLGAGYPAHEPFPFSFSVDAQRWTLSAPAQPALVGPFTAHTHTSLVLLTRDYRTVAQHP
FT                   LSLTSLPNARLSSPRVHTFEASMDALKTTHQDAYYLQCVVEDFQRSWRFISQPHRLYPE
FT                   DALSEQAPP"
FT   gene            complement(495431..496600)
FT                   /locus_tag="TPASS_0466"
FT   CDS_pept        complement(495431..496600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKK0"
FT                   /protein_id="ACD70891.1"
FT                   /translation="MSSKHKRRILNLPLKLVLTQEGSEFFIKQNRKLMKLKLAEHVEDY
FT                   GIALDAFAPKTVQGLLLSGYVSLIEVSPPEFASSRQEIIDLSKLIVHSILYRQYDCYVF
FT                   RQILNSEVIKKWNRSNPGSSIDEHANLNAPFIYNHLKQHEAHVTQIKHHILRLLHASLA
FT                   ACEERTPKEKNTLLFLGEKFLDTLRPFTWFIISKFQHAPDMGSVLSSIHTSLAQYLNKA
FT                   RIAEYIALVLVELLINEENTNLKKEVQKLFPDLEDAQEALCDEGIRRRIVAELKHNAES
FT                   LFISWKLQGRSVSTAGTRRKLKITVYGRNDYPQEMRNCLQDAKVVNADTDTLVDYCQQT
FT                   IDTAKHANLGVYYISYLSEACKEANVRFESSLNRFTRSEFTTVDLSFEF"
FT   gene            496591..496839
FT                   /locus_tag="TPASS_0467"
FT   CDS_pept        496591..496839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKM6"
FT                   /protein_id="ACD70892.1"
FT                   /translation="MNSYFSALPLKCVRRPFILSRNEGWGIKRFYVADEPHRSFLCMQE
FT                   GVRRGGGESEITQRKADVLRKSIRSADRYKEDRSCRT"
FT   gene            complement(496809..498761)
FT                   /locus_tag="TPASS_0468"
FT   CDS_pept        complement(496809..498761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70893"
FT                   /db_xref="GOA:A0A0H3BIY8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIY8"
FT                   /protein_id="ACD70893.1"
FT                   /translation="MNNVHKTFIALAAGLVLLLAVVAGFSLFSRGVVRARLPRAAGETL
FT                   LEEEGVSEQELAWLETNQLLQEQGEEPGVLVDHHVQLSGNSDEEQFLQTLSEELAPQRP
FT                   VPYAPTPRERMQEQDTRQKGARVLTPPRGVSRTASFSPEKSIKRAVQIATRPEVRAPAE
FT                   TATPQHHVHALLSEGKELTERRDYPGAVRVFNKAIRALPAGDAVFAADAYTRMGEAMYA
FT                   LSQHDNRDGFERTRALETATVYVKEALRLNPRSAAAHYLAACIADAQPDDDQTTALTLL
FT                   ERAAALDRREYRYSYELGKRLFAVRRFAEAQEAFNAATVANPKFEPAFFNLGLTCRVRA
FT                   KHDLALQAFRAVIRLNPTHTRAWIELGRVHDAQGEVSAALADYQKAQECAAAAEAHDLY
FT                   LTAARERARVLAKSGAKEEAVRLFQEILERDSEDALTLYNLATVLLDLDRNEEALKHAQ
FT                   QAVYANGSQARFLYAYALAAQKTGRVDLALTQYQLAAARDPAHVKAHNNLGKLYLDKGA
FT                   LQEAETHLQAALAHDAQNFEVNSNLGKLYVLRAQWETAIAHYRRAATAQPQDREAQCQV
FT                   ARVYVAAGQPHEALRAYRAVLAQDARAWDVYLEAGKLAIKVNEKEYAQEVLTQLLDRNP
FT                   DYAQAPHVRQLLSSL"
FT   gene            complement(498754..499695)
FT                   /locus_tag="TPASS_0470"
FT   CDS_pept        complement(498754..499695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70894"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG5"
FT                   /protein_id="ACD70894.1"
FT                   /translation="MCQKSSPCTYARVRSLPSVRLFSFLALAFASFLRAEDAFDHFREG
FT                   ERLLSLQQAQQAIGPLHKAAQQKPAHPKAALYLGMAYLQTGRYTQAIQWLQNPPVHSQE
FT                   YAHLYAYNLGNVYFVQHRYEEAQHAYEQALALKHDYPPALLNRANTAMKRQAYAHALAD
FT                   YKKYVSQNPTASQHYEVQRMIAALEQWLQRKEAEEARRKEAEEARRKEAEEARRKEAEE
FT                   ARRKEAEEARRKEAEEARRKEAEEARRKEAEEARRKEAEEARRKEAEEARRKEAEFEAL
FT                   KRALRLKQAEDARTLSTGSEDTVPYQEEHNLE"
FT   gene            499687..501096
FT                   /locus_tag="TPASS_0471"
FT   CDS_pept        499687..501096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70895"
FT                   /db_xref="GOA:A0A0H3BJ94"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ94"
FT                   /protein_id="ACD70895.1"
FT                   /translation="MAHLTFLLGCATMGGMSAYMALLAAAFSSSIVFLLVFLMRGFSIP
FT                   RRQLLVEKSFRDGKYALAIKHAHAVLAKDPHNWAVRVLLGRAHLAEGKRDVALMELRAA
FT                   SSRAAFGTVVDEVEFRKTIAQLYLQFDQIEEALKEYTLLIRLDPTCADYHYRIGQLFER
FT                   KNVTDRAAAYYRQCIGMDAAHPAAHAALGSLLLRSGHLAEARAELDTVLALEPANAEAL
FT                   FCQGQLLRKEREYAAALRSFEQASRSPVLRQKCFTERGCCYMDAKDVDRAIVEFDRALR
FT                   CKSQSGENEDLQIRYLLASCYEKKRDVEKAIEQWEAINARSAGFKDVTIKLAQYQDIRL
FT                   NDRMKEYLTLDGDSFFDLCQRIVSKALRLSIDSVQDVRGCCEIVATERDEKGWSNVRTQ
FT                   PKVVVFYREARVLDDSFLRAILERMKERGIARGVVVTSSSFSRAALSFAENRPLELLGK
FT                   NELERLLDASS"
FT   gene            complement(501109..503184)
FT                   /gene="uvrC"
FT                   /locus_tag="TPASS_0472"
FT   CDS_pept        complement(501109..503184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="TPASS_0472"
FT                   /product="excinuclease ABC, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70896"
FT                   /db_xref="GOA:B2S367"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S367"
FT                   /protein_id="ACD70896.1"
FT                   /translation="MRPSESLVETLRIQALSAPSTSGVYLWKDVHGVVIYVGKAKSLRT
FT                   RLTSYFRCRHDPKTRVLMSRAAALEYLQTQHEYEALLLENTLIKKHTPRYNICLKDGKT
FT                   YPLLKLTCEPFPRIFRTRQFCQDGARYFGPFPDVQILDSFLKLILRTYKIRTCTTLRKR
FT                   KNPCLYYHLKRCDAPCCGWVSPRTYQKDIHEITLLLEGNIDATVARLEKRMKRAVRQEA
FT                   FEAAARIRDDIQAIRCITHKSLVQDMDERARDYIAWSSTGAIVTFAVLRMRGGKLNGRE
FT                   LFRTRSLKNEEEILSEFLITYYSDHTIPPHLFVHSSAGLAEHWLSHKAGTQCTVTLIPL
FT                   HTFPTPQTPSSTVTTNAPTLAASQNSNAVQDSGLRSCSETSTMHTLQKAHDACTASEGT
FT                   RENTPHESAHTPHHRAILAMAQLNAHEDITRYLKNRGADDALKELQKQLHLARIPTLIE
FT                   GFDISHLGGKYTVASLICFKNGAPDTKNYRLFNLRAHDTRIDDFASMREAIARRYTHTP
FT                   EGYTLPDLILVDGGIGHVSAAQHVLDALGLSIPLVGLAKRAEELFIPNSPTPLVLDRRN
FT                   PALHMLQRIRDEAHRFAITRNRHLRTKKELVLSFERLPHVGKVRAHRLLAHFGSFRSLQ
FT                   SATPQDIATAIHIPLTQAHTILHAATRSTTAPVREEYKEHEHDPQGESPGPGRKTD"
FT   gene            complement(503259..503903)
FT                   /locus_tag="TPASS_0473"
FT   CDS_pept        complement(503259..503903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70897"
FT                   /db_xref="GOA:A0A0H3BKK5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKK5"
FT                   /protein_id="ACD70897.1"
FT                   /translation="MVTVSIVEIFLIISLPLLFFSSFADAGDPLQELISFVHGAVLAVP
FT                   LLLLRSFFLGYYPPDSALVEEQWMRFFLFDYVFPLFCLPFFLFTSRSLERVSLVSGVSA
FT                   LFGAYTSFFFVHVYTQLNDPDLLARVMTLVLYMTNLLQLHAHVSFSMRTRLPLLGLIAA
FT                   LCIFLLMGAFSATVMTLCFFNARTVVYTSMLAGAGGVALLTHFFAVRMNVR"
FT   gene            complement(503968..504705)
FT                   /locus_tag="TPASS_0474"
FT   CDS_pept        complement(503968..504705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70898"
FT                   /db_xref="GOA:B2S369"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S369"
FT                   /protein_id="ACD70898.1"
FT                   /translation="MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISVAARMAGGDPQA
FT                   NPRLRTAILKARAANMPKDNIERAIKKGTGELSGSSYEELVYEGYAPGGVAVLVEVLTD
FT                   NKNRAAANVRNLFSRNGGNLGSAGSVSYMFNRKGVIEYDSEQVDEEALMELALEAGAED
FT                   IQNAGGVLTVTTVPGTFETVLESLQAKGWESLSAGISMVPDTYLALDEETARKVLKMID
FT                   RLEEEEDVQAVYSNADIPSELVL"
FT   gene            complement(504846..506453)
FT                   /gene="gpi"
FT                   /locus_tag="TPASS_0475"
FT   CDS_pept        complement(504846..506453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpi"
FT                   /locus_tag="TPASS_0475"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70899"
FT                   /db_xref="GOA:B2S370"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S370"
FT                   /protein_id="ACD70899.1"
FT                   /translation="MNWRNLDECAAYARLQAIRAPSLKTVLCGPEGIERVRRYCTDAGA
FT                   GLRYHYAAKTVNEEILTALAALADEQELVAKYDALRAGAQINTGEKRKVLHHLTRLGVQ
FT                   GSSLASLPCEVRDMHAFYTKEYERVCAFARQVHEGGLRTSRGAPFTDVVQIGIGGSDLG
FT                   PRALYLALEGWAQRHQAVKMRTHFISNVDPDDAALVLSKLPLETTLFILVSKSGTTLET
FT                   LSNELFVAHVLRQAGLEPHTQFVAVTSETSPLANNPQYLASFYMDDFIGGRYSSSSVCG
FT                   AVVLTLAFGPQVFGHFLSGAAEADRAAQEQDIRRNAALLDALIGVYERTILGYEHTAVL
FT                   PYSQALARFPAHLQQLDMESNGKSVNRFGIPITYKTGPVIFGEPGTNGQHSFYQHLHQG
FT                   TSVVPLQFIAFQHSQLGQDPIIRGSTGQQKLLANVVAQIVAFARGKEHADANKTFSGER
FT                   PSSLLYAKALTPQTLGALLAHFENKIMFQGFAWNLNSFDQEGVQLGKTLAQHILAGEVE
FT                   GVLRAYADLFDLAHAPTC"
FT   gene            complement(506517..507863)
FT                   /gene="ack"
FT                   /locus_tag="TPASS_0476"
FT   CDS_pept        complement(506517..507863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ack"
FT                   /locus_tag="TPASS_0476"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70900"
FT                   /db_xref="GOA:B2S371"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S371"
FT                   /protein_id="ACD70900.1"
FT                   /translation="MIILTLNCGSSSVKYQVYNWTERAVIAVGVVERVTQAGSVITHEV
FT                   HGRENHVRESPCPTHTEAVQLIISTLTDAHVGVISDMSLIKAVGHRVLHAADRFVKSVV
FT                   VTPDVLETFRSVQDLGPLHNPANIRGIEAAQAVIPSVPHCAIMDTAWHQTMPEASFMYA
FT                   VPRQWYEEYAVRRYGFHGTSFLYTAKRASVILKKRAEDTNIIIAHIGNGASMCCVKNGV
FT                   SFDTSMGITPLEGLIMGTRCGDCDPALAFYIMRKTGMSVSDIDTTLNKQSGLLGITGKY
FT                   VDRRDVCAAMKNGDALARLAFDMEVHRIRKYFGAYVAALGKQPDALVFTAGVGEMCCDV
FT                   RAAACAGLEHLGIRLDARKNELARTRNAETEISTDDSPVRILVIPTDEELVMTEDTYAL
FT                   MQGTYDVHTRFTYSFQDPTYVNKARAAGLKRDLEKNPALATIVVPRLDT"
FT   gene            complement(507930..508655)
FT                   /locus_tag="TPASS_0477"
FT   CDS_pept        complement(507930..508655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0477"
FT                   /product="possible glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70901"
FT                   /db_xref="GOA:A0A0H3BKN0"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKN0"
FT                   /protein_id="ACD70901.1"
FT                   /translation="MKKHIFEDARAIAAFLVSVFDSRLKTQEILWLALSGGSTPREIFR
FT                   TWAHEFRHHLDWKRLRFFWSDERCVPPTDAQSNFNMTHSALLEPLEINPDAVFRVRGED
FT                   APESACAAYSQEIEARLPRQRGVPCFDIILLGMGADGHTASIFPHEIELWDHSGCCVVA
FT                   THPDTGQKRVSFTGHLINNAHEIYVVVTGREKQDMLASVASDPHASVPLHAWTLPKRSG
FT                   CWIPLLRGLYPRKQCKPTV"
FT   gene            complement(508716..510263)
FT                   /gene="zwf"
FT                   /locus_tag="TPASS_0478"
FT   CDS_pept        complement(508716..510263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="TPASS_0478"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70902"
FT                   /db_xref="GOA:A0A0H3BIZ4"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIZ4"
FT                   /protein_id="ACD70902.1"
FT                   /translation="MGKISGSGTVAPHILVIFGASGDLAARKLIPSLWDLFEQELLPRT
FT                   FGILGAGRTALSTESFRARLAEAVTKHAVRTPHDPARLTEFLQKIHYFSFDPTDSVAFA
FT                   DFATYVRTLDQSLHTEGNFIFYLATPPSLYETIPTQLAMHHLNREQGNFRRVVIEKPFG
FT                   YNLETAQHLNASLRAHFQENQTYRIDHYLGKETVQNILVTRFANPLFEPTWNRTHIDYV
FT                   EITASESLGVENRGGYYDQSGALRDMIQNHLLLLLGIIAMEAPAVVSSSRLRDEIVKVF
FT                   DCLRPMGERDVMQHTVRAQYVAGKIRGVAVPGYLEESGVDPRSCTETFAALKCYIDNWR
FT                   WMDVPFYLRTGKRLPTGVTEVIVHYRTLPIALFEHIERPCAREGNALVIRIQPDEGIQL
FT                   KIDLKEPGAGFKTIPVSVDFQYSALTYSHLPSAYERLLLDCMNGDNTLYHRDDAVESAW
FT                   RFIDPILAAWKSNKSPLLTYPAGSWGPKAADDLIKGSAPRWHHPSSTLLSDDFACRL"
FT   gene            complement(510336..511010)
FT                   /locus_tag="TPASS_0479"
FT   CDS_pept        complement(510336..511010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70903"
FT                   /db_xref="GOA:A0A0H3BIG9"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIG9"
FT                   /protein_id="ACD70903.1"
FT                   /translation="MTLSHPTREDRPSRRVLQLGLDRMGIQWHTARGGVRARCVVRVGS
FT                   LLAALGMGAGVFAAEVFVSPKVGQVGAHPWGKEPAPRTDVLLYTPTLGLAVGVIAHNGF
FT                   AFTTELDAGLAFLMFRAQFLVGWAIRSGKNFAFIPSLGVDILSTQDDKLVGIPINLDFL
FT                   IFFTKHVGLDFTFGSGVNVPLTKNLKKGANGNGQDLTWSNIWAKYCCTSLVMVKIGPVF
FT                   RI"
FT   gene            511122..511610
FT                   /locus_tag="TPASS_0480"
FT   CDS_pept        511122..511610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70904"
FT                   /db_xref="GOA:A0A0H3BJ98"
FT                   /db_xref="InterPro:IPR019935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ98"
FT                   /protein_id="ACD70904.1"
FT                   /translation="MIRALFSLFRSLHANTHPADLAHAAALALALALLPRSSLLWYLLF
FT                   AVCFFIRLNRGLLLLSLVLFGFVVPSFDPWLDSLGNWALCLPRLQPVYRALIEIPFVGL
FT                   ARFYNTMIAGGLVAGALCYLPCYALARCAVTAYRTYLYPKIHHATIFFLVRNAPLCKR"
FT   gene            511642..513075
FT                   /locus_tag="TPASS_0481"
FT   CDS_pept        511642..513075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70905"
FT                   /db_xref="GOA:A0A0H3BKL1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKL1"
FT                   /protein_id="ACD70905.1"
FT                   /translation="MSDDSTPKTPSRRIRHTGRRRTLHRFFCKRYTPRSLKRFLRRIHI
FT                   PADRAYCMRYLADPVSTPVRVFGRTLLSRTYVRFDQQAIAHSADLKRLNAIAASIAKQR
FT                   GRVNFWSLSMACASVLALLGLVYLIRNVIARRVVIGGSEAVFGARCEAAVVDLDLFNAR
FT                   FRLKNYAVANKHHPMWNLFEIENIDIHFDLLELSRGKFVSHTMVVEGVTWNTPRKTSGA
FT                   LPPRRAKRQRVRSSNPLIAKIQEKAAELAAPVSFGAGFSALKAQVDPRILLEREVKALK
FT                   TPTLVQHVGAQAPKLAERWTQRVFDAHARAEKTVAAIRAVTELDFHALKDVSAIKQGIE
FT                   TLDRARRSTEEALATARTISHELQQDVHSTLGLAREFAAAVKADGARIARAAAAIRDIQ
FT                   ADGGKKFISGLCTVFLARSFSHYYPYVAQMLDYVRGSQRTPSDGSPSAEAEKTAQSLTT
FT                   RKRLQGVIFCLSATSLPCC"
FT   gene            513042..513890
FT                   /locus_tag="TPASS_0482"
FT   CDS_pept        513042..513890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKN4"
FT                   /protein_id="ACD70906.1"
FT                   /translation="MFERNVPSVLLRNIGVSAADPQARFSVAARVRNASNDAHGFGEPI
FT                   SFLLDVAAGAQDASLRGVVDLRRAHPDLVDVSCTARGIPLAVPAPAEGFPELSGVLGLH
FT                   TQVFVRKDHSVELKMGARISDSVLRAAPFEPRVLFDVYADVLRQIRQIAFEATVRVSAE
FT                   GALSISVESDADGAFVRALSRAFAQQVDALRRAVIAEGERFLAQQRRVYAQEIAQVTQL
FT                   VSRAEDAIAQLGVSSRVIQQKRAEAERLLEAAARKALGEVTKRAADELQNKARDAFRSF
FT                   F"
FT   gene            complement(513956..515080)
FT                   /locus_tag="TPASS_0483"
FT   CDS_pept        complement(513956..515080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0483"
FT                   /product="hypothetical protein/fibronectin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70907"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIZ9"
FT                   /protein_id="ACD70907.1"
FT                   /translation="MSIISRVCIPCAVLLFAQLHAKELVHVSQLKEQEARISWQEVPGA
FT                   VSYRVLIRNAHGRIVTNAVATTRSYSFSRLRPGSYQYQIIAYDVLHRASASAWTSLSIE
FT                   KVHKPKTGGITPSTIEHVVGGEAYTVVXDRXWTYEKGWTIALFPDDKADEAGAYVKPLS
FT                   VSKNKEGNWMVAIPNAALKTGSYTLRAITPRNIYAEVRGILHVVLWRRPIFFYYDLSVG
FT                   YAPVYRPQDHAATINGVSDFFKICSPIGFVGTFEMCFFKRNSSTISAGFNAQMHSDSKQ
FT                   VDVKLDGNFAYLYELYPRIEVGGMLGLGYSLPFGQRKEDDSMYSYVTGTMKYFFTNSIY
FT                   LRVQQQHMLTVKPSFTGVSLQQTPSLSFGYRFHN"
FT   gene            complement(515067..517082)
FT                   /locus_tag="TPASS_0484"
FT   CDS_pept        complement(515067..517082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70908"
FT                   /db_xref="GOA:A0A0H3BIH2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH2"
FT                   /protein_id="ACD70908.1"
FT                   /translation="MTDRRRSMSCVHFFPLKSRGFLPTLTSKKRSVKLSKQDATVTVVI
FT                   LLLILLLGWGYSRALRLSQGKGNPIGRVFFYKKTATRKKNNQALWLKLKDGVPVYHRDV
FT                   LRTTTGSEAVIVFTDNSRLDIAENTMVRISHTGMKKKDVRLVTGAIRYARAAGNPAAHT
FT                   VHVGKTTISLSGDGQVNVRGGERDSTVEIARGEALLHDAQGQTLPLQTFTQLATSREDG
FT                   TVRILHPTFVPLLPDQDALLLTAEHTRSVGFVWLGDATTVQPSVRLQISRYADFSVIET
FT                   ERKLTLPHEANASRTTFKTSERLGEGRWFWRLVPQNGTASAPRSFSVRRARKVMLHTPR
FT                   AQAVLSYRDAIPPTLFSWTSVEDVEQYRLLLSSRADFSADVKTFSLRTPEISVPGLGEG
FT                   TYFWKVVPRFDEGIEDPVFASEVGTFSIKQGKELHAPVALFPAEDEVLEHADRENRMVI
FT                   FTCEPIPEARRYVWTVKNMDANASPLVTTTSVPFLTVPMRSLRARLQEGTYQWQVAWET
FT                   RRSDRSPYSALRAFTVIEGMHAWEEEPETRDLIALRAPSFVLRDMPALITEKYLLQHRA
FT                   LRCKWTAVHNAQRYTVTLKNKKTDAVLQTATTTGVEFSFTNLAHLEEGSFHWVIQAHTE
FT                   QEGYEPASAQVVRAFTIRVSELERPRAKEIVHYEYH"
FT   gene            complement(516976..518820)
FT                   /locus_tag="TPASS_0485"
FT   CDS_pept        complement(516976..518820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0485"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70909"
FT                   /db_xref="GOA:A0A0H3BJA2"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJA2"
FT                   /protein_id="ACD70909.1"
FT                   /translation="MSRKNANQKIVWPLTTKLIGIISTVVVLATIAVTAMASWFFASSL
FT                   HSNAELNNLAAAENFAAQIKGEFEAIATSAKSFVSLGLRSGARMHSRSALSKDFFSFYP
FT                   RIGYIGVGGVAELWNGDFFKKNQLRVADARRFLADNAQVISTLQTAPATLNAAPWFKAQ
FT                   IIAIVAPFEVDGATRNVVVIFSADVVQHLLESGASSGTMYAVTWAGNSLYHPEYSLNYS
FT                   NINLQDSPVVRDLRESTQLTKQISFIGTDNKRYFGAFAKQTFGKFAIVLETPMSVVYQA
FT                   VYYAIILDGILTGMVLLASILLVWFIAQSITRPILTLVGATHAISSGQFLLDIKPSSKD
FT                   EIGLLTETFVSMGRGLAERERMKEAFGKFVNRDIAEKAMKGELALGGERKTATIFFSDV
FT                   RSFTEMSEKLPPEDVVEFLNEYMSCMVDCIEQTGGVVDKFIGDAIMAIWGAPVSLGSAR
FT                   LDALQSMKAVFLMRESLIQLNEKRVACSKPRIGIGCGVNTGSCVAGQIGSSKRMEYTVI
FT                   GDAVNTASRIEALNKPFGTDFLISENTYELVKDMLIVEKMPPITVKGKREPLNVYAAIN
FT                   LKGHDGPQTLDELRALLSIEKPGLSADPDFEEKKCEVI"
FT   gene            complement(518817..520412)
FT                   /locus_tag="TPASS_0486"
FT   CDS_pept        complement(518817..520412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0486"
FT                   /product="antigen, p83/100"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70910"
FT                   /db_xref="InterPro:IPR007926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKL3"
FT                   /protein_id="ACD70910.1"
FT                   /translation="MKNVLPMCAVLGAGCLFALEVDRRELERANATVEFENFAGTHTDV
FT                   DSAAAIRRIGEGLASALRGGVAGDRARYALIHAVGPHTTNGFDADILIIGAQARVDHID
FT                   NIREIVAAYLSAAYGYRLQDARTIATFTTVYNAVYRADLPTFKARYKGVVTAHLSPEHV
FT                   GIARRFDQWPGKTQLVIPLSGHSDALSAVDTGAISDKRVVERLREDPDKNVDLRRDMID
FT                   LKEREAQEGTRRAQQLAQQSQQAQERAAELSTQAQRAQAHADKTRREAQQAQQAAQNSP
FT                   DPARTQEAKEKERVAERAQQEAQQAAHTAQKATEQAESLAREARSQEQRAQQKSAEAQR
FT                   ERLEVAGDMQRMMNAGRAKATHGAQEARESVTPCYGLKVVDAQHLLSEIVLVDPKTEAP
FT                   LRSSSLRTVRNRLLYSEPHALVAIADTTGNGTVRLVHIDPKTLEVTKESTQRIAAQSFL
FT                   LREEEHYYAVIDENGSHFLGRFTKNLELTTRSAAQVTPYTAVTVTPRGIMVQTKEKGMA
FT                   LLHTRTLADALPRT"
FT   gene            complement(520501..522078)
FT                   /locus_tag="TPASS_0487"
FT   CDS_pept        complement(520501..522078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70911"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKN8"
FT                   /protein_id="ACD70911.1"
FT                   /translation="MGFLQPGHTRPRICCPACCHARCKACGERGERGAVHRACNFKRRT
FT                   AAVHHRTRPAVLQQYRPAPVESEAWRKAPPSSDRCKNARIFHHGPAGTVEYWSIFGEKK
FT                   GALRASGSVRALTSTPRGYVVATDQGLWRVRTDTLNSTPDKTQAGKTAKQHQAPVPVRI
FT                   STQRSCVALFATENMLIALFADGAVRAYDADGENELFSLTLPCTFSSAAQCRVQGDEIV
FT                   LSDTARAITLSAGGALKWNISLYETPFTPLITTDGLVVSAGGWVLNAYRAETRLIDHTP
FT                   IYNRDSYFHVLGSSRRAHVQEAPPSRPAAPAKRSPYDSIFSSDPFFSSPAPAKNSGKTD
FT                   NAQETHTTSPPGPYATPELLFQAVQTSLKEGNVGPREPAYSRSLHALLTSPHHARARAP
FT                   AVTSARRAQAATLLGALGAHEYRDALLELLKEQDYTVLEGILKGLTRCTFGLDERALLA
FT                   LYRVTRAKDARAESLMRAACDALAACARSAPRTLSEKAVSELSRISTGAFPYTIRAYAR
FT                   TLVQSMLR"
FT   gene            522306..524843
FT                   /gene="mcp2"
FT                   /locus_tag="TPASS_0488"
FT   CDS_pept        522306..524843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp2"
FT                   /locus_tag="TPASS_0488"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70912"
FT                   /db_xref="GOA:A0A0H3BJ05"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ05"
FT                   /protein_id="ACD70912.1"
FT                   /translation="MCGATACGARICKAERQEHCEGAVPYGYAHPFCTVLVLISLREGV
FT                   YPFTHCGCLRSELCVGSNGRCPKRAAPDALHMCLRGAHAPCGAELFPVKPCKRKNACGR
FT                   IGPRWVKGLVTFHSHIIIPREWLMGYGSSAEETSSTPHASGQRKVGFLSLRTKLALVFG
FT                   LLAFVSGLVQGGILVVFARNSIVGEISRHLADRARDTSSIVEGRIGALFQFLEGLARLE
FT                   VLQGSSDRRRAQVDRLKKEAFFNRDIARLAVVDLAGVLYGEDGRTHYVQDRKYFQRAVK
FT                   GRCYVSAPYPSRSSDDMVITFSIPVYDEDRRVIAVLVADVIWTWLCDITGDFSVGGVGR
FT                   IAVIDEVGTVVAHPRHEVVAQQTNYIRLAKEDPATYASVAEFVEKVIKSDSTASHVFSY
FT                   EGLEKIGSSAKMKSTGWTVVVFAPVSEFMGPVYTLQNYLLAVGIIVVLFSLIVVYAVAR
FT                   KIVRPLRSTVRVLEDIAYGEGDLTVRLPVVGGDEVSLLCQYFNQTMEKIRFAIATVGSS
FT                   SDDMRRIGDELASNMTETASAVNEITANIDGVKHQVDLQVSGVSEATDTVERIIKTIKG
FT                   LNSSIETQAVNVAQSSSSVEQMVANIVSITQTLERSDEAVHSLAIATADGRDTLVSSSG
FT                   ITQKISEESGSLLEASSVIQHIASQTNLLAMNAAIEAAHAGEAGKGFAVVADEIRKLAE
FT                   ESSTQGKTITETLKTLSVEIDTLSTSSKAVEEQFDTIFRLSDQVRTMSRSLTEAMKEQS
FT                   DGSREVLAAIKSINAATVDVKEGSADMLKGGEVIAREMQRLDDLTSEIARSMNEMAAGA
FT                   IEINNAVHEVNEITQRSKQSISSLADEVEKFKV"
FT   gene            524956..525030
FT                   /locus_tag="TPASS_t0019"
FT   tRNA            524956..525030
FT                   /locus_tag="TPASS_t0019"
FT                   /product="tRNA-Thr"
FT                   /note="tRNA-Thr3; codon recognized: ACA"
FT   gene            525040..525121
FT                   /locus_tag="TPASS_t0020"
FT   tRNA            525040..525121
FT                   /locus_tag="TPASS_t0020"
FT                   /product="tRNA-Tyr"
FT                   /note="tRNA-Tyr1; codon recognized: UAC"
FT   gene            525291..526259
FT                   /locus_tag="TPASS_0489"
FT   CDS_pept        525291..526259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70913"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIH7"
FT                   /protein_id="ACD70913.1"
FT                   /translation="MRVHFWGVRGSVPTPVTPRQVQSKIAAVVQRISAKDVRNQRSKER
FT                   FISDLPAWLFGTTGGNTTCVEMETDCGETLIFDAGTGIRDLGIDLMSRPGYRAQGHVYH
FT                   LLFTHFHWDHIQGLPFFNPAFDPRNTIIVYSTRKKMKEFLEDQMRYPYFPISMFGRDGF
FT                   NAKFEFRLIGNHEECFAIGKTKITWNRVRHPGGCVSYAVSEAGGKKVIFSTDTELRQKD
FT                   FDRSERNVCFYDAASLLIIDSQYTMTESIKKEGWGHSTFSIVVDFAVSWGVRRLALFHH
FT                   EPTYDDKKLFSILQNACWYRKYVGAHDLEILLAQEGKDIFV"
FT   gene            526256..526444
FT                   /locus_tag="TPASS_0490"
FT   CDS_pept        526256..526444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJA4"
FT                   /protein_id="ACD70914.1"
FT                   /translation="MSEEERMYSFSGEEIKELALLFRRCGQTLAPALRRLALFVDRTVC
FT                   RHMTVEEAEDFFGSAER"
FT   gene            526451..527485
FT                   /locus_tag="TPASS_0491"
FT   CDS_pept        526451..527485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70915"
FT                   /db_xref="GOA:A0A0H3BKL8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKL8"
FT                   /protein_id="ACD70915.1"
FT                   /translation="MSIRTFSFTPSVRLRRIVLWGSLFCAGVLCLLCLCLLVGLAPVRP
FT                   FVKKEHMFTVQSGVGARKVIHELRNARLIRSEWAARLYVFARALNFKAGSYAVSPAMSA
FT                   VRILTMLDDVEQQRFIKVTVPEGLTVKKIAALLQDATVVSAAAFVEACTSAALRTRYKI
FT                   PAPSVEGFLYPDTYFFSYQERAANVVGTMIENFLAKTSQLPSFPGDPVARFKTVILASI
FT                   VEREYRVASEAARIAGVFYNRMKVNMGLQSCATVEYVITEIEGKAHPERLFFKDLEIDS
FT                   PFNTYKCAGLPPAPISNPGLTALNAALHPEVHDFFYFRLTDPQRARTRSPRRWTSMIKL
FT                   GSCC"
FT   gene            527509..529326
FT                   /gene="dnaG"
FT                   /locus_tag="TPASS_0492"
FT   CDS_pept        527509..529326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="TPASS_0492"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70916"
FT                   /db_xref="GOA:A0A0H3BKP2"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKP2"
FT                   /protein_id="ACD70916.1"
FT                   /translation="MARISAHVIDAIADRVDLVSLVGNYTHLERRGDDWWGRCPFHHER
FT                   TPSFHVVPDKKMYYCFGCGVGGSTIKFFMEIEKIDFHEAAVRLAKRAGIEMSFEDGVHA
FT                   PSAHASFTMQLCEVYQRIAETFHHVLMHTAQGARARAYLASRKVTDDSIRTFKLGYAPP
FT                   DPVWLFQFLRHKGYSPEFLARSGLFAKKSERIAVFSDRIMYPIADRYGQVIAFGARALG
FT                   TAPAKYLNTADMPQYKKGEHLFAFHCALSQMRKTRAAIICEGYMDVIAFHQAQLTYAVA
FT                   PLGALLTKSQARLMRSFVDRIYMCFDADGAGRAATYKAILLCRSLGFEVRIVELNGGTD
FT                   PAECACIEGEDALRKSVERSTTDAQYLIRCARHEHSHLGADDTSRAVSFLFPYLSVLDS
FT                   AIQREQVMQDIAMAFGIRIQAVHADYLRYVSRTTQKGTTGNCVLSVQGTAIQVKEPATG
FT                   VRTAQLRLVLAVVANPELFELLRESVCADDFEDPMAKELFIILEECYRADTRASPHVLS
FT                   CCTTDELRKLVSEAIVCGEFSCNAPQIVRDGVALVRRNRLLKERESLVGRLRRFGDASS
FT                   GEECGSMQELMMEKQRVDEELERLKGVRK"
FT   gene            529323..531158
FT                   /gene="rpoD"
FT                   /locus_tag="TPASS_0493"
FT   CDS_pept        529323..531158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="TPASS_0493"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70917"
FT                   /db_xref="GOA:A0A0H3BJ10"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ10"
FT                   /protein_id="ACD70917.1"
FT                   /translation="MMELSRTPAVMRLLEYAREKKAITHDEVENILAHYGVETEELLHD
FT                   VLDMLEQENIKVFSSEEEELEDEVFAGLKGPAADDGDGSFPLSTERVRDKLCDSSRGAR
FT                   QNLLSNARNIALDDPVKLYLRDIGQEKLLTAEQEVMLSKRMEEGEGIIKDIITQSGLLL
FT                   PEFYHIGRSLSKKALAVLDPAESGRTRKEISEEMADRRRLKQAYGEVLRSLYPEMRHYM
FT                   AMKKRLDERGEPVTVLSSDEEVCKQRDKLLSCLQKVDLQLEEIDRFSRKFLDTARKIRE
FT                   YKRRKDRHEKQLMIADLCDMRKIGRGLAVPRQRAKLEETLGMSADCIQEIYTQIQKVTR
FT                   RLRRIEYDFENTIDGILSMARAIHRGHVMLKKAKDKLINANLRLVVSIAKKYTNRGLLF
FT                   FDLVQEGNIGLIKAVEKFEYRKGYKFSTYATWWIRQAITRSISDQARTIRVPVHMIEQI
FT                   NKVTRESRQLLQKFGREPSDEEIAQQLCWTVEKVKQVKSVAREPISLETPIGEEEDSSL
FT                   GDFVPDADVENPSRVTERVLLKEEVRSILSALPAREHEVLRMRFGLDGDYSQTLEEVGL
FT                   YFDVTRERIRQIEAKALKRLRHPRHSRRLKDFLDS"
FT   gene            531168..531989
FT                   /locus_tag="TPASS_0494"
FT   CDS_pept        531168..531989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70918"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BII0"
FT                   /protein_id="ACD70918.1"
FT                   /translation="MVPANVFENLRALQVVLAQKNRLETEIAEAPKFLVAQEELLTRCK
FT                   ESFIEKNVEYESVREEVARLTTELCKAEKRREDAEVAMDNISTQREYDALDREIQEAKR
FT                   QEVALRSEVARSDVAYKRLAEEIKLDQEDIVQQERELTENKARVDAEVRGKREQVLRLQ
FT                   EEERRLSPDLDRDVLFKFERIIKSKQGVGIVPVRGNVCAGCHMILPAQFSTGVREGNSI
FT                   VYCPYCSRILYYEETDEPEMTFFDEEDLGSLSDLVYPEESGGFGGGDREEI"
FT   gene            532319..533308
FT                   /locus_tag="TPASS_0496"
FT   CDS_pept        532319..533308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70919"
FT                   /db_xref="GOA:A0A0H3BJA7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJA7"
FT                   /protein_id="ACD70919.1"
FT                   /translation="MTESGLPVLCFFRVSMEFLLRRSGHQSFFPGRRKLPNSVFLFSVF
FT                   FALVVGVGVGAWRYRRYYRGLPSARSVYEDWKNGNYKAVYDKAAEILQRRVFDAEMLAL
FT                   HGFAAYYIFSEQTDLSVSYDYLNSAIVSLRRALHVVRPAEVPNVSYVLGKAYYQRGYYY
FT                   ADLAVKYLDLAYNAGFRAADLAEFRGMSASLLGDMQKAVESFTQALAAQPSDLVLYALA
FT                   ECYEKLSDFSKAKLYLYDTIGKTKDVLLELKCRNRLAALYLSERNLAEAERELDVVLQK
FT                   DERSAEAHYHRGVLYEMGSDLVRARAEWRRALRLNPLHEPTRVKLNLK"
FT   gene            533321..534355
FT                   /gene="mreB"
FT                   /locus_tag="TPASS_0497"
FT   CDS_pept        533321..534355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="TPASS_0497"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70920"
FT                   /db_xref="GOA:A0A0H3BKM2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKM2"
FT                   /protein_id="ACD70920.1"
FT                   /translation="MFFLRRFSADVGIDLGTCNTIIYVEGRGIVVNEPSVVAVERGTKS
FT                   VVAVGSDAKRMLWKTPGNIVAIRPLKDGVIADMDTTEKMIRYFISKILPRHRLIKPRMV
FT                   IGIPSCITDVECRAVHESASKAGAGEVEVLEESLAAAIGANIPIEEPAGNMVCDIGGGT
FT                   TEVSVISLLGMVVTNAIRVGGDEFDQAIIKHVRSVHNLIIGEQTAERLKIEIGNASPEK
FT                   NIEKVEVKGTDAITGLPRRLEIDSVEVREALKEPITQIVEEIKRTLARTPPELAADIVE
FT                   RGIVMTGGGSLLKGLPKLISKETHVPVILAENPMNCVAIGAGRYHEVYKDISGDRSLYA
FT                   GLNS"
FT   gene            534360..535223
FT                   /gene="mreC"
FT                   /locus_tag="TPASS_0498"
FT   CDS_pept        534360..535223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="TPASS_0498"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70921"
FT                   /db_xref="GOA:A0A0H3BKP6"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKP6"
FT                   /protein_id="ACD70921.1"
FT                   /translation="MEKAFFFRIDSDLFTFIVFLLVSSGLLVFSGGELIVSFRDVGFSV
FT                   TSRVEKAAASVSFFVTHTVKTLKTLSEVQRRYEVLREQLKDYEFLQGSRESLRKENQRL
FT                   RAMLGFSRELSTRNIPAEIIGFDPDNLYSGIVVSRGARHGVRKNMPVVAFQSDTLGLVG
FT                   KVVQVSRTTSMIVPLYHYQFYVAGKLERAQYRGLISGQGGSDFPLLMRYVKKHGQGSIR
FT                   VGDLVVTSGENYPFPKDVPVGKVRDIKLHDHETSLELSLDPVLDLFRLEYVFILDLSLS
FT                   QEGPHG"
FT   gene            535220..535726
FT                   /gene="mreD"
FT                   /locus_tag="TPASS_0499"
FT   CDS_pept        535220..535726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="TPASS_0499"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70922"
FT                   /db_xref="GOA:A0A0H3BJ15"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR017225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ15"
FT                   /protein_id="ACD70922.1"
FT                   /translation="MIRLIAWSVGTSFLFSIVEMAVFVHVSYLSIMPDLVLLVVLFTSI
FT                   HNGVVAGIWTGFIAGIIFDFLSISPFGLHSFVFTTIGFMVGKVQGRYHIDRVFAPAVLA
FT                   GFAMIFKVGLVLVLRGVFGPNIQVYSVFSRQLWIEMTLNIVFVPFVFGLLNMFPTTFLY
FT                   KRFSS"
FT   gene            535727..537601
FT                   /gene="pbp1"
FT                   /locus_tag="TPASS_0500"
FT   CDS_pept        535727..537601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp1"
FT                   /locus_tag="TPASS_0500"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70923"
FT                   /db_xref="GOA:A0A0H3BII4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BII4"
FT                   /protein_id="ACD70923.1"
FT                   /translation="MRYFSLLPDRHMLFRIKVLTWLVVLVMLLYMRQLFVIQIVRGDSF
FT                   KKKSLNISQRSKVIPAQRGEIFDRHADLPMVLNVNSFAVDMIPGEVPPEQFDTVLNKLS
FT                   HILRVPISDIRKKIPDAVRRSFQTVELRSNVSYEDITAIAQIIDELPGVSWYSKPVRNY
FT                   VETGSFAHVIGYVGEITKEELKRFYSKGYRPNSLIGKAGIEKEYDEVLRGKEGHEYRTV
FT                   DARGRYIENTSVTNPPRMGNNLVLTIDRRIQKLAEDALGPRIGAAVVLKPTTGEVLAMV
FT                   SYPYFDQNIFTQHNAHELYAQLSHDTRFPLLNRVVNASYPPASTFKIVMSTAILAEKAF
FT                   PHEKTVDCPGEIEYGNRLFRCHIRKPGHGKVDLRRALEQSCDIYYWTVCRDYLGIDRMI
FT                   SYINDFGFGKSARIDLPSQTEGMVPTPKWKERRFHEKWLDGDTMNLAIGQGYMLVSPLQ
FT                   VANMVAMTVNNGVIYRPHLLKEIRDSRTNEVLFRHKPEVLKTAKIPAEIFEHVRADMHS
FT                   VVTRGSSQYAMKNKTVSLAGKTGTAEVGFHNRWHSWMAAYGPYHRPLDEAVVVVVLVEA
FT                   RNEWEWWAPFATNIIFQGIFANEDYEQAVESLKSYGISLGVPARSRQE"
FT   gene            537598..538899
FT                   /gene="rodA"
FT                   /locus_tag="TPASS_0501"
FT   CDS_pept        537598..538899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="TPASS_0501"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70924"
FT                   /db_xref="GOA:A0A0H3BJB1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJB1"
FT                   /protein_id="ACD70924.1"
FT                   /translation="MRIRGVSDFDYLLLLTMLALTSIGILFIYSSVVNSEGHVISREYL
FT                   KQIVWAVMGVVLMLSVSMYDYHRFKDRTTLIFAGFILLLIYTRLFGRYVNGAKSWIGVG
FT                   EFGIQISEFAKIAYILYLAHYLVYSQSEPMLKRFAKAGVITLLPMALILSQPDLGTASV
FT                   YLPIFLVMCFIAGFPLRLIFAVVCVVLLTLLFTLLPLWEQTFLQYQGVATRIADSRMLS
FT                   LFVFFSLSATSAVAVVGYLLSGRKYYYWITYALGMVSISYGASLLGVRVLKPYQMMRLI
FT                   IFLNPEVDPLKAGWHIIQSMIAIGSGGAFGMGYLRGPQSHYRFLPQQSTDFIFSILSEE
FT                   WGFVGGVIVFGLYLLFFLHTLSIMSHVDDLYGKLIASGVLGMFLFHFVVNVGMTMGIMP
FT                   ITGIPLLLLSYGGSSLWTAMIATGLLMSINARQL"
FT   gene            538925..539821
FT                   /locus_tag="TPASS_0502"
FT   CDS_pept        538925..539821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70925"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKM7"
FT                   /protein_id="ACD70925.1"
FT                   /translation="MKVVLFYDQGRAHSVAAICEVLCAQGCAVTPHAIEQVWNDTSPCS
FT                   TPLALVQDATHVFFLYAHEPMRDPAFIFFSGVACGRGMHVLLLATTTEVRDIHVFRDLV
FT                   FLLEEETFEDFFRVEHERFVRQKKKRVARTALLERGYPCFEENFIATVMDGNIDIVNLF
FT                   LDAGFSAALKDARGTPVLSLAVREGQDEMAAQLIARGAPVDQLSDDRAYSALMEAAQIG
FT                   NRTVARLLLHAGADPNVRGSNGQTALVLAVGRKDHVLIRLLMDHGANPYLEDKLGLSAQ
FT                   GYAKLFNDPTLCTLVGV"
FT   gene            539800..540363
FT                   /locus_tag="TPASS_0503"
FT   CDS_pept        539800..540363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKQ0"
FT                   /protein_id="ACD70926.1"
FT                   /translation="MYAGGRVVRSAFARGKVCYLIGSVLWGSVSCTQPRVQKWVQNDGK
FT                   VNVHSPQERAGVVATFGTVRITRSDYERTKAELQDVVAHLNRITAERDYHKWLVYLSDA
FT                   YRRAYSMPDILQQSSDALPKKGVRLRHLRDYFIHVFVPSRQNVRVDSIVFESPTRVDVI
FT                   MNHGGKALLVYKIEKIHSAWKLLP"
FT   gene            540345..540485
FT                   /locus_tag="TPASS_0504"
FT   CDS_pept        540345..540485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ20"
FT                   /protein_id="ACD70927.1"
FT                   /translation="MEVTPLETGRARSHQKASTAAQPHAADEKMTGSTARRYLSQDHQS
FT                   V"
FT   gene            complement(540494..541828)
FT                   /gene="hxk"
FT                   /locus_tag="TPASS_0505"
FT   CDS_pept        complement(540494..541828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hxk"
FT                   /locus_tag="TPASS_0505"
FT                   /product="hexokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70928"
FT                   /db_xref="GOA:A0A0H3BII8"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BII8"
FT                   /protein_id="ACD70928.1"
FT                   /translation="MDQHTRTRDLVSAFFGRFHFDVQGPSVRTVVDVLRADMVRGLEEE
FT                   AQLPPRMGSALAMIPTWVAPPRVSPCNRRVIVIDAGGTNFRSCLVRFGDSGTPHIENLE
FT                   KRPMPGTTREYSRTEFFGEIADNLARLKGAADCIGFCFSYPIRIRPDGDGEVIQFAKEI
FT                   KAAEVIGTCVGAGLTEALSARNWPELRSLKMLNDATSALLAGFFAAPEGCSFSSYVGFI
FT                   LGTGMNSAYLEPDPIPKIPAHHTPQVVVCESGKSNKVPRSVFDELFTQTTAEPDIAHLE
FT                   KMSSGTYLGPLASVVVRLAAQEGLFSHAVHAALSTVSFTLVDMDRFLFAPSVSTTTLGA
FT                   LLAPGTDTDREILFLLLDAVVARAARIAAGVIAASVLKSGAGYDPLRPVCVLAEGTTFQ
FT                   RTYRLRTRVTSHLQAFLTEERGVYFDIISLENAVTLGSALGGLSS"
FT   gene            542188..542260
FT                   /locus_tag="TPASS_t0021"
FT   tRNA            542188..542260
FT                   /locus_tag="TPASS_t0021"
FT                   /product="tRNA-Lys"
FT                   /note="tRNA-Lys1; codon recognized: AAG"
FT   gene            542320..542400
FT                   /locus_tag="TPASS_t0022"
FT   tRNA            542320..542400
FT                   /locus_tag="TPASS_t0022"
FT                   /product="tRNA-Leu"
FT                   /note="tRNA-Leu4; codon recognized: CUA"
FT   gene            542411..542482
FT                   /locus_tag="TPASS_t0023"
FT   tRNA            542411..542482
FT                   /locus_tag="TPASS_t0023"
FT                   /product="tRNA-Gly"
FT                   /note="tRNA-Gly2; codon recognized: GGC"
FT   gene            542563..543891
FT                   /gene="tig"
FT                   /locus_tag="TPASS_0506"
FT   CDS_pept        542563..543891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="TPASS_0506"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70929"
FT                   /db_xref="GOA:B2S3A0"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3A0"
FT                   /protein_id="ACD70929.1"
FT                   /translation="MELQKKFTALAQSQVELEVVVAREDAQRHYQRFVEEYLERARLPG
FT                   FRKGKVPLAVLERKYGSAIRQDAAAALMEKALEEGFAQASQDSQPLPISRPSLKKKPVF
FT                   DPDEDFSFAVIYDVFPSVELRNTSGFSLSVPTVSVTEEDVSRELTRIQERNALVTDKGA
FT                   DSCAEVGDIATVDYHEVDDSGAVRPGTERAGVVFTLGVEEGPFALGQDILGMKLGQRCL
FT                   FAKRAGMLKDEAAQVRVTLKALKQRQLPSLDDELAQDVSDAFRTLDDLTRSVRQNLAEA
FT                   LEAALHEYKRRQLLRILVRENPFSLPESLVVGEMESRWALVMRQFGVSLSGTPQNKLQF
FT                   FQQWRPEVEEHLKQRVIVELLLKQEQVSVSAEEIETEYVRIASKTGSKEERVREYYAGE
FT                   EKRRALCEGIRERKLCQKLLGRCVTECGPEQSLTDFLQEQSRA"
FT   gene            543884..544495
FT                   /gene="clpP1"
FT                   /locus_tag="TPASS_0507"
FT   CDS_pept        543884..544495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP1"
FT                   /locus_tag="TPASS_0507"
FT                   /product="ATP-dependent Clp protease proteolytic component"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70930"
FT                   /db_xref="GOA:A0A0H3BJB6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJB6"
FT                   /protein_id="ACD70930.1"
FT                   /translation="MRERMHNLVPYVIEQSGGGERSYDIFSRLLKDRIIFVDGEITDAV
FT                   ADLVVAQLLFLESQNPDKDISLYINSPGGAVTAGLAVYDTMQHICPEVQTICLGQASSM
FT                   AAVLLAGGAPGKRFALPSSRVMIHQPWGGVQGQASDVCIQAQEILRLKTLTIAYFALHT
FT                   GQSEEQVREDMERDFFLSAEQACSYGIVDTVMKRRKHAQV"
FT   gene            544482..545729
FT                   /gene="clpX"
FT                   /locus_tag="TPASS_0508"
FT   CDS_pept        544482..545729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="TPASS_0508"
FT                   /product="ATP-dependent Clp protease subunit X"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70931"
FT                   /db_xref="GOA:B2S3A2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3A2"
FT                   /protein_id="ACD70931.1"
FT                   /translation="MLRSKGDLVLGCSFCGKKEDERRRIVTGHGVSICNYCVERCAEYL
FT                   RDRKPSALALMTKEEIPTPLELKAYLDQYVIGQDLAKRVLSVAVYNHYKRVAGRSLDID
FT                   SVLIEKSNVLLIGPTGSGKTLLAKTLSQKMKVPFAIADATTLTEAGYVGEDVENILLKL
FT                   VQNANGDVALAERGIIFIDEIDKISRKSENVSITRDVSGEGVQQALLKIIEGTIASVPP
FT                   QGGRKHPNQDMLRVDTSNILFICGGAFVGLDGIVGTRVCKNPVGFGADVKTVKERGLQL
FT                   MHEDVIPDDLVKFGLIPEIIGRLPVTVALDALSKEDLRNILVRPRNAIVRQFEALFALD
FT                   DVRLVFDEDALDAIAQQAIDQKTGARGLRSIVERLMLDAMFEAPSLKGKKELCITKKVV
FT                   TQEEKASVRLVSERTA"
FT   gene            545826..546392
FT                   /gene="ahpC"
FT                   /locus_tag="TPASS_0509"
FT   CDS_pept        545826..546392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="TPASS_0509"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70932"
FT                   /db_xref="GOA:A0A0H3BKN1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKN1"
FT                   /protein_id="ACD70932.1"
FT                   /translation="MESLIGKRVIDFKLPAYVGGKFTEVSNASIKGSWAVFMFYPADFT
FT                   FVCPTELADLARVYPSFVEIGCKVYSVSTDSEYVHKAWADATDTIKNLPYEMISDKAGK
FT                   LAGFFGVLLPDTWHALRGTFVVDPEGLVKAFEVHDMGIGRDADELLRKVQSAQFVAKHG
FT                   DQVCPARWKPGAKTLKPGIDLIGKI"
FT   gene            complement(546573..548390)
FT                   /gene="lepA"
FT                   /locus_tag="TPASS_0510"
FT   CDS_pept        complement(546573..548390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="TPASS_0510"
FT                   /product="GTP-binding membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70933"
FT                   /db_xref="GOA:B2S3A4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3A4"
FT                   /protein_id="ACD70933.1"
FT                   /translation="MRAMACVRRVRNFCIVAHIDHGKSTLADRLIERTRAVEERLQHAQ
FT                   MTDNMELERERGITIKSHAVCIPYTDAHGTEYVLNFVDTPGHADFAYEVSRAIAACEGA
FT                   LLVVDATQGVESQTISNLYLVLEHNLEIIPVINKIDLPTADVPRVLQQVEHDLGLDPAS
FT                   SVLISAKTGENVDALFDAIITRIPPPQGSGTAALQALVFDCHYDQYRGVVVHIRVFEGQ
FT                   VTSGMVIRFMSNGAEYRVEETGVFVFNLIAREALCAGDVGYLSANVKTVSDVQVGDTIT
FT                   DASCPCDTPRAGFRRVKPVVFSSVYPVDTDECEQLREALERLALNDASISWERDSSLAL
FT                   GHGFRCGFLGLLHLEVVQQRLEREFNQTVIFTAPQVQYYVFLKTGQRIVCDNPAHYPLE
FT                   QEIAQVHEPYIRATIITPTEVLGAVMTLCIEKRAYQTAVNYLDQKRVELVYEMPLAEIL
FT                   FGFYDRLKSISHGYASFDYELIESKLTDLVKVDILINGKPVDALAQLCYRPHARRRAQA
FT                   VCARLKEEISRQQFKIAIQGSIGGQIISRETVSPFRKDVLAKCYGGDITRKRKLLEKQK
FT                   EGKKRMKMVGDVEIPQTAFLSVLKEASDA"
FT   gene            548433..549059
FT                   /gene="carD"
FT                   /locus_tag="TPASS_0511"
FT   CDS_pept        548433..549059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carD"
FT                   /locus_tag="TPASS_0511"
FT                   /product="transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70934"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKQ6"
FT                   /protein_id="ACD70934.1"
FT                   /translation="MATRAWWSSLVFPLPLPTDFFPCLCYAGPMGKACAFRPHDHVVYP
FT                   GQGVGQVQEISEKTFKNETLLYYVIYLEESDMTVLIPVDKAQELGIRTIVKRKEAERAL
FT                   RFLSEDFDPSPLDWKMRYQVNLNLFKSGGILDNAAVVRSLYHRSKVKELPIQERRLYDS
FT                   AYRIFQDEMCFALGLRPPEVETLIHGYLEKAKENPVVSGTVDVPG"
FT   gene            549056..550303
FT                   /locus_tag="TPASS_0512"
FT   CDS_pept        549056..550303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70935"
FT                   /db_xref="GOA:A0A0H3BJ25"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ25"
FT                   /protein_id="ACD70935.1"
FT                   /translation="MTRAALLVTAAGSSARMRRGGACVQKKEYLPLTSRQPGVCLLSEI
FT                   LVRALEARSFFLVVVTVPAGEVAYAESQVACDSRLSAFPSRTRPVILYVPGAHTRSASV
FT                   RAGLDAMATHAPDVVLVHDGARPFVSVALIHSVLEATCRYGAAVPVIEATDTPKGVAAD
FT                   GSIETHLIRSRVRLAQTPQGFCYASLCAAHHRAATDGEQYTDDSELYARYGGTVHVCAG
FT                   ERSNVKITYPEDLEQRASEPALTRGISVLPCTEEGALRVGLGTDMHALCAGRPLILAGI
FT                   HIPSKKGAQGHSDADVLAHASIDALLGAAGLGDIGTFFPSCDGRWKDAHSCALLRHTWQ
FT                   LVRAACWRLVNLDAVVCLEQPALHPFREAMRASLAQALDTHVTRVFVKAKTAERLGPVG
FT                   SGAAVTAQVVVLLKKI"
FT   gene            550377..551777
FT                   /gene="trkA"
FT                   /locus_tag="TPASS_0513"
FT   CDS_pept        550377..551777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="TPASS_0513"
FT                   /product="K+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70936"
FT                   /db_xref="GOA:A0A0H3BIJ1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIJ1"
FT                   /protein_id="ACD70936.1"
FT                   /translation="MRVIVVGCGTNGRELTRRLSARGHQVTLVAAAHEPVPRKIPAGAQ
FT                   ALVRHQKDHRATLGEAGIAKAQAFVAVTEVDELNIVLCGIAADLNAGVIKIAQTHDDHY
FT                   AHAVCRESRCIFGIDFLISADKEAMRAVVSTVEQGAISDVIPLKNAPYEIARFPIAKGS
FT                   GLDGITLSDMRRLVKISFVAVAFEVRGRSVIPSGETMLASGMRLSVLCAPEHMGRFYEL
FT                   AGFKIHPVKKIALIGMSAVGTLVAQDVAEKCKPHFFSSAFSLSPRERASLVLVDKSETA
FT                   TQAVCAQFPHVTAYHGDVTDEAFFAEITPDTFDLVITTTNNYELNMITAAYMKTLGVPR
FT                   AVALVHSSLMEDIAGKIGIDVAVSYQDVVVDAIMSHLAGSHVTGIHTIGDGSLEIVEFA
FT                   ISAQSPLVGKRLKDIAVHGSFLVLLISTVRGSFIPSGDTVLLEGSVLMFIVQSAQSEKI
FT                   VALLGGTV"
FT   gene            551891..554773
FT                   /gene="uvrA"
FT                   /locus_tag="TPASS_0514"
FT   CDS_pept        551891..554773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="TPASS_0514"
FT                   /product="excinuclease ABC, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70937"
FT                   /db_xref="GOA:A0A0H3BJC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJC2"
FT                   /protein_id="ACD70937.1"
FT                   /translation="MGSAARNLCIKGAREHNLKNIDVMLPRDALVVISGLSGSGKSSLA
FT                   FDTIFAEGQRRYVESLSAYARQFLGRLDKPDVDSIEGLSPAIAIEQKTTQRNPRSTVGT
FT                   VTEIYDYYRLLFARIGRAHCPHCAREIKEQTVDQIVDTLMTVPSGSRIQLLAPVVRGKK
FT                   GTHHKVLEAARKDGFVRARIDGALLHLHERISLDKQKKHSIDIVVDRIQLSDTVRKRLT
FT                   ESVETTLGYADGLLTVLVQGENSGTVSGKIETSALLPSELFFSQKNACAHCNVSVPELQ
FT                   PRLFSFNAPFGACPSCAGLGIMQTFDLDRIVPDQNRSFNEGAFLPFKPEHEWNRVRFAA
FT                   LAEKYHFSLDDPVRNLSKHALDIILHGSGSEALEFSHERKDGSRTARYIKPWPGIFSEL
FT                   HRRYAESCTHSQREVYERYLSVRTCEACRGMRLKPESLAVTIEKKNIHALSALSVDDSC
FT                   EFFKTLHLTEVEATIAQQILKEITDRLEFLQNVGLGYLTLERAAATLSGGEAQRIRLAT
FT                   QIGSRLTGVLYILDEPSIGLHQRDNERLIQTLLHLRDLGNTVLVVEHDEQTLRVADYIV
FT                   DLGPGAGVHGGYVVAAGSPPEVMQVQASLTGQYLAGAITLPIPAVRRTGNGNVLTVHDV
FT                   HEHNLQHISVRIRLGTFTCITGVSGSGKSTLLIDVLYPALYNRVMNGRLPEGKFSSIEG
FT                   TEHLDKVIYVDQSPIGRTPRSNPATYVGVFTDIRMLFSQVPEAKMRGYKPGRFSFNVPG
FT                   GRCEHCKGDGVITIEMNFLPDVYITCDVCHGTRFNRETLAVFYKGKNISHVLDMTIEEA
FT                   RSFFSAVPPIVRKLEALCSVGLGYVRLGQSALTLSGGEAQRVKLALELSKRATGKTLYI
FT                   FDEPTTGLHFADIIQLMEVVQRLVDQGNTVVMIEHNMDVIVQADCVIDLGPEGGMHGGT
FT                   IVAQGSPEAVSQITESRTGWYIKEVLCKKT"
FT   gene            554770..557745
FT                   /locus_tag="TPASS_0515"
FT   CDS_pept        554770..557745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70938"
FT                   /db_xref="GOA:A0A0H3BKN6"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKN6"
FT                   /protein_id="ACD70938.1"
FT                   /translation="MRAWYPIWGIFFLFCPLFGESGLRKLRIIINSAQETTRLSETGQP
FT                   ILESTGRVPLSPFDLQDQLVVFTGNVSISIDDGSVTATILSDQTVYNTSAQILYSTGNV
FT                   RYSRTEGETKTIEISGTRFIFELKTLKGLFLDGSLTLPIKGQQVLFVQSPIIHSDAYTS
FT                   VILKQATLSTEEDPEQALWSVHTKNIWLLPNNQLAFSHGVLSFGVVPLLYIPFFYYPKD
FT                   EFIGNPVFGLRSRAGAFIQTTTYLLGKRPKSAYPPSFGTQSPAQEEAPNYLKISADYYS
FT                   ALGGMAGISTFFQAKDYLPFVRFSAYIGASRTVHQRGNGAYSIYDTTGQVMWDKSYLFG
FT                   MQVPFRYYAECALRFHKTPLYVDVHVPIISDPFFSTDFLQRSEDLNWFHLALSPRSLRE
FT                   LTQSTISSYDWKISASLRPVWLVLHPWLRDFSLDPISFTVHFNSKSDSKKNSSSPERNF
FT                   FYPHSMESRAGLSFSGTLFSHVWERQKSQQKESYAPKEIRNPLAYTPADGLSREGSPPE
FT                   QSPAVSKENSETDSTFDFFMPEFREENERRTGTDHAYVFTRYALDYKGKGDIVYDAQFN
FT                   HGSWDDASKIKWNDLQSQHVTIRGDFSIRSQFQCVNDIIRMSNGIQCTLQHRYPIHGQP
FT                   PAKQNGFQNSALVQSSNNLAVYPFSADSFFRESFLGWSITPVLYDSSRPTGKSSLHVRD
FT                   HSITANAAFSLYGYTQQIRVSVHFAPGPYAYSIATFLSFPYISATLSARFLDKPQVRAE
FT                   LDFRMPYEITCKQTYVYDIGKSMSDSYEVSLGWKYFSLSYLLKGESGKAAPSGNNGLSI
FT                   SKLKLTLSHDDFPLTVRFWKRRIKIQGTLSSSLEINFKDLDKSHISFSPLITFSIYKFL
FT                   DLSINTVIKNEKLTPYFPTQLSKSPKTRLWDAFVSSLYFWDEMKRSSALFPIRTLNIEL
FT                   AHYLKDWTLRFGYRLHSEPPSSGSRQISPLVSSISLSINWNPLPMVRTRARKTPGMFEV
FT                   GI"
FT   gene            complement(557759..559339)
FT                   /gene="mviN"
FT                   /locus_tag="TPASS_0516"
FT   CDS_pept        complement(557759..559339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="TPASS_0516"
FT                   /product="virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70939"
FT                   /db_xref="GOA:A0A0H3BKR0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKR0"
FT                   /protein_id="ACD70939.1"
FT                   /translation="MKSKSSLLKSGLLLSLLTLVSRVLGLAREVVKSTLMGTSATADAF
FT                   TVAFMIPNLFRRLFAENAISVAFIPVFTQHYSMPSSAQVPCSSKTKEFLSAIFTLMSSV
FT                   TASISLIGILGAPYIVRLFDTDQSLTVSLTRLMFPYLWMISLAAFFQGMLHSIKVFVPS
FT                   GCTPIFFNVSVIFSMYFLNVSHMNVAIAAAIGVLIGGCAQALFQLIFVYMHGFRFTLQS
FT                   PLKAMHDEGVRRIIALLLPTTVGIATYLLNDLVCTALATSVEIGVAASVQYSLRIQELL
FT                   LGIFIVSLSSVVLPDLSFHVMRKDWQSFEDLLITAIKIVMLITIPATFFVLFSSDRIIT
FT                   LVYKNAIFNELSVRMTATIFRWHSVGMLAIALNRVLISAFYAQHNSFAPMIAGTISFVT
FT                   NIILATLLFIPLGGKGIAFSLSAASMVQTVFLWMFLKRSWQITIPSLYKTSLYYGVKIT
FT                   LFSVIALVPTWASSFFTAYFFPGSHKIISHGVPLCVEALIFSCTGCILLLLSRDEFAYK
FT                   ALRSIRFCR"
FT   gene            complement(559336..559926)
FT                   /gene="ruvC"
FT                   /locus_tag="TPASS_0517"
FT   CDS_pept        complement(559336..559926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="TPASS_0517"
FT                   /product="Holliday junction nuclease, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70940"
FT                   /db_xref="GOA:B2S3B1"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3B1"
FT                   /protein_id="ACD70940.1"
FT                   /translation="MHAQNVDIAPGSTSTVSIIVGIDPGLESTGYGVIEAGGGSLRCLT
FT                   YGVIVTQSNQPSAARLRHIFDTLQQVISIYQPQYCAVETIYFAKNVTSALCVAQARGVV
FT                   LLAMAQQHISVAEYAPNAIKKAITGIAQAEKRQVQHLVKILLNLKDIPHPDHAADALAV
FT                   AVTHVHCCMSSNYAVGSTRSRGAYVTLYKKGKR"
FT   gene            complement(559908..560600)
FT                   /locus_tag="TPASS_0518"
FT   CDS_pept        complement(559908..560600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70941"
FT                   /db_xref="GOA:A0A0H3BJ29"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ29"
FT                   /protein_id="ACD70941.1"
FT                   /translation="MKRALIITGGEYAPYEFVQYYLPAYDLLIAADSGLDTALQFGLVP
FT                   DFVIGDMDSVKDNLFIQACDKTRTHLFPRDKDFTDTELAVTLAHQLGSDDLSIVGGGGG
FT                   RADHFLYFMRLFAAPLSPRLWLYRHGLGYCFGEGCVTQQLCIGGVDNTSFSFFPVGDAT
FT                   DYSLSSEGLHWPLDGVPWHTHVSMSNRSSAPVVRVEAHRGRFLLFLSPLGRYTIDHHER
FT                   GIACTHRT"
FT   gene            complement(560597..561973)
FT                   /gene="atoC"
FT                   /locus_tag="TPASS_0519"
FT   CDS_pept        complement(560597..561973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoC"
FT                   /locus_tag="TPASS_0519"
FT                   /product="response regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70942"
FT                   /db_xref="GOA:A0A0H3BIJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIJ6"
FT                   /protein_id="ACD70942.1"
FT                   /translation="MKFSILVLDDEKNIREGLQMALEDEGYEVFTAEDGNTGVEIALKG
FT                   DIDLIITDLKMPRMSGELVLQHVHAVLPDIPIIILTGHGTVENAVEAMHKGAYDFLTKP
FT                   LDLNRLSLLVRRALQNRELIVQHRELIKQIGNRTSFENIVGESPAMNKVFDMVKKAAAS
FT                   KASVLITGESGVGKELIANAIHNLSPRKAKPLIKVHCASFAEGVLESELFGHERGAFTG
FT                   AVNRMKGRFELAHEGSMFLDEIGEVSMAVQIKLLRVLQERSFERVGGRETIKVDVRVIS
FT                   ATNRNLLEEIKRNLFREDLYYRLNVVHIHVPALRERKEDLPLLIATFLKEIAEENGKKI
FT                   TSIDPQAQSALHAYDWPGNIRQLRNCIESAVIMSSGPVIHIEDLSEPIRSLGETSSIRI
FT                   PIGVSMEDAEKEIILQTLEAQKGNKSKTADVLGIGRKTLYLKLDQYTNTSFEPDAAAKS
FT                   "
FT   gene            complement(561983..563171)
FT                   /pseudo
FT                   /locus_tag="TPASS_0520"
FT                   /note="sensory transduction histidine kinase; frameshift"
FT   gene            complement(563168..564439)
FT                   /locus_tag="TPASS_0521"
FT   CDS_pept        complement(563168..564439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0521"
FT                   /product="possible DNA polymerase III, gamma and tau
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJC7"
FT                   /protein_id="ACD70943.1"
FT                   /translation="MFENIVGQPATDLLRDDVMHARLPAALLFVGPPASGKLTAALELA
FT                   RVLSCTQGGVWQCPCAPCVQHTELLSPELLVMGIKDLILEIRASARAYMSVHTQGTRYL
FT                   FVRAVRKLITRFDERLWDSDDTRFSAAVSSIAELDQELASLPAQGDRRTTPEQKERVQR
FT                   ICVIAERLQQESLYTQLPVQQIRNAIQWVRLTPSGRKKVLIIEHAHAMHESARTAFLKI
FT                   LEEPPRDTLFILTTATKYAIMPTVLSRVRSYSFRERSVELQCAVITRVFHDRPTDAKNT
FT                   QGVLLHYLYQFLSFSLEEVQTSVMYFWLYVCQHARCIGRIIPDTWVSVGTQPQVSGMDL
FT                   TSLDSTLHFFQAHKQQHAVSLFFSLLVRHMRTLQRTTEYSARNTECFAHIAHCIEQAHR
FT                   NVQLWNLTIQGTLEHLAHTIANHL"
FT   gene            complement(564450..564929)
FT                   /locus_tag="TPASS_0522"
FT   CDS_pept        complement(564450..564929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70944"
FT                   /db_xref="GOA:A0A0H3BKP0"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKP0"
FT                   /protein_id="ACD70944.1"
FT                   /translation="MTISTLDLILGIIMGIVTVRATMRGFVDEFFSKASILCAAVVAIL
FT                   CHKRLVPLTRVLLGHSILLPCITFLITFMGVYCVMLFLRSRMRTYATRDLISGFNQVFG
FT                   FFFGIIEGSVLLTVILLLLHVQPFVSVSHMLHESVINTVLSPLVLDGVRYMRLKM"
FT   gene            complement(564926..566080)
FT                   /gene="murG"
FT                   /locus_tag="TPASS_0523"
FT   CDS_pept        complement(564926..566080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="TPASS_0523"
FT                   /product="UDP-N-glucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70945"
FT                   /db_xref="GOA:B2S3B6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3B6"
FT                   /protein_id="ACD70945.1"
FT                   /translation="MRFRARVSQSTAKCVVFTGGGTGGHIFPGIAVFQALAQQAAVRVV
FT                   WIGAARGADRSIVESAGLEFCGITAGKWRRYASVRNFFDVFRVLVGTVQSYCILRALRP
FT                   QALFSKGGFVSVPPCIAAWLLRIPVVTHESDISPGLATRINARFADRILVSYPHTSCYF
FT                   PRARRAAVHCTGNPVRQDFFSAQAERAYQFLRIDQKKPLLTVLGGSSGARDLNARVLSC
FT                   STFLTERFYLVHQFGAGNEDQMHTITNSLSVNARHAYMSFPFIQAHLPDILAASALVLS
FT                   RAGANAVWECAVLGKPMILFPLERGSSRGDQIENAEYFSAHGAACILRAQDEKGHQLVS
FT                   LLTELFHPSCARIEEMARASYTLGIGNAAYDIAQQLQTFIKEGM"
FT   gene            complement(566084..568729)
FT                   /gene="lon2"
FT                   /locus_tag="TPASS_0524"
FT   CDS_pept        complement(566084..568729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon2"
FT                   /locus_tag="TPASS_0524"
FT                   /product="ATP-dependent protease LA"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70946"
FT                   /db_xref="GOA:A0A0H3BKR6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKR6"
FT                   /protein_id="ACD70946.1"
FT                   /translation="MAKNTDIEHDAHEPAGHGDVRESAVENPSASAVSDGEERATFAPE
FT                   VAPQTDTESAQGAAQESEPEVQRAGEAEKGVPEKAKAVVPLDELLPQKVHLIPLTGRPI
FT                   YPGIFTPLLISDEDDVRSVESAYSDSGFIGLCLVKTDTQNPTISDLYEVGSVARIVKKI
FT                   NLPDGGLNVFISTQKRFRIRKHVHHSKPIVAAVQYLSDLIEGDPLEIKALVRGLIGEMK
FT                   ELSENNPLFSEEMRLNMINIDHPGKIADFIASILNISKEEQQRTLEILDVRKRMEEVFV
FT                   YIKKEKDLLEIQRKIQNDLNSRVEKNQREYFLREELRSIKEELGLTTDPKERDQRKFRA
FT                   LIDSFHFEGEVKEAVESELEKLSLTDPNSPEYSVGRTYLETVLSLPWHAPEKEEYDLKK
FT                   AQKLLDEDHYGLENVKERIVEYLAVRKLRADTKGSIILLVGPPGVGKTSVGKSIARAIH
FT                   KPFFRFSVGGISDEAEIKGHRRTYIGALPGKVLQGLKIVKTKAPVFMIDEVDKIGSGAR
FT                   GDPAGALLEVLDPEQNTTFRDHYLDLPFDLSHIVFVLTANSTDPIPRPLLDRAEIIRLS
FT                   GYIDTEKVEIAKRHLVPKTLEKNGLKRACVSYRKEVLLHLVHSYARESGVRGLEKSLDK
FT                   LHRKLATEIVLGKRSFDDKCLMDEALIGTFLGKPVFRDDMLKDANKVGTAVGLAWTGMG
FT                   GDTLLVEAITIPGKASFKLTGQMGAVMKESASIALSWLRRYSAQQRIASPNWFEKRAIH
FT                   LHIPEGATPKDGPSAGITMTTTLFSLLTQQKVKPRLAMTGELSLTGQVLPIGGLKEKTI
FT                   AARRGGIKEIIMPKANVRDLDEIPEHVKKGMVFHLVESMEEVLSLAFPKGKRVRAGTAA
FT                   QSASPETLTG"
FT   gene            568865..569428
FT                   /gene="efp"
FT                   /locus_tag="TPASS_0525"
FT   CDS_pept        568865..569428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="TPASS_0525"
FT                   /product="translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70947"
FT                   /db_xref="GOA:B2S3B8"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3B8"
FT                   /protein_id="ACD70947.1"
FT                   /translation="MIRGGDIAKGTVLLHKGAPYLVVEREFVNPGKGAAFARVKMKHLR
FT                   DGSVLTQTVKTSDTVEDAVVDSHRAQYQYDDGECFVFMDTRSFEQIFVSKGNVPGRERY
FT                   LREGDEYDILIWNGESIDIKIPTKMVFRVAHSEPYLKGDTVSGATKPVTTETGLVVRVP
FT                   LFIKQGEKILINTETNEYQERVND"
FT   gene            569576..571582
FT                   /gene="hrpA"
FT                   /locus_tag="TPASS_0526"
FT   CDS_pept        569576..571582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpA"
FT                   /locus_tag="TPASS_0526"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70948"
FT                   /db_xref="GOA:A0A0H3BJ32"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ32"
FT                   /protein_id="ACD70948.1"
FT                   /translation="MFSYKQLPVYSQKDKILSALAHHHVIVVESPTGSGKTTQLPLILH
FT                   EAGYNEGGAIGVTQPRRIAVLSVSEFIAKQVLHVQPGIVGYKMRFEDHTDVETKIKVMT
FT                   DGILLQEMKLDPLLSKYSIIMVDEAHERSLNIDFILGLLKRVLQQRHDFRIVISSATIN
FT                   TAMFSRYFNECPVIKIDAVAYPVTVIFDPPDTPASTHTKEAEAALLEKIVCIVERVIAS
FT                   RDKGAILIFLPGERSIKNCITRLSHERWFRKLFLLPLYGRLSKEEQEQVFNRAPFGKRK
FT                   VVIATNIAETSITIDDVTTVIDSGLVKLNSYNPLSYTASLDETPISQASCNQRRGRAGR
FT                   VRAGTCYRLYSRDDFEQREPYTLEEIYRTDLSEVVMRMAELGIHDFEHFDFISPPGTHG
FT                   IIGAEDTLRLLGALEDDRSLSEIGKMMCLFPLGPRQSRMIVEALRRYPHSIDDVLIAAA
FT                   FLSARSPLIFSEDQEEKTKKAHGTFSDPMGDFVSFLRIYRAYAQENNKHSFCQHFYLDE
FT                   RIMAEISNIKEQLELIVSGMGFPLLTGGTVEEYLICVGTGMIQFVCVQEHRDSYRSLTA
FT                   ECIHIHPGSCVYKDRPKFIVAGEIVRTSRMYAMSVSPLSKKIAELIAPALLERRGRAEK
FT                   HGTSPTRAAFLKKSTLRKGPRKRRVRVGRASLR"
FT   gene            complement(571630..572259)
FT                   /gene="atpD2"
FT                   /locus_tag="TPASS_0527"
FT   CDS_pept        complement(571630..572259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD2"
FT                   /locus_tag="TPASS_0527"
FT                   /product="V-type ATPase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70949"
FT                   /db_xref="GOA:A0A0H3BIK0"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIK0"
FT                   /protein_id="ACD70949.1"
FT                   /translation="MKTPLAPTKSNLAYVRDQLGLARDGYRLLEQKREILFMELTSLLE
FT                   EVHLLETELDKRRKQAYASLWQLLLAQGRDDIAACALVTPVPCRVQQEVLLIAGLRFLR
FT                   LDAVMQPPKLQYAALGSSACMDRAREDFGLLLQTLTRMASVQTIVWRLASEMRKTQRRV
FT                   NALSKQIIPQMCETCMYIESVLEERDRESTFVLKSLKARKDPTTTL"
FT   gene            complement(572354..573796)
FT                   /gene="atpB2"
FT                   /locus_tag="TPASS_0528"
FT   CDS_pept        complement(572354..573796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB2"
FT                   /locus_tag="TPASS_0528"
FT                   /product="V-type ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70950"
FT                   /db_xref="GOA:A0A0H3BJD2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJD2"
FT                   /protein_id="ACD70950.1"
FT                   /translation="MKGVWYRGLSSIDGPIVVAKRREGAFYGEITAIRDRFGALRTGRI
FT                   IDLSQECCLIQVFGSTLGLSLDGACLEFLDVPMQLRVCEGLMGRVFDGLGRPIDGFPEV
FT                   LSSQLRNVNGYPINPYARVYPRDFIQTGISAIDGMNTLIRGQKLPIFSGNGLAHNRLAA
FT                   QIIRQAKILGTDEAFVMVFAGMGIKHDVARFFVSSFEETGVLSKVVMFLSLADAPSIER
FT                   IITPRCALTAAEYLAFEKNKHVLVIFTDMTNYCEALREVSTTRGEVPGRKGYPGYLYSD
FT                   LAELYERAGRVKGSSGSVTQIPILTMPNDDISHPIPDLTGYITEGQIVLQRDLSQRGLY
FT                   PPIGCLPSLSRLMKDGIGEGMTRADHHAVSSQLFASYARVQSVRSLASIVGEEELPALD
FT                   KCYLRFGDLFEQYFLTQDEHEDRSISQTLDIGWSLLSLLPRTELYRIDPKLIDQYLTAS
FT                   CSAVSDQLRKAIEEARTPVADA"
FT   gene            complement(573793..575610)
FT                   /gene="atpA2"
FT                   /locus_tag="TPASS_0529"
FT   CDS_pept        complement(573793..575610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA2"
FT                   /locus_tag="TPASS_0529"
FT                   /product="V-type ATPase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70951"
FT                   /db_xref="GOA:A0A0H3BKP3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKP3"
FT                   /protein_id="ACD70951.1"
FT                   /translation="MIKDDVVTGRVVRVSGPIVYAEGLSACSVYDVVDVGEASLIGEII
FT                   RLDESKAVVQVYEDDTGMRVGEKVTSLRRPLSVRLGPGLIGTIYDGIQRPLERLFQEDG
FT                   AFLRPGARSQPLDGSVRWDFRPHCNERGEALCAGIPIAPGSVLGTVQETPSVVHTIMVP
FT                   PDIRGSVLSSFKGAGAYTIDEEIGRTDLGEPLFLSQYWPVRRARPFSKKLAVCEPLVTG
FT                   QRAIDVFFPLSKGGTAAIPGGFGTGKTMTQHAVAKWCDADIIVYIGCGERGNEMTDVLS
FT                   EFPKLIDPRTGRSLMERTILIANTSNMPVSAREVSLYSGITLAEYYRDMGMHVAIMADS
FT                   TSRWAEALRELSGRMEEMPAEEGFPAYLPTRLAEFYERAGRVETCVAREGSVSIIGAVS
FT                   PPGGDFSEPVTQHTKRFIRCFWALDRELAHARHYPAIGWIDSYSEYAQEVSAWWSKYDP
FT                   RAGALRAAALDLLRKEQRLQQIVRLVGPDALPGEDRLVLMVCEMIKGGFLQQNAFDPTD
FT                   VFSCPEKQVQILRTIVDFHERAVVLLRAGISLSALSQLSCRELIVRMKTTYGNEDVHKM
FT                   QKVYDTMCTEFDQLSVCAAARTQGGEKVE"
FT   gene            complement(575607..576233)
FT                   /locus_tag="TPASS_0530"
FT   CDS_pept        complement(575607..576233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0530"
FT                   /product="possible V-type ATPase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKS1"
FT                   /protein_id="ACD70952.1"
FT                   /translation="MEELRSTEVLERDIYAEARKRADHILSCARADCAQLEAHASARVQ
FT                   DITRAVEQLFAQRIAAYERNAQAVIPLERIRQTIRAVDARVQRALASYFEKIGEEKRLR
FT                   VLARLLERYAPLIGEQKITVRFFGYCESRVRDLLNQALPRAVLRSLTPFDKAEAWRAQC
FT                   SDGLTIETEDGTLQCRSTIEEICAQLLSEKRQELACALCGNGVVA"
FT   gene            complement(576239..576577)
FT                   /locus_tag="TPASS_0531"
FT   CDS_pept        complement(576239..576577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0531"
FT                   /product="possible V-type ATPase, subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70953"
FT                   /db_xref="GOA:A0A0H3BJ37"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ37"
FT                   /protein_id="ACD70953.1"
FT                   /translation="MRLGCHQVTYCIIGEQELVLGFSLVGVHGFVVHSPEEAARAFSQV
FT                   TRPPSGDRPAQVLILTQRAMSYLREEVRAWQMQGELPFVVEVPALHEQGNVRTSLRESI
FT                   RQVIGAKV"
FT   gene            complement(576579..577045)
FT                   /pseudo
FT                   /gene="atpK2"
FT                   /locus_tag="TPASS_0532"
FT                   /note="V-type ATPase, subunit K; frameshift"
FT   gene            complement(577197..578561)
FT                   /gene="atpI2"
FT                   /locus_tag="TPASS_0533"
FT   CDS_pept        complement(577197..578561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI2"
FT                   /locus_tag="TPASS_0533"
FT                   /product="V-type ATPase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70954"
FT                   /db_xref="GOA:A0A0H3BIK4"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIK4"
FT                   /protein_id="ACD70954.1"
FT                   /translation="MFRSQRMKFLELVVLERDVDRVLEYLGKTALVHLRLSAAARGSSS
FT                   HCAQSKEYVGRLEEACKYLGVSGECAFSPGDSLPTEEDYTLAQQILAEVDALHAREREG
FT                   DAPSVPRGKSSVAHDSANEEQFQGEKCALGSMRGPALCALLRRFALQERVHRTRDALES
FT                   TRHTYRIAGWLPAHEAKDLVAGLDNVTTGRMAVRLFEPQELSFIRDGSEHVPVCYQHGR
FT                   FVRSYERMVSSYGCPPYGLVDPTPFVAFSYALLFGIMFGDLGQGLLFFVLGLLLRTRRV
FT                   RALNRWAHLDYVFLSVGFSSMVMGFLTGEFFAHGTLLAPLIRSVTALCGGVPRDHILHL
FT                   MPSHGSLHTLMAFFGFTLFLGFVINSLGLIINIVNQVRLRHALQQCVQKRECADSSFFG
FT                   TWLPLQCAYHFLEFHSGSLMRLQWACLSWVFFVKSFWSVCASVCVRGFLKVLACI"
FT   gene            complement(578554..579579)
FT                   /locus_tag="TPASS_0534"
FT   CDS_pept        complement(578554..579579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70955"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJD6"
FT                   /protein_id="ACD70955.1"
FT                   /translation="MAVERDVADVFVYAKLSGLCARLWVGERLGTLQGVGTLCDLWVRL
FT                   FSEPAPRSAGAHLVGLIQRRVEACLLRDCVRAASCYQEPPSLFSALLARYDYLYLKTLS
FT                   SSESQAGFRVCQPPDLGRFSLFRWEKWPCIEAVTRGSPVSWYNRVPRSDERVLWDLRLD
FT                   QSYYHALWQTLCSIPEDDRTACSRLVREEVALYAVGWVLRLRMFYGVQKKDAPSELSSN
FT                   GAIRRCLGTWWKCILFAWDCSLTERGAWSGWRYERFLNNPVDGVQWEPDLDAFERAGSR
FT                   FLYCLARTVFHAQLFTPATIVAFFMMKRFEARGICALAECIHAGSARTLPREFLGEAAY
FT                   V"
FT   gene            complement(579583..579795)
FT                   /locus_tag="TPASS_0535"
FT   CDS_pept        complement(579583..579795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKP7"
FT                   /protein_id="ACD70956.1"
FT                   /translation="MRESAEAAGETLVKEAEGSVVEAQEQAWHEACARIDAQRREACGQ
FT                   LERELSVLEEDVERFEAFLDGFFFG"
FT   gene            complement(579936..580337)
FT                   /locus_tag="TPASS_0536"
FT   CDS_pept        complement(579936..580337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70957"
FT                   /db_xref="GOA:A0A0H3BKS6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKS6"
FT                   /protein_id="ACD70957.1"
FT                   /translation="MAVLSVMILSLLVVVCLLVVTLVLLQTEEGDGLGGMFSGGSRSAF
FT                   GSRSASVLTKTSYVMVGLFFGLTFFLALLNRAPDDTGLQKAAQQKQAETAVEWWKHPPK
FT                   KVLVLQRLLSLLVLPQEFLGLWGSGSSVP"
FT   gene            complement(580487..581236)
FT                   /gene="tpi"
FT                   /locus_tag="TPASS_0537"
FT   CDS_pept        complement(580487..581236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpi"
FT                   /locus_tag="TPASS_0537"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70958"
FT                   /db_xref="GOA:B2S3C9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3C9"
FT                   /protein_id="ACD70958.1"
FT                   /translation="MRGYFIAGNWKMHKTCAEAVALAQELVRELRGGPHTYMIAPSFTA
FT                   LDAVGKVLRGSNVLLGAQDVSSEEWGAHTGEVSVLQLEDLGVQVVIVGHSERRHGRGEN
FT                   DKLINQKVRRVLESGLRVILCVGERLQEYEAGCTNEVVGTQVRAGMADVCGSLMHNVTV
FT                   AYEPVWAIGTGKTATPAQANAVHAHIRSVVREMYGAAIAEALCIQYGGSMKAENARALL
FT                   AEEHIDGGLIGGASLEAASFVPIARSV"
FT   gene            complement(581387..582646)
FT                   /gene="pgk"
FT                   /locus_tag="TPASS_0538"
FT   CDS_pept        complement(581387..582646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="TPASS_0538"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70959"
FT                   /db_xref="GOA:B2S3D0"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3D0"
FT                   /protein_id="ACD70959.1"
FT                   /translation="MMLRTCKDVTMRGERVVVRVDFNVPMRDGMVQDDTRVTAAVPTLR
FT                   YIIEQGPRHVVLISHLGDPTRDADKAEGNAKKDGCPFDRHAFINGKHRLKPVADCLAKK
FT                   LGVPVHFAPSCVGQREFIEGLPDGSVVLLENVRFHPEETSGDAKVQEQFARELAQYGDI
FT                   FVNDAFGTAHREHASTVVLPRLMRRRVAGLLIEREVRYLEPMVCNPKVPMVAVVGGAKV
FT                   SSKIAVLESLLRTSTALIIGGGMAYTFLKAQGVGVGTSLVEDDFIDTARMLLQKAQSGG
FT                   VSVVLPVDHVCASTFCADAQPVAVDDVHIPMHLMGMDVGPRTLEQYRAHLKGVSSVLWN
FT                   GPVGVFEFDAFAHGTRVLAQLIAEATDAGATSVVGGGDSIAAVSKFGLASRMSHVSTGG
FT                   GASLKLFEGKVLPGISCLET"
FT   gene            582618..582839
FT                   /locus_tag="TPASS_0539"
FT   CDS_pept        582618..582839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70960"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ42"
FT                   /protein_id="ACD70960.1"
FT                   /translation="MTSLQVLSIISSFLTQGLPHPPHVAADSHYISKKDSISASVGRLT
FT                   SLLPCLCALHAYGVGHRPFVIVDIFYAE"
FT   gene            582861..582933
FT                   /locus_tag="TPASS_t0024"
FT   tRNA            582861..582933
FT                   /locus_tag="TPASS_t0024"
FT                   /product="tRNA-Asn"
FT                   /note="tRNA-Asn1; codon recognized: AAC"
FT   gene            583120..583491
FT                   /gene="spoIIAA2"
FT                   /locus_tag="TPASS_0540"
FT   CDS_pept        583120..583491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIAA2"
FT                   /locus_tag="TPASS_0540"
FT                   /product="anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70961"
FT                   /db_xref="GOA:A0A0H3BIK9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIK9"
FT                   /protein_id="ACD70961.1"
FT                   /translation="MPMELKVRQSGGICVVDISGDMDLYHSYKLKDLVLKLFDRGPRCI
FT                   VIDLEAVEYIDSSGIGVLIYLCSTVKKLKIHFFISGVHGSVKKVIELTRLLNYFPIAES
FT                   VDEALARARSSAPPQTGSL"
FT   gene            583621..584580
FT                   /gene="era"
FT                   /locus_tag="TPASS_0541"
FT   CDS_pept        583621..584580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="TPASS_0541"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70962"
FT                   /db_xref="GOA:B2S3D3"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3D3"
FT                   /protein_id="ACD70962.1"
FT                   /translation="MVTDGASPRSGVSLIIGRPSSGKSTFLNAVCGYKVSIVSPIPQTT
FT                   RNTVRGIVNIESDQIVFMDTPGYHRSDRKFNLRLQSLVHSNVKDADVLLYLVDATRQFG
FT                   EEEAAICALLAPYQKTRVLLAFNKVDVLHNSTSCDEHAFLHRQGSVLRAGSLGRALHAA
FT                   LPHLPADRVFTISALHQVGLDALMRTLRDLLPEAAPLYPQDCYTDQTIAFRVTELIREQ
FT                   AIARCRDELPHALYAGVEDMELRRGKRELWCRAFLAVERESQKAVLVGKKGAVIRAIRL
FT                   DAIRALRTLLPYHISLDIRVKVDRSWRQRDHTLSSLLY"
FT   gene            complement(584577..586298)
FT                   /locus_tag="TPASS_0542"
FT   CDS_pept        complement(584577..586298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0542"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70963"
FT                   /db_xref="GOA:A0A0H3BJE2"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJE2"
FT                   /protein_id="ACD70963.1"
FT                   /translation="MSISLLQQERHRYLPKVPDLLRGDFRRVCARRGLSTTAVADYDAL
FT                   RSLFARTYGQPLVNFVNASEKNEDSPMETAPEPRGLRVAIVLSGGQAPGGHNVIAGLFD
FT                   GLKRWHADSVLIGFLGGPAGVLSGDHIEICADRVDAYRNTGGFDLIGSGRTKIESESQF
FT                   AAAAQTVTRMALDALVVVGGDDSNTNAALLAEHFVNSGISTKVIGVPKTIDGDLKNEAI
FT                   ETSFGFDTATKTYSELIGNIARDACSARKYWHFIKLMGRSASHIALECALKTQPNVCLI
FT                   SEEVAAQSLTLAQIVQSLCDTIATRAQHGEHFGIVLVPEGLIEFIPEMKALITELNEVM
FT                   ARRAQEFEALDTPDAQRVWIEQALSASARAVFNALPAEISTQLLADRDPHGNVQVSRID
FT                   TERLLILQVTERLAQMKQEGTYTGVFSSIAHFFGYEGRCAFPSNFDADYCYTLGLTACL
FT                   LAVHRFTGYVASVRNLTSSVAEWAVGGVPLTMLMNMERRHGSQKPVIKKALVDLEGMPF
FT                   RVFSRRRASWALKTSYVYPGAVQYYGPPAVCDEPSVTIRLERPAPAANSSFGHRSS"
FT   gene            complement(586358..587041)
FT                   /gene="ruvA"
FT                   /locus_tag="TPASS_0543"
FT   CDS_pept        complement(586358..587041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="TPASS_0543"
FT                   /product="Holliday junction DNA helicase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70964"
FT                   /db_xref="GOA:B2S3D5"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3D5"
FT                   /protein_id="ACD70964.1"
FT                   /translation="MFESISGILTLHERERLCVEVHGIEWEIAVSAYSSAAFGEVGSHV
FT                   KVFTWLYHREDALRLFGFSNVQERTLFLSLTKVEGIGPKQALKVLSSISSQALCAALDT
FT                   GDLCALQRIPGIGKKTAQRMLLALKGTLALTDAASCAQSQTDDRAAHPSNLGCAPHARE
FT                   IEDLVTALVQMGYDRKMAAEVIAQESAALCSVGRSLYEEEATVLKRAILALSIAHPHAV
FT                   APAAE"
FT   gene            complement(587083..588957)
FT                   /locus_tag="TPASS_0544"
FT   CDS_pept        complement(587083..588957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70965"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKQ1"
FT                   /protein_id="ACD70965.1"
FT                   /translation="MSSKVAGACVGVIFWIVGTGSRCSAASVPHSIGAIQGEGHRSAYE
FT                   GKHVRDVRGVVTAIARSGKRPIGFYFQDPHGDGNPKTSDGIFVYCGKAFPDSLRVGDYV
FT                   AVLGTVSEYISKGNARDLSVTQLVIKRAQDVRVLAHGRELPEPVLISYARVSQPVFVSN
FT                   LADLAPDAETIDFYESVEGMRVQMVNPTVPAVAYRSTYYLLPGDTPSTRLNMHGGYVYE
FT                   QTHIRPVLAFCPRRMFDSLPEVFKSAPPLPGDSFEGTVVGIMGYSSSSYQLELAEPLPP
FT                   LRRSGFSPEVSTIQFNARFLNIASYNVENFSAGNKADSARARVFAKHFVNDLKAPDVIC
FT                   LVEIQDDDGAKKHHHCTSAQHTLDLLVRAMAEFSAVRYKAVNIDPQDNAPAGVQSLDAD
FT                   GGQPGGNIRCCYLYRTDRVQLVQDQTGSAGTGTFHSVAQMVRGGRQMVKNPARIGVGQE
FT                   SFQNTRKSLVAHFQFVSGVNKGKDFVVVTNHFSSKRGDDPVWGSTQPAQEHSKRKRIQQ
FT                   AAQVAAFVAALRRERADLPVVVAGDFNDFWFSDVIQKFTAVGMHSALDLLPETERYTYV
FT                   YRGYSQTLDNILSVGARTETADILHINAEQPARERVSDHDPVFVQLSW"
FT   gene            complement(588982..590046)
FT                   /gene="mglB1"
FT                   /locus_tag="TPASS_0545"
FT   CDS_pept        complement(588982..590046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mglB1"
FT                   /locus_tag="TPASS_0545"
FT                   /product="methylgalactoside ABC transporter, periplasmic
FT                   galactose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70966"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKT2"
FT                   /protein_id="ACD70966.1"
FT                   /translation="MKGTGMCVALLLCALGAGACKRSEKPTIGVVVYQYDNTLVARLRH
FT                   ILSTVGKKHARILIVDSQASQSIQNKHIDQFIARGVHGLAVNLVDHRAARTVIEKAQQA
FT                   RIPLVFFNRMPDLSDLNRYARAYYVGVKDDELGLLQSRLVAQYLERTPSADKNADGIIQ
FT                   CVVLKGDPDHKSGARCARYVCQALREIGLKGEIIGEAFALDSRVKGQAAMHTLIHTHGD
FT                   RIEAVFANNDDAALGAIEALQSAGFFKENKRVPVVGIDATASALKAIEEDLMLGTVLND
FT                   VSSQGKAILNLLFALMGDSVPSIPAEDSTAFTHAGNGVAGRAAVFGTAEKQCVWIPYKV
FT                   VTKENYRTVQNYLR"
FT   gene            complement(590131..592131)
FT                   /locus_tag="TPASS_0546"
FT   CDS_pept        complement(590131..592131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0546"
FT                   /product="possible periplasmic serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70967"
FT                   /db_xref="GOA:A0A0H3BJ47"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ47"
FT                   /protein_id="ACD70967.1"
FT                   /translation="MAGRACRRYSPRYLCLQCGGHQCRGFHPRLCYRCCGAGAAHGRRA
FT                   CRFSGVFLCSAQGEYLQGCLCGGYFFRRFSGCIRRGVARCCPTFCCRLRAVKTASLCLR
FT                   SAWLNVALGGVLGVLSGCRVFDERADVRVDRTGKEYLDAQVACAKEELRARPLRALMCA
FT                   IALKRNAPAHQKVAQLYAQALARVKEAFRYSVEKQKWSEALVFFRSLSALRIPLKDWTE
FT                   RSLHRAQIEQWKKEGAHVLVAAQEKRAGTSAARSPAAMIKGTVTILVDRGIRVEHGRGF
FT                   ADRVIGSGFFIDKRGYIVTNYHVIRSEVDPAYEGYSRAYIKLPSDNTVKVPVRVVGWDA
FT                   LADLALLKTEITPEVVFGLGSSKNLDVGSKIYAIGSPAGLERTLTSGIVSAKKRKLLSV
FT                   GGGVLQIDASINRGNSGGPVIDEEGCVQAVAFAGVEQHAGLNFAIPVELLKQVLPSLYR
FT                   GGLVTHPWLGAFGETHRVWKNAGVGGVLSSYVIPGSPLSYAGIPEGAIITTVNDASVSC
FT                   VADLQAELEKYVPETIVRLAGYRLRDKSKLHDLAAYEQDEWYCQLGVRPEHPARILYKY
FT                   DLSYRAFLPLFGMRLARTGTRNTYRVESLVPGNFADEHGFSTYDVIEIQNIYMIEASEA
FT                   IVADVYAKRRKAGYIDTFMRLVAALDNPSFF"
FT   gene            complement(591843..592973)
FT                   /gene="lytB"
FT                   /locus_tag="TPASS_0547"
FT   CDS_pept        complement(591843..592973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="TPASS_0547"
FT                   /product="penicillin tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70968"
FT                   /db_xref="GOA:B2S3D9"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3D9"
FT                   /protein_id="ACD70968.1"
FT                   /translation="MRKVNCIKVITRAHTLGYCGGVRMAVRMAEHARAHHRGSVYTLGP
FT                   LVHNPVTLARLRARGIECLDPAHLSFALHAPAAPGAAPHAVEEKTARTVVIRAHGVAPE
FT                   VYEALERSGAQVVDATCPRVKESQRRAQGFAAQGLHVILAGDRNHGEIVGIEGYVRAGA
FT                   AQACSHLPGGAPDGMLPQVQCFVVQNAREAAALPCLARAALLAQTTITQGEYDAIAAAA
FT                   RTRVRELTVARTICAATARRQAALRALAPTVEALLVIGGAHSANTQRLLHTARETSLPT
FT                   WLVERVEDIPPDIYAFSAVGISAGASTPDCVIAAVEQALRTGGAPVASRVSSSALPKVS
FT                   TCRAVCAAATSSVGSAGASGAVSPGAVRPFAVGSVR"
FT   gene            593117..594433
FT                   /locus_tag="TPASS_0548"
FT   CDS_pept        593117..594433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70969"
FT                   /db_xref="InterPro:IPR005362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIL5"
FT                   /protein_id="ACD70969.1"
FT                   /translation="MRQNGAVPMISCSVRRRPRWEPQVGAAFLAFALLPVLASGRGMQA
FT                   AVATAAGGSSGCSDNGNHPGKEQFLQFLIPSGGRYEYLGVSFTALADDASFFEANPAGS
FT                   AGLSRGEVALFHHSQIHDSHTETVSFARRTQNTGYGASVRAFSSESDLKSFYGMIGSSS
FT                   SSGKNGGHQGKQGKGFVAIANASHTFCGQYRFKGVSFGCNFKMGFRKGKTDSHVTVAGD
FT                   LGLRAAFSVAKNFGSNEPNMHVGLVLKNAGISVKTKDSDVKHLNPAIAVGFAYRPVYAF
FT                   LFSLGLQQTLTKKELPVCSVGFMFFCTHQVTLLASAACKGKAYALSGGAEIRIGSFHLD
FT                   MGYRYDQIFQAAHPHHVSVGLKWLIPNGGTQADQALLVKESYLVGLRFYDQRRYQEAIT
FT                   AWQLTLRQDPGFEPAAEGIERARRFLKLHEKLSLFDILN"
FT   gene            594531..596975
FT                   /gene="clpC"
FT                   /locus_tag="TPASS_0549"
FT   CDS_pept        594531..596975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="TPASS_0549"
FT                   /product="ATP-dependent Clp protease, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70970"
FT                   /db_xref="GOA:A0A0H3BJE7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJE7"
FT                   /protein_id="ACD70970.1"
FT                   /translation="MLQDLSANARKVLLELGQTVAREARASLLQPEHILLALIQHKVGR
FT                   GYKLIEKLIEDVATVRLILEQHVLTNEGDVASPQDLPVSGRVKHLLDIAAMEARSLRCA
FT                   YIGTEHLVIAFAREEQNPLFQSLIREGLSLDDLRNASIISSPHSDTTRTRLERKVASVL
FT                   DEYGTDLTERARAGALNPVIGRNKEITRVIQILCRRGKNNPVLIGEPGVGKTSIVEGLA
FT                   YAIVREEVPHILLHTRVVSLDLAAVIAGTKYRGQFEERLKRIIKEVEETEKVILFIDEL
FT                   HTLIGAGGTQGSLDAANMLKPALARGQIQCIGATTLAEYRRYFEKDAALTRRFRSVLVR
FT                   EPSFEETCTILRKIKSHYERHHQVIYQSDALEKIVELSRRYIPERFFPDKAIDLMDEVG
FT                   AMKRVQQRADTQVLRSFSIKVANLTTETERAIALEDWARARSLHTDVVQLRRRLHALKV
FT                   EWSAREALSIFAEDVAQAVSLMTDIPVHSLEGDELCRFTNIERDLCATVRGQREAIATL
FT                   ARAIVRARVGISSDTRPIGSFLFLGPTGVGKTLLAKTLAEFLFGSADALIRIDMSDYME
FT                   RYNTSRLMGAPPGYVGFENGGLLTERVRHRPFSVILLDEIEKAHPDVFNVLLQVLEEGE
FT                   LQDNLGHTVNFRNTIIIMTSNAGTRGLGENVPGFQTARARNIEYRQLRVQALREIKRIF
FT                   SPEFLNRVDECVVFAPLERETLQEILECELKKLAERLRGKDIVLRYSAAAKAYCLEHGF
FT                   DPFLGARPLRRVLQQEIENELALRMIHGTLRAGSCVHIDSDGARLHLSTEKSYLTLHPQ
FT                   EI"
FT   gene            complement(597016..598503)
FT                   /gene="thdF"
FT                   /locus_tag="TPASS_0550"
FT   CDS_pept        complement(597016..598503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thdF"
FT                   /locus_tag="TPASS_0550"
FT                   /product="thiophene and furan oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70971"
FT                   /db_xref="GOA:B2S3E2"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3E2"
FT                   /protein_id="ACD70971.1"
FT                   /translation="MRAHEYALDDDIVAIATALSPAALGIVRTSGSSSIERVASFFSRA
FT                   QALTRARAHTFLHGWILDGKTRVDEVVLLVYRAPHSFTGEHAVEIICHGGVRTVQAVYR
FT                   LCLAQGFRAAQRGEFSFRSFFHGKRDLTRIEAIQSLVDARTCAAQQQAVLHLSGALQQE
FT                   IAALTRALLAFSATLQGEIEYPEDEETRVHDIDMRELEPLVERLRRLRACWQERALQRT
FT                   GVRIVLGGCPNAGKSSLFNALLGQDRAIVSSVPGTTRDWLEADLDLSGIPVRLCDTAGL
FT                   RVTDNPIEAQGVVRSEQLLQGADCVFYIINGRAGVQAADCAFLSDCAVPLVVVVTHNDL
FT                   MSMSERIQVCQAVQPFISAPVLSCARSQDARGAGEQCLAGGKNGEVRDRAPRAFVCVSA
FT                   KTHAGLDALRAQTLHLLHGGQVPYEELSLGSERQYVLVDAAVQALEHAQEAYARGFGLD
FT                   AVVHDLEEALYHCGALTGEVHSEDILDALFEKLCVGK"
FT   gene            complement(598507..599595)
FT                   /locus_tag="TPASS_0551"
FT   CDS_pept        complement(598507..599595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0551"
FT                   /product="phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70972"
FT                   /db_xref="GOA:A0A0H3BKQ5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKQ5"
FT                   /protein_id="ACD70972.1"
FT                   /translation="MEEFIFWNLSVIHAVQQAAHPVITHAVVLFTFFGGKGIALCSLWV
FT                   LWCVEYRKGLAIAYALACSEGLNYALKGLLRVPRPFVRDPSVKLVFHDGFSTPSGHAQA
FT                   SALFVLLARSYPSAKTPVPCFCAPGCGTDRQVGDRENPSSYGQERTPLARTAWTGVAGV
FT                   LFVGVIGLSRVYLGVHYPIDVLLGWLNAVLFGALILGMRRALRRGVVFFTRIQEVSGRS
FT                   FAGLRFSAVVCIALLLAVGGADVSMCGAFCGLGAGHLFIFDRWVTRRAPAGGVGFHAAG
FT                   GSFTQKVVRFCVGCVFCSVVSSALHALFSGAPAEYARLLRFVRYGIGASLSTGVVPLLF
FT                   LRVGLAGGLPFHAPAPTAVRER"
FT   gene            complement(599608..600141)
FT                   /locus_tag="TPASS_0552"
FT   CDS_pept        complement(599608..600141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKT7"
FT                   /protein_id="ACD70973.1"
FT                   /translation="MQSLEPLITKQLRPAPVGVPEGTPQQVLYVLTWSALTQVDKYRIS
FT                   TAVPAVSGVYELYYMDEARALNLLTAAHAWYGGLRGNVRAAVDPHETADPARRALLTDA
FT                   TLYYRYSVSHSRDDMCDLVWFLHTQYFPGSVRVQHSGRYSAIFVQERAPDRVYWLEDLP
FT                   HRTERGSMQTRVSK"
FT   gene            complement(600217..600288)
FT                   /locus_tag="TPASS_t0025"
FT   tRNA            complement(600217..600288)
FT                   /locus_tag="TPASS_t0025"
FT                   /product="tRNA-Cys"
FT                   /note="tRNA-Cys1; codon recognized: UGC"
FT   gene            600385..601596
FT                   /locus_tag="TPASS_0553"
FT   CDS_pept        600385..601596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0553"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70974"
FT                   /db_xref="GOA:A0A0H3BJ52"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ52"
FT                   /protein_id="ACD70974.1"
FT                   /translation="MEKQSPAQTISLFVLLALMFVLVCMLFVPYLTVLLWSSILAILLS
FT                   PCYRALCARIDMHAFTRTRHLVSHMNGEDGCTAAITRATRFQKKMLAAVFSLVITLLVT
FT                   TVFFFIAISLFGQGKLLFDKLSLFFREYDLFEGAKQRSFTALIFKLSRGTVDISTLNVE
FT                   EHLLRFFGKHVESVFVYTQIFVKNIARAALSTLFFSFTLYFFFLDGEHLSCLLIAALPL
FT                   RKRASAQLLEKCKEATRHLFKGLFSIAFYQTCVAFVFYGIFRVEGPMALAMLTFFASFL
FT                   PLVGCACVWLPVGISIGFTSGWMRGTLFLFVAGSSITIIDSFLRPLLLQNKMRIHPLLI
FT                   FFSMLGGVQTFGFNGMVLGPILVILLFTVIDLTHDGESHYTSIFHDPPAAGVHAQSIHR
FT                   QGKK"
FT   gene            601631..602299
FT                   /gene="gph2"
FT                   /locus_tag="TPASS_0554"
FT   CDS_pept        601631..602299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph2"
FT                   /locus_tag="TPASS_0554"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70975"
FT                   /db_xref="GOA:A0A0H3BIM0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIM0"
FT                   /protein_id="ACD70975.1"
FT                   /translation="MRPMTRACIFDLDGTLTNTLGTIAYFVNMQAAHYHLPPIPSEKFA
FT                   LFLGDGSRALIQRVLAHYGAAAQTISEDEFLQRYCLAYEADFLQRCTVYPGVPEMLVEL
FT                   KRRRIELAILSNKPHSIAQKVASAFFGDNVFSVVLGQREGVPVKSDPAGLFEILRTLNV
FT                   ETAEALFVGDTAVDIRTASAAQVRSVGVLWGFRDETELSQAQAHVLIRTPAELLQHLSF
FT                   "
FT   gene            complement(602363..603553)
FT                   /locus_tag="TPASS_0555"
FT   CDS_pept        complement(602363..603553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0555"
FT                   /product="possible glutamate/aspartate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70976"
FT                   /db_xref="GOA:A0A0H3BJF0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJF0"
FT                   /protein_id="ACD70976.1"
FT                   /translation="MAGSAGFWLLAKLSGGMVCGVALGLCVNESVMAIIHTGKTLIGGV
FT                   VFFVIPLVIFGFIAPTVLSLKASAGRMLGSFLVLSYLSSVGASLFATAMGRVVIPYLRI
FT                   PRTVEGLRTIPKVIFTLEIPSLMPVVTALAFALLVGLSALWVKARAVEQVLYEFRRMMG
FT                   EAISRVLVPLLPFFVAATFAELAYSGSLTRQLPLFAKVVAVVIVGHLLWLCVLYLVGWI
FT                   LSRKNPFEVLRHYGAAYATALGTMSSAATLPVSLQCAHKSRALPAEIVDFAIPLGATTH
FT                   LCGSVLTETFFCLTIAQMLYGSMPSLADMVLFSCLFGIFAVGAPGVPGGTVLASLGLVL
FT                   DVLHFDTTGTGLLIAIFALQDSFGTACNITGDGALALMLRGLRYTLRANCVGREEK"
FT   gene            complement(603776..604768)
FT                   /gene="asnA"
FT                   /locus_tag="TPASS_0556"
FT   CDS_pept        complement(603776..604768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="TPASS_0556"
FT                   /product="asparagine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70977"
FT                   /db_xref="GOA:B2S3E8"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3E8"
FT                   /protein_id="ACD70977.1"
FT                   /translation="MEKSFILQQQGISFAKHTFTQKLMEHLGLIEVQGPLLSQVGDGIQ
FT                   DGLSGREKAVSVSVKQIPGTAFEVVHSLAKWKRHTLARYGFQDNEGLFVHMIALRPDED
FT                   FLDQVRSVCVDQWDWEKVVPVGSRNLAYLKDTVRKVYGALRESEVLVSERFGLRAFLPA
FT                   DIVFVQSEELVRRYPHLDSKGREDAICKEHGAVFLIGIGGVLSDGKPHDVRAPDYDDWT
FT                   TPSEGEYKGLNGDILVWNPVLGRAFEVSSMGIRVDEGALRTQLALTGDEDSLACSWHQD
FT                   LINGRLPQSIGGGIGQSRLAMLLLQRKHIGEVQASVWPRSVREEFENIL"
FT   gene            604873..605586
FT                   /locus_tag="TPASS_0557"
FT   CDS_pept        604873..605586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70978"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKQ9"
FT                   /protein_id="ACD70978.1"
FT                   /translation="MKKRMWRAVRTLLIICAGGTGALWAHPHVFIRTKVTFQWQKGVLQ
FT                   RAHITWEFDPFFSADIISGYDTNKDGLFDKKETQQVFENAFIHTKHYSFFTFIRSGESH
FT                   ARRARSQAARTSPQSVQHFSVSQKDGTLSYHFSIDLSSYQHAKSAPPGTRRTLYLALYD
FT                   HSFFCDFRYAEHDTVRFVCDKARVQPSYEIVENRTAPVYYDPFDSIESTPQYEHWRPGL
FT                   HTYYPKEILLRYTAP"
FT   gene            605616..606524
FT                   /locus_tag="TPASS_0558"
FT   CDS_pept        605616..606524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0558"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70979"
FT                   /db_xref="GOA:A0A0H3BKU1"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKU1"
FT                   /protein_id="ACD70979.1"
FT                   /translation="MKKVGVRVRACILCALAACATGVLANPFFGGAPARPRRQRTPELL
FT                   LRRYALVHQRLGAAIVQWSKTHSTRAWWITVMLSFAYGVLHALGPGHRKAALFSFYLGR
FT                   NAPVWEPALTAALLAALHGAASLLLLSAFRGVSGAIGAHSARTMWYMEVGSYGLLTFLA
FT                   LFSLVHELMHLFPSGGRYFSCGCSAHTAVCMRTGTVAHMQWGTMLLSGLFICPAALFVM
FT                   ILVLSLDAVGLGVAAVLSISAGLALPLMAVGYLAWASRAGIFYRMQKNTRHAQAVLSVV
FT                   SITSYGIMLIVCTSALVASLG"
FT   gene            606586..607791
FT                   /locus_tag="TPASS_0559"
FT   CDS_pept        606586..607791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70980"
FT                   /db_xref="GOA:B2S3F1"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3F1"
FT                   /protein_id="ACD70980.1"
FT                   /translation="MVNGSTQYLAHVGELSLKKGNRRQFEVQLERNLTLMLRSINPHVT
FT                   VRAGRLYLSVPASFEAQTTAEQALSCLLGITGWAAATACPKTMEAITRCAHAEATLAAR
FT                   EGKRTFRIEARRADKRFCRTSSEIAREVGAVIHQSGALSVDLHYPDVVIFIEVREREAF
FT                   LYGARRRGLRGLPCGVSGRGLLLLSGGIDSPVAGYRMLSRGMHIDCLYFHSYPYTPPEA
FT                   QKKVEDLAKVLARYGLSTTLTVVSLTDIQKQLQTHAPAPSLTLLLRMCMMRIAEHVARE
FT                   QRARCLITGESLAQVASQTLENLTVTSACTHLPIFRPLIGADKEDIIRTATEIGTYAIS
FT                   IRPYEDCCTLFAPKHPVLRPEVEEMQKQYQSLMLGPLLEDAFRTRKRTRIYGNYGVQES
FT                   GE"
FT   gene            complement(607844..609829)
FT                   /gene="tktA"
FT                   /locus_tag="TPASS_0560"
FT   CDS_pept        complement(607844..609829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="TPASS_0560"
FT                   /product="transketolase A"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70981"
FT                   /db_xref="GOA:A0A0H3BJ57"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ57"
FT                   /protein_id="ACD70981.1"
FT                   /translation="MTEEAMRAMALSIRSLTIDAIERANSGHPGLPLGAAELAACLYGT
FT                   ILKHNPANPSWFNRDRFVLSAGHGSMLLYAALHLSGYDVSLEDIKNFRQVGSRCPGHPE
FT                   YGCTPGVEATTGPLGQGISMAVGFALAEAMLAARFNTDEHAVVDHHTYALVGEGCLMEG
FT                   VASEASSFAGTMRLGKLIVFYDENHISIDGSTDLTFSEDVAKRYEAYGWQVLRGSMYSY
FT                   TDIMDLTACAKRDDRPSLIILRSIIGKGAPTVEGSARAHGAPLGEAGVREAKKALGLDP
FT                   ACSFFVAPELTAVLQKRKCECAHVEDSWNELFEAWSTQYPEKRADWDAAFVPGGVSTSQ
FT                   LARVVCPHFEKGSSLATRTASGKVLDALCSVLPNLVGGSADLRGPNAVAVSSLRPFSAE
FT                   HRAGGYCYFGVREFAMAAIVNGMQLHGGLRAFGATFMVFSDYFRPALRLAALMRIPSVF
FT                   VLTHDSIFVGEDGPTHQPVETLAALRAIPNVLVLRPADAEETFEAWKIALLHRNGPVCI
FT                   VLSRQNVPVFEKSDSSWRSTVEESGAYVVREGGATPELTVLASGSEVDLALRAAQLSKR
FT                   RVRVVSVLCKERFEAAGDEVQRRIQGGARVVVAEAGVYQGWGAWAKREKCLVLDRFGXS
FT                   GPGTQVAQALEFTAEALVEIILDWLA"
FT   gene            complement(609940..610791)
FT                   /locus_tag="TPASS_0561"
FT   CDS_pept        complement(609940..610791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70982"
FT                   /db_xref="GOA:A0A0H3BIM5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIM5"
FT                   /protein_id="ACD70982.1"
FT                   /translation="MLRTSVLVCIGCLSAAIPARLGARAVPPLSSAVVDEAALLSVQEA
FT                   RGIRALLEGLARPSGDGSSRSHPSPAPEAHARTLHDGTPLQIAVLIVDSLQGDSLEDFS
FT                   LRVAQEWGIGSRAQDTGIVLVIARAERKARIEVGYGLEDRVTDVHAHQLIRGTLAPCFQ
FT                   AGAYAQGVYETVLRLATLVRGQHEVQQFMQPRSVQPAVPRRGPVRNSAGSVFFFLLLFY
FT                   CLGGRLLPGGVLWPLLFFGTRRRYDPFGSGFSGAFGEWAGDGGGFSGGGGRFGGGGASG
FT                   SW"
FT   gene            610962..612098
FT                   /gene="spsE"
FT                   /locus_tag="TPASS_0562"
FT   CDS_pept        610962..612098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spsE"
FT                   /locus_tag="TPASS_0562"
FT                   /product="spore coat polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70983"
FT                   /db_xref="GOA:A0A0H3BJF5"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJF5"
FT                   /protein_id="ACD70983.1"
FT                   /translation="MFTCGGRCFRPDADILTIAEIGSAHAGSFDRARALIDAAADAAAA
FT                   AVKFQLIYAHEILHPLTGAVRLPSGAVSLYQRFEELEVPLSFYAQCFNHARSRGMLVGI
FT                   SPFGPRSATEALALKPDFLKVASPELNYPTLISTLAAAELPLILSSGVCLLKEIEGALA
FT                   QCRQYTKQGSSHALLHCITAYPAPETEYNLALLPALATIFNINVGVSDHSVDPLLVPLL
FT                   ARAHGACIVEKHICLSRTDAGLDDSIALDPADFRTMTAALNSCARRSPSQIISFLHERG
FT                   YAPHVVRAVIGSGEKVLAPSERAHYQKSNRSLHYLHAYPRGTVLQKENLVIVRSEANLS
FT                   AGEAPEHANLFVGAVLQRSVHAGEGARFGDIIQKGTCL"
FT   gene            612089..612502
FT                   /locus_tag="TPASS_0563"
FT   CDS_pept        612089..612502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70984"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKR3"
FT                   /protein_id="ACD70984.1"
FT                   /translation="MSMTSFYERIGAILRDRLNSDEDPFDQWDNRGGKYRTCAGRMERR
FT                   PPPKKNPPPGPVRVPVPPELVEDFAVLSVPAGLPLSYCKQSWKRLLKKYHPDVFTCTHT
FT                   SEQAADIVRRINSSYKRIETWFETGALPTDNKS"
FT   gene            612499..614535
FT                   /locus_tag="TPASS_0564"
FT   CDS_pept        612499..614535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70985"
FT                   /db_xref="GOA:A0A0H3BKU6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKU6"
FT                   /protein_id="ACD70985.1"
FT                   /translation="MTRVCRALLFVLCGIFVHAQENELHFFGPRTDVLVVFTASREAQE
FT                   RETRAVQQLRLLVQDFEHQTPDVSVLVAITAHDHPPVPDFVPVDRLTGTKKLISLISSY
FT                   KAPIVLILDETTGPPRLHTGAHRTVCPPWLLQAVYQHLTSHHVPIRYRDFDAILHRLGW
FT                   LHEDPRHALYIKEHIPAVRMENSLYPPGALHTLPALLTQVYSEEWDTHYVSVSYGGTLY
FT                   LIREQFFVILILGAVITLLLSLAIFSFLSDSRKRHYWNTILAMWWLPAILGVLSVCSVF
FT                   VATQLTALFFLIRFGTHTSTGALPLLALIVKHSIAIALSCVCMANSKTIRDSMLHNGFI
FT                   GGYLASTLCLLYAVLFSVIDFSLSAVFALEYALSLVFFSAQRKTTRRIMLAMMFLLFAP
FT                   FLYAYLKNSAVTAPLSFHQSNVFFALGCVPFMLFMLTLFFEREKSHPRIPFIRRRNLLL
FT                   SGALLTVLVINGVLWSVSLSSTRIPQEITACYRISERGLTLSLHSPLPIPRHIRARTHA
FT                   RLSTAEIQKAQDHLQISMDSRSYFGGRINVLEVRSQLRAQAIELRITSPHGTAAYEADR
FT                   PFTRLEQGSVVRFISQARPPLPFTVTFSGDQNSTMQVQATVWTYDNPLQDAPPVMQDTT
FT                   VRFIPMFELTRDVLFPSPSSQGVHATPEKNACIRDETVPNLQE"
FT   gene            complement(614417..615637)
FT                   /locus_tag="TPASS_0565"
FT   CDS_pept        complement(614417..615637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70986"
FT                   /db_xref="InterPro:IPR007407"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ62"
FT                   /protein_id="ACD70986.1"
FT                   /translation="MMTTVRVILQRCARGICSNKGRYSANQVLLFCILTLSLWTPFLGP
FT                   ALRHPAVYIRHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWED
FT                   TFYHCEQRSYEPAAALAESVPSPVLQEAVAVSPPGVAVNDSVAERKTTAPARVFSRTAL
FT                   RILMCGDSQMRYLTGGALQVLGTSSHVQIQEVTVSSSGFVRTDYYHWPRKFLALLDTHT
FT                   QQEPYAAVIMAFGMNDYQNFYDADGSLCVTKTARWERAYEQKMRACLNIILHTVPKVYL
FT                   LGMPETRNKQLNEKLVYIEHVQKKVVAQYDPQRVRYYSLKPIVPGVHGTYASAIRDTHG
FT                   RWVHVMHKDGIHYTIEGGAYVMETLLPLILADLERSRHGYMRSSLGSHELPATKGMERA
FT                   RHASTRT"
FT   gene            complement(615648..617135)
FT                   /gene="algI"
FT                   /locus_tag="TPASS_0566"
FT   CDS_pept        complement(615648..617135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="TPASS_0566"
FT                   /product="alginate O-acetylation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70987"
FT                   /db_xref="GOA:A0A0H3BIN0"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIN0"
FT                   /protein_id="ACD70987.1"
FT                   /translation="MFFSLLSPAAFLFIFFILYWYVFRTATQRVVVLLVANFLAIAAFD
FT                   IRFCIPYLVLSALAYSCGLLILMQKSFLWRKVLLIAGTLLQILFFCLFKHFSDMLSLVR
FT                   AFAPAYFAQHTWHQHVKDWNIWHPVGISYCTFKCMSYVFDVYLCKIRRREPFARVLLYV
FT                   SFFPQMISGPIANASHFFTRLPHNLRAGESPLDRPIHFDRAVVLLYTGLVKKVIFADFL
FT                   SILVTDKIFTLPSAYSSTELLFGLISYSAVLYCDFSGYSDLAIAVGLLFGFETPANFKR
FT                   PYISQSVTEFWRRWHISFSQWLKEYLYFSLGGSRFGIKRTVCALFFTMLIAGLWHGVRL
FT                   TFLLWGMAQGVALVIERVYREKRRVNGANAFGSSSVMGRWKARAMRCIRVSALFLFVSV
FT                   GWLIFRAPSFAEVWRYVTLLFRGSWHGPFQVITPFTALLALCALCVQLPSDRTRARAFA
FT                   CYCAVPLPVKALCAAFFFFVLSVMTPSGIAPFIYYSF"
FT   gene            complement(617167..617787)
FT                   /locus_tag="TPASS_0567"
FT   CDS_pept        complement(617167..617787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJF9"
FT                   /protein_id="ACD70988.1"
FT                   /translation="MRRNSRTMAKIVALLALILLLILAGFIWFDYLGVLDAKRAISPLY
FT                   RLFGRSVPEGVVSTADPDLDADRYAKRLEALGERAEELDKKDAELQEKEKDHERVSQEL
FT                   DERLRALEDKEKSYNLLVAETNERRGNVRKIAEYVSGMPPESAVKILLKTDDQDVIEVF
FT                   RMVDAAARQRGVNSLVPYWLSLMPPDRAAEIQRKMANKPADFP"
FT   gene            complement(617866..618498)
FT                   /gene="eda"
FT                   /locus_tag="TPASS_0568"
FT   CDS_pept        complement(617866..618498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="TPASS_0568"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70989"
FT                   /db_xref="GOA:A0A0H3BKR8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKR8"
FT                   /protein_id="ACD70989.1"
FT                   /translation="MITIFEALERVRVIPVVTLERVEDAVPLARALITGGIRCMEVTFR
FT                   TLVAAEAIAAIRQECADVLLGAGTVLTVEQAQQAQAAGAQFVVSPGFNPRVVAHCLGHG
FT                   VPIIPGIASATEIERALEFGISVVKFFPAELLGGTAMMSALARPYTAVRFVPTGGIHLN
FT                   NLAEYVAHPRVLACGGSWMVPAQSIAAGDFSQVTALSQQTLQIVGVM"
FT   gene            complement(618620..620944)
FT                   /locus_tag="TPASS_0569"
FT   CDS_pept        complement(618620..620944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0569"
FT                   /product="aminopeptidase P"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70990"
FT                   /db_xref="GOA:A0A0H3BKV0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKV0"
FT                   /protein_id="ACD70990.1"
FT                   /translation="MIPLGKRHGHSAVAVCSRGVSVFRGEKAMDGVRGRLSALRSLMRA
FT                   QGVDICYISGENAHGQIDGAREYFSGFTGSAGIVVVTAQRAFLWTDGRYFIQAERELSA
FT                   CEVCLFRTGQAGVPRVTELLRTELRAFSSGPGHGGGTLAVDGRTISAAVWEQFQQELVD
FT                   VSLRLDFDGALLLPQEHRVSVVPSPAFLLDERYTGLSAAQKLTQLRAALSARSCDATVL
FT                   STLDDVCWLTNVRAHDVPCTPLLVAYMVVTHTRAFLYVDMRKISSALHQALYAQGVECM
FT                   PYDTFFDQVCARCADQEPTVHAVGKGRAGVQEVAGRTPVVLLDFERSCAALVDLFRASP
FT                   QVCRPQVERSAPSGSLSSVLGIEEDGTETSRGGKSACALQSARDALAAGKEKENKEERG
FT                   QTMCFSVCRGLLPTVALKALKNDTERANVHQAMIQDGIALVKTLQWVYQQLDVGADVDE
FT                   CAVAEFVRAARAVSPSFIEESFHTIAGYGANAAMVHYRPVRFSALHPAAGQTAALLRAR
FT                   GFLLLDSGAHYREGTTDVTRTLALGPLTDVQRADYTLVLQAHSALARARFPAGTSGAVL
FT                   DGIARAPLWAQGRDYPHGTGHGVGFCLSVHEGPYSISPSAPGRGGTARGIGAEHTGDPP
FT                   FFSEEAAWQLRPGMLLSNEPGVYVAGSHGVRIENLMWVVQAHESDAQCVWKEGGEGKEE
FT                   NAAARECTGADRMQPSRCRSFYGFQTATLCPIDTRPLVRERLHDEDIAWLNAYHLRVYV
FT                   TLAPFLDARTRAFLRTCCRAL"
FT   gene            complement(620969..621814)
FT                   /locus_tag="TPASS_0570"
FT   CDS_pept        complement(620969..621814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70991"
FT                   /db_xref="GOA:A0A0H3BJ67"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ67"
FT                   /protein_id="ACD70991.1"
FT                   /translation="MWFSLRRIGDLLSWLVGSKGVRGSFCADPVPRVDGAHGGDDPRRE
FT                   EDASGAFHIPRFAARLGLDSAGLLRIQRTVARVEGHTDGEVALALIKESDSYSVYELFF
FT                   ALVLAGACFCVQLSMVSVLEQAFARFFWAPPSWYMPAFMVASSVAACVLFFFIANIPWV
FT                   DRALVPGPLKQQKSYARAVRHFVESGVCNTRNRTGILIFISVLERRVLVLADVGVSAYV
FT                   PAREWTELCQIITAGLRSRRAADALCEALTRVEQVLATRMPPQKKSSNELPDGLVILSH
FT                   "
FT   gene            complement(621841..622506)
FT                   /locus_tag="TPASS_0571"
FT   CDS_pept        complement(621841..622506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0571"
FT                   /product="protein Tp70"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70992"
FT                   /db_xref="GOA:A0A0H3BIN5"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIN5"
FT                   /protein_id="ACD70992.1"
FT                   /translation="MGCACLSSFCWARAGVGVSVSKGLRGTLIGVGVSLAFLLVVYRLF
FT                   AGSYNRMISLDEAVKSAWSQVEAVLQRRLDLIPNLVSTVKGYAEHESDTLKRVAEARSR
FT                   AGGVMQVGESALSDPEKFARFQRVQAEIGGALGRLLLVSEQYPALRANGSFLALQSQLE
FT                   GTENRISVERTRYNRAVQEYNAYIRSFPRSAVARWGNFSSRPYFTAHEGAVAAPRVRF"
FT   gene            complement(622524..623606)
FT                   /locus_tag="TPASS_0572"
FT   CDS_pept        complement(622524..623606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70993"
FT                   /db_xref="GOA:A0A0H3BJG4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJG4"
FT                   /protein_id="ACD70993.1"
FT                   /translation="MSALFSLVAVYVLVCALHKQIKKYASVCYLGSACVSVAVVCVVWS
FT                   GATKGNFGVRVLLHPLTSASFSTAIFTFVMCASVLKNGLLKQRVMGLRAELAITAAILT
FT                   LGHNIAHGRDYLVRLCGSTGDLSTGFLVAGAVSMVLVLLMSILAVTSFKVVRRRMGAKT
FT                   WKRVQRLAYLFYGLTYVHLSFILLPTALRGYIPSVVSYVLYTVIFATYALLRVRKALGK
FT                   RKGACALCSAAVAVSFVAFVLGASHMVRHTRRAHTERTTRAKARKCSPAEMKDGVYEAS
FT                   AQGHNGKLSLRVTISQGRIEAVTVVGHSDDDPYASWAVEGVSAAIVGAQSTDVDVVSEA
FT                   TSTSEAIIRAVEKILQQPQP"
FT   gene            623597..623689
FT                   /locus_tag="TPASS_0573"
FT   CDS_pept        623597..623689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKS3"
FT                   /protein_id="ACD70994.1"
FT                   /translation="MQTFSLLVAYKIFTDGTETKRVHASKAKHA"
FT   gene            complement(623716..625020)
FT                   /locus_tag="TPASS_0574"
FT   CDS_pept        complement(623716..625020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0574"
FT                   /product="carboxypeptidase, 47 kDa"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70995"
FT                   /db_xref="GOA:A0A0H3BKV6"
FT                   /db_xref="InterPro:IPR029218"
FT                   /db_xref="InterPro:IPR029220"
FT                   /db_xref="InterPro:IPR029221"
FT                   /db_xref="InterPro:IPR036154"
FT                   /db_xref="InterPro:IPR038031"
FT                   /db_xref="InterPro:IPR038698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKV6"
FT                   /protein_id="ACD70995.1"
FT                   /translation="MKVKYALLSAGALQLLVVGCGSSHHETHYGYATLSYADYWAGELG
FT                   QSRDVLLAGNAEADRAGDLDAGMFDAVSRATHGHGAFRQQFQYAVEVLGEKVLSKQETE
FT                   DSRGRKKWEYETDPSVTKMVRASASFQDLGEDGEIKFEAVEGAVALADRASSFMVDSEE
FT                   YKITNVKVHGMKFVPVAVPHELKGIAKEKFHFVEDSRVTENTNGLKTMLTEDSFSARKV
FT                   SSMESPHDLVVDTVGTGYHSRFGSDAEASVMLKRADGSELSHREFIDYVMNFNTVRYDY
FT                   YGDDASYTNLMASYGTKHSADSWWKTGRVPRISCGINYGFDRFKGSGPGYYRLTLIANG
FT                   YRDVVADVRFLPKYEGNIDIGLKGKVLTIGGADAETLMDAAVDVFADGQPKLVRDQAVS
FT                   LGQNVLSADFTPGTEYTVEVRFKEFGSVRAKVVAQ"
FT   gene            625132..627188
FT                   /pseudo
FT                   /gene="ptsI"
FT                   /locus_tag="TPASS_0575"
FT                   /note="phosphoenolpyruvate-protein phosphotransferase;
FT                   frameshift"
FT   gene            627252..628358
FT                   /gene="prfB"
FT                   /locus_tag="TPASS_0576"
FT   CDS_pept        627252..628358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="TPASS_0576"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70996"
FT                   /db_xref="GOA:A0A0H3BJ72"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ72"
FT                   /protein_id="ACD70996.1"
FT                   /translation="MVHKSPPSRRACRKYGGVFDVAAYEARIATLEAAAAAPDFWSERA
FT                   RAEALLAELKTLRATLEPWRALRRESADLRALYELAREAQDASLEPELSSLFSDISARF
FT                   EEASLTRLLHEEVDRLDAFVTIHSGAGGVEACDWAQMLMRMYTRWAERRSFCVHIVDLL
FT                   ESEGGVKSVTLKICGSHAFGFLKGETGVHRLVRISPFDSAARRHTSFTSTYVFPVLDDH
FT                   VEVHIRSEDMRVDTYRSGGAGGQHVNKTDSAVRITHLPTGIVVTCQNERSQISNRATAL
FT                   SLLRARLYAYERQKKQQEHQRFASEKKDISWGNQIRSYVFHPYTMVKDHRSKCETGNIH
FT                   AVMDGALEPFIRSYLEFLCTSTQCVEPQ"
FT   gene            628250..630094
FT                   /locus_tag="TPASS_0577"
FT   CDS_pept        628250..630094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70997"
FT                   /db_xref="GOA:A0A0H3BIP1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIP1"
FT                   /protein_id="ACD70997.1"
FT                   /translation="MRNGEYSRSHGRSVRTVHPFLLGVSVYQYPVCRTTVNGSYAQSFA
FT                   ALLFFPQIAVAFSATAPAPSFDSFLSARQRHPPASSFLASPAAPTHPLFATARTTAAQL
FT                   LSTPPAPARPRPRPDHVIPKEKWRLAVADFTFHGIPKIFQRYVRPARELLFIELKKLPL
FT                   RHFLSEAEQRERAALPHEEAYHARLKERAHLQRARDFVSLHPVSDHARRLRTAAFEKQI
FT                   KEKEQEIERARVEVRTARARFFRPWLQAEVLVLGAQNEPHALPERFHLATHLRQKKLSA
FT                   LVTGKLVDVAGYVRISLYLSTGLEAEPTREFTLAGPYRELPRLMHTLSAQLRSAIENAQ
FT                   PVRIVFDVHPPHARLSFQGVPVEDLSKPLISYPGRYVVDVSAAGYFSATKEIYIENRPA
FT                   FSLRVRLVARPQHRVRVQLTDNSAAPIFSGARSVGVTPFSTVVTDLREIFTVGPAGARS
FT                   FAFIERGTFPNSQPSTLVLPAPNPNATQDLAYKRDVAYWSFGALCIAVPIALILGSTLA
FT                   DTHQALERAKAASAQPPPPPTPAGTGALERKSQHLLIGTGVAVGVAVILSINFIVHAAR
FT                   YLNAVMHNAPQAVRPRADKDIQTLTHRDEAEEDQEEDS"
FT   gene            630101..630988
FT                   /gene="ftsY"
FT                   /locus_tag="TPASS_0578"
FT   CDS_pept        630101..630988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="TPASS_0578"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70998"
FT                   /db_xref="GOA:A0A0H3BJH0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJH0"
FT                   /protein_id="ACD70998.1"
FT                   /translation="MKVGLGNLAQKIRRLLGGQAPLDETFFSALEELLIEGDLSLSTAE
FT                   SFCTQLRNAARTRSVHTEDALRTLFAEIMESCVRVTHLAPNPNQCSLYLLLGVNGSGKT
FT                   TSAAKLAAYYQTQKVHPILFAAADTFRAAAAEQLAHHGAQLGVRVIAHPGGKDPAAVVF
FT                   DAGEALRAQKRGLLLVDTAGRLHNKTHLIAELQKIDRIAQTKVSADAYRKILVLDATTG
FT                   QNAFRQAQTFHEAIGVDALLLAKCDTRARGGAVFSIMQELGIPLAFLGWGERYTDLVEA
FT                   NAREFVSSFLHGER"
FT   gene            630985..631761
FT                   /locus_tag="TPASS_0579"
FT   CDS_pept        630985..631761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD70999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKS8"
FT                   /protein_id="ACD70999.1"
FT                   /translation="MIRPRYGWMYSSGIAVHLCAAVCAHSAVPAAWTFAEQTQAQKTDT
FT                   PLDSSSYAVTSPEEAPNEADPFEKELEHAFERAHVSTGGADSSSHADFVHMEEAGRAHA
FT                   SANRWYHETFDSRQRPSSAVLYEGAQLLHTVHWHYVGDRLFPCEKIITTPHTRIRARYN
FT                   FSGKIVAYEMHTRGVLVYARTYRYDAHARICEKEETTARGNERITYEYRGKVDVLEKRY
FT                   RNGVLQAIIHQKEGAQDVQVFERGKEIYSTKEVHDE"
FT   gene            631754..633043
FT                   /locus_tag="TPASS_0580"
FT   CDS_pept        631754..633043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0580"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71000"
FT                   /db_xref="GOA:A0A0H3BKW0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKW0"
FT                   /protein_id="ACD71000.1"
FT                   /translation="MSNTHVQTLRWMCFMVRRLNSVRARSANAITSLFFILGIAFGALT
FT                   LIVILSVMNGFQQGFIGTILQVSSAHVRVYGSVDAVKRAETLGGYQSFYPFIEAHALLQ
FT                   GNYYRQHGALVRAVPADIFHRDRLLARALPITSGSFNLSKKHSIVLGYELARHLSVRTG
FT                   DQVDTLALSGSDTQKIMPGWNKLTVTGIFKSGYHEVDSTFAYIPLDMGTTLFGTTPDIT
FT                   AAVKLNNHERDDRYLFFLAQHIPDLKAESWREYNRAFFSALRIEKNVMILLVILIFMVV
FT                   TVNIYHSMRRSIRTRKEEIAMLVSLGAPVSHVQILFIGNGIMIGFLGSLLGVLLGLLIT
FT                   IHVNEIIACIETAVNSAFFLFSLFSGTKTPSFSVFGTQYFYNVERIPVQIFFQEVLFVF
FT                   LFGTGSASVATYLATRKILLLKPAEVLRDE"
FT   gene            633036..633716
FT                   /locus_tag="TPASS_0581"
FT   CDS_pept        633036..633716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0581"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71001"
FT                   /db_xref="GOA:A0A0H3BJ75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ75"
FT                   /protein_id="ACD71001.1"
FT                   /translation="MNDPILSVEQVSKSFCCATERIQILSDVSFSVPRAVKVAITGESG
FT                   CGKSTLLNIIGGMEHADSGIVRVLSCDVLTLHEHALTEYRRQFLGLVFQFHHLLRDFTA
FT                   LENVMLPGLIAGKSYREVRARAYELLEKVRVVQRAHHFPAQMSGGERQRTAVARALIND
FT                   PTLILADEPTGNLDPKNALIVQDLLFSLTEEYQKTLLIVTHDPRIASMTDYRYQLQQGS
FT                   LIRI"
FT   gene            633713..635200
FT                   /locus_tag="TPASS_0582"
FT   CDS_pept        633713..635200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0582"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71002"
FT                   /db_xref="GOA:A0A0H3BIP7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIP7"
FT                   /protein_id="ACD71002.1"
FT                   /translation="MKQRCAAVNLIRVIFMCALRCAGVCAGYGHTPSLHGDAHHVLPTP
FT                   VPFLSGTPVAGKRRSFLRKSFFCAALGIGISIIPLIVVLVVSDGMIEGITTRMIELGSG
FT                   HLQFIDILPLAPNETATQRYEDAQRIFNAFMAQDFGPYCHSRWMHLQGDGIVIGKTGRA
FT                   GGNIRAVPPDFFSSERGLRPFLTVEGSLELVDRPQGVHTLILGKRIAERIGVRCGDTCQ
FT                   ILTLVQGGTGRAVPKMVRAVVGGIVSCGYQELDALWVFIPLTLGMKILSPASALLSFVV
FT                   KTADAFDAKAMTRFIEQVHEQLPSHFSAYTWQDMNRSQFHSFRTSRKLLLFIMYLIVLV
FT                   ASVHISSVLVVLMTERRKEIAMLKAMGAPPHVIALIFLSAGLLTALYGLLIGLPLGMWC
FT                   AIHVNEMFLFAEQMLNSWRTAIHAIGQLFLRTSAHVPVTPIHLLDPAHYLERIPIVLSV
FT                   HALCGVAGGTLCLSLAVCIIPALRAGRVRPLDLMRKV"
FT   gene            complement(635184..635309)
FT                   /locus_tag="TPASS_0583"
FT   CDS_pept        complement(635184..635309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJH4"
FT                   /protein_id="ACD71003.1"
FT                   /translation="MRSSIAPTAPAECSSKRWYPSVCEPDVRNQKNWGHPITPCA"
FT   gene            635296..636705
FT                   /locus_tag="TPASS_0584"
FT   CDS_pept        635296..636705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKT3"
FT                   /protein_id="ACD71004.1"
FT                   /translation="MEERKNYMDRLAEALTRRKVQLDRDILPKALEQYRVQVTAVKAIR
FT                   SNLLQKGFLHDDAYKYDSKMTEIELPETSPYGENEKPMVIGSRLSHYQTMLGFLDNYYR
FT                   FDSEFLIPKRIAKLVALNGTFMWKDFTATTKDANTRGLFDIVQSFYGAADPISIGLVRD
FT                   SLQYLVKAHEVISTALKSLSVFHRERYKLLIRQHALDGLDETTVDVNNPEVALDAMKKN
FT                   FSENAKGHPFYSELATVVLREDFSANAEKLRAAILREFEESSAPKRCRGAMRNPHAVLL
FT                   SGFRSLGATSSHFHTALEKIRFNEELVTQSEATFFSKVVLAFLKAFNIQTRSKDVEIVV
FT                   VDPATQIQKKECVNVELFQKELARCVKLYRGFVSPDTPIHEKLMALKDEQLFELLFKHV
FT                   AEAHTLVKQLAGLDEYYKTVRSDVRAKIKGVKIEVTTITTSVTKANKCRAEYASQLEEQ
FT                   KHMKRLGVARA"
FT   gene            636698..638341
FT                   /gene="oppA"
FT                   /locus_tag="TPASS_0585"
FT   CDS_pept        636698..638341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="TPASS_0585"
FT                   /product="oligopeptide ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71005"
FT                   /db_xref="GOA:A0A0H3BKW5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKW5"
FT                   /protein_id="ACD71005.1"
FT                   /translation="MRRMRLSRRGILTVVGTLLLLPLFPSEKKKTHAPLPRSERKEFVV
FT                   SFSPYRPVLHPHVASRVDEAQLLTALYEGLVTYDPYDLHPIPALAQHWSVSTDGLTWTF
FT                   YLRDQIFFQNGDPITAETFQQSWLNLLNPEWNVPYASFLDAVEGARAYRSGTTADSHTV
FT                   GILVEGSDKKTLVVKLAYPAGHFIQMLCHHAFAAVHPTQLASVGTLHARTASASAHKPF
FT                   HPIASGPFELQQMQADRVVLRVNTRYWDRDALALHAIVALIAQDPAARDAGFNDGSIHW
FT                   ISGALEHSSLQDAATLQIVPLLATEYLCFKTAHEPTCNATLRKALLLATPVEELTARYL
FT                   FPARTLVTPFTGYPVPPVVHEYNPARARALLAEAKIGGKTARTPLKILVSDTEACRALA
FT                   LELQKAWTALALAVEIWAVRPETYREYVQDEKYHVRIVSWVADFADPMAFLELFRKGSK
FT                   THSTGWTHEEFEALLTRAGAEPHVLRRWELLAQAERILLQEAVVLPLSRLHALHAVQRR
FT                   TVRGWYANVLDVHPFKFISLQEEIKVNLDS"
FT   gene            638430..641066
FT                   /gene="leuS"
FT                   /locus_tag="TPASS_0586"
FT   CDS_pept        638430..641066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="TPASS_0586"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71006"
FT                   /db_xref="GOA:B2S3H7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3H7"
FT                   /protein_id="ACD71006.1"
FT                   /translation="MGYPFRALEKKWQAYWRDKRVFCVSEDERFPPERRAYVLDMFPYP
FT                   SAQGLHVGHPEGYTATDIYCRYLRMGGYNVLHPMGFDAFGLPAENFALKTGTHPRVSTS
FT                   ANCDTFRRQIQSFGFSYDWEREISTADPEYYRWTQWLFLKLYEKGLAYEATAPINWCPS
FT                   CKTGLANEEVRDACCERCGAEVTRRGVRQWMVRITAYAERLLSDLDELDWPESVKQMQR
FT                   NWIGKSCGAEIDFPVDAPACSVHDKLPQTIRVYTTRADTLFGVTYLVLAPEHEAVTALT
FT                   THAQRAAVQAYVQRAAKKNDLERTDLAKEKTGVFTGAYVRNPINDMRIPVWVGDYVLVS
FT                   YGTGAVMAVPAHDQRDWDFATRFGLPKLTVVSADYTATVPNSNSPQGAVLQRCVSDEGF
FT                   VVNSGAFNGLASADARERIVAHLEMRGAGARRVTYRLRDWVFSRQRYWGEPIPLVHCPS
FT                   CGVVPLPESALPLLLPETADFTPTEDGQGPLARARTWLRVPCPQCASDAVRETNTMPQW
FT                   AGSCWYYLRYMDPRNKTAFCAPEKERYWAPVALYVGGAEHAVLHLLYARFWHKVLYDLG
FT                   LVSTKEPFARLVNQGMITSYAYRRKNGALVPHDEVHTNAQGTYVHARTGEKLECVVAKM
FT                   SKALKNVVNPDDMIAAYGADACRVYEMFMGPLEASKPWNTQGLVGVFRFLEKIWVLAGR
FT                   VAAANGIPQDSRAEPPGDLHAQKKSCSMYALETLLHRTIQKVTDDTSALSFNTAISQMM
FT                   IFVNEATRVARRMPLPSKMWEMFVKILSPYAPHLAEELWEMCGHTHTIAYEPWPQVDPA
FT                   RVAPHVCSVVVQVNGKVRDTFSVAPNAPNEELEQKARETAGARKFLGTQQPKRVVIVPN
FT                   KLVNFVL"
FT   gene            complement(641046..641276)
FT                   /locus_tag="TPASS_0587"
FT   CDS_pept        complement(641046..641276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ79"
FT                   /protein_id="ACD71007.1"
FT                   /translation="MIAQYQRAASLWTLSDTHAILDRLFQTDAMIRSGGTPLQGPLMQL
FT                   CLYAIVVHAGRAPHRYCTTLQEQCGLQNEIY"
FT   gene            complement(641303..642067)
FT                   /locus_tag="TPASS_0588"
FT   CDS_pept        complement(641303..642067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71008"
FT                   /db_xref="GOA:A0A0H3BIQ0"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIQ0"
FT                   /protein_id="ACD71008.1"
FT                   /translation="MSVWLFTGPEIGERDSAVQEVCARAQAQGTVDVHRLYAHETPVAD
FT                   LVDLLRTRALFADAVCVVLYNAEVIKKCDEVHVLTEWIKDGGSRADVFLVLISDSVSIH
FT                   KRIEQNISPVHKRVFWELFENKKHAWVQRFFFQHEMRIEQEAIESLLELVENNTRALKT
FT                   VCTQLSLFFEKGRRITAHDISSLLVHTKEETSFTLFDALSKRDLEHSLMILNTLLCSKD
FT                   VAPVQILAGLLTRSVALRIGTIYRRTKRTLQR"
FT   gene            complement(642155..642421)
FT                   /gene="ptsH"
FT                   /locus_tag="TPASS_0589"
FT   CDS_pept        complement(642155..642421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="TPASS_0589"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71009"
FT                   /db_xref="GOA:A0A0H3BJH9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJH9"
FT                   /protein_id="ACD71009.1"
FT                   /translation="MVVKTVRVLNRAGVHARPAALIVQAASRFDSKIMLVRDTIRVNAK
FT                   SIMGVMAMAAGCGSELELVVEGPDEVAALSAIERLFQNKFEEE"
FT   gene            complement(642393..642509)
FT                   /locus_tag="TPASS_0590"
FT   CDS_pept        complement(642393..642509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKT8"
FT                   /protein_id="ACD71010.1"
FT                   /translation="MQHMHRIIGQMIRTRGLKNVRCMAVEGKHNGRKNGARA"
FT   gene            complement(642466..643425)
FT                   /gene="ptsK"
FT                   /locus_tag="TPASS_0591"
FT   CDS_pept        complement(642466..643425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="TPASS_0591"
FT                   /product="HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71011"
FT                   /db_xref="GOA:B2S3I2"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3I2"
FT                   /protein_id="ACD71011.1"
FT                   /translation="MLKLDLKERDSLDLRCIAGHHGLANPITISDLNRPGLVLSGFFDF
FT                   VAYRRIQLFGRGEHAYLLALLEQGRYGAIEKMFTFDLPCCIFSHGITPPEKFLHLAEPS
FT                   SCPILVTRLTSSELSLRLMRVLSNIFAPTIALHGVLVEVYGVGILISGDSGVGKSETAL
FT                   ELIERGHRLVADDLVEISCVNGNSLIGRGVHKSIGHHMEIRGLGIINITQLYGVGSIRE
FT                   RKEVQMVVQLEEWNSSKAYDRLGTQELNTTILDVSVPLIEIPVRPGRNIPIILETAAMN
FT                   ERLKRMGYFSAKEFNQSVLKLMEQNAAHAPYYRPDDTY"
FT   gene            643604..643676
FT                   /locus_tag="TPASS_t0026"
FT   tRNA            643604..643676
FT                   /locus_tag="TPASS_t0026"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg2; codon recognized: AGG"
FT   gene            complement(643690..643761)
FT                   /locus_tag="TPASS_t0027"
FT   tRNA            complement(643690..643761)
FT                   /locus_tag="TPASS_t0027"
FT                   /product="tRNA-Pro"
FT                   /note="tRNA-Pro1; codon recognized: CCG"
FT   gene            complement(643813..643886)
FT                   /locus_tag="TPASS_t0028"
FT   tRNA            complement(643813..643886)
FT                   /locus_tag="TPASS_t0028"
FT                   /product="tRNA-Asp"
FT                   /note="tRNA-Asp1; codon recognized: GAC"
FT   gene            complement(643956..644028)
FT                   /locus_tag="TPASS_t0029"
FT   tRNA            complement(643956..644028)
FT                   /locus_tag="TPASS_t0029"
FT                   /product="tRNA-Met"
FT                   /note="tRNA-Met2; codon recognized: AUG"
FT   gene            644188..645690
FT                   /locus_tag="TPASS_0592"
FT   CDS_pept        644188..645690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71012"
FT                   /db_xref="GOA:A0A0H3BKX0"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKX0"
FT                   /protein_id="ACD71012.1"
FT                   /translation="MVFRRTVALALLLRTLPCAAHFGNRDRTFYDLNNAPLALRAIQDA
FT                   YPHLNAVIAYDPREQDWLIRSDGRTLYWAEGRLLPREHRDQAHDWRPIIDYVYAREVLD
FT                   PAHLFPEEIHALRPKTLAIKRSATKPYHDAFFTWLYGPATRSEINARLARDYTFLGKPV
FT                   YVHKALITRLNAVQEKILTAAKTHAHVQKFIEDLLRVDGFNWREISDSRQKSNHSWGIA
FT                   LDLMPKNWQRHTMYWNWEAAHNEDWMHIPIKKRWAPPAEIISLFESEGFIWGGHWMLWD
FT                   TMHFEYRPELLAVRKILAEGNRYDFQEQNIVVHADDFPAQYFSPKEVFGTDEKEHITYA
FT                   ESCVRATHASVKELVRARTLVARFSPMRRLHVYAPPESIHNSIDTALLRMTAQLKKNYT
FT                   NAKIRNNSRLLSKKHAQTRASRRSADVYTVSCRHAQAIALQYPHALSWQSKERSDALWI
FT                   ALFSVRQEAARRSVCTPSSKEQCMTHALSSCVDLARTHILLP"
FT   gene            645627..647660
FT                   /locus_tag="TPASS_0593"
FT   CDS_pept        645627..647660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71013"
FT                   /db_xref="GOA:A0A0H3BJ83"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ83"
FT                   /protein_id="ACD71013.1"
FT                   /translation="MHDARTFFMRGSCTYAHPVAIGRFFPLSSPTHTPQGTLMKSHGTM
FT                   CSRNALLLPRRGAGLHVLTPRIREARPVNTGVKVILSLFATLVLMVGVFFCAPRASFAE
FT                   FERHFYQPTVLSALSTNLREVSKASEAWHSRYRPLFSQFCALDAVRSSFDPAQKAEDIT
FT                   QRAREASALLSSVAGLKGVRIVEAQKPNIHFSTFESDVLLADSGSVTYRKYNAEEHDVP
FT                   LQFLGEHSPEPKVIIDEYHDALLYSFPSLGNYGEYRGRILFYLSLRALGTHLIAENKLK
FT                   ITDSIVPLSADDYTFGGIVIGIPHEGVRSLKPSVLAEWKRKQFRVQTVRSEQHEDWALL
FT                   SNASGAFVIAQAVPVLLFGFTPLTKGLVAMVAVVTTFLLVFQLLSLRQDPLTKLRDRLI
FT                   HFHAQLLHSCLEQKESLEWEEVRTRLEHRRRETDAEMKKSLPRRLRIRRGRELDALLSK
FT                   GWDDVFSTLEHGYGGARAMNRAQIEQLVREVLAQSLASGEAVLPVAMRADTADEELDEV
FT                   LEELPDEAASLPSDSSPEEDLDPLEEVESIEGTAEESTREYAAAGDALLSKTPQLSTHS
FT                   EYVPATLAELLGRNAEPGDVVRDSAVLEYIEGVFDYRPCCFYESHAVHDCLEVVTGEDG
FT                   PSLSPMESIVSTEDGLFTIRVSKEEGNHLNRDFKALVDSVLY"
FT   gene            complement(647747..648355)
FT                   /locus_tag="TPASS_0594"
FT   CDS_pept        complement(647747..648355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71014"
FT                   /db_xref="GOA:A0A0H3BIQ7"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIQ7"
FT                   /protein_id="ACD71014.1"
FT                   /translation="MVPAFLQVVFPLVGCAHYILWGRAMRKVIVYGVVLCLCVPCFTAS
FT                   SDKAAQVPSVQKEMADPVEGIWKSVDDNTGKPTGVWRLYVQDGKLFGKILVCMGRAPNA
FT                   AVVSCTRTYPDFPKKGNVANMPLVGTPFIYNLERTSPGSWGGGYVIDPASGKYYYCKIN
FT                   FIPADGRSYKVDTLQMRGEISWGIGQKPVLAQVFPDGSR"
FT   gene            complement(648383..649018)
FT                   /gene="adk"
FT                   /locus_tag="TPASS_0595"
FT   CDS_pept        complement(648383..649018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="TPASS_0595"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71015"
FT                   /db_xref="GOA:B2S3I6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3I6"
FT                   /protein_id="ACD71015.1"
FT                   /translation="MRFVFLGPPGAGKGTLAGEISGRCGVVHISTGGILRAAIQKQTAL
FT                   GKKVQKVVEVGGLVDDQTVTELVRERVSHEDVVSGFILDGFPRTVTQARCLEDIVPIDY
FT                   AVSIVVPDDVLVARLTGRRVCSACGSSYHVLFAQPKREGVCDRCRGVLVVREDDKMSAI
FT                   LQRLTAYRAQAEPIVHFYSERGKLVSLNGAPPISDVVLEFQERFAQSR"
FT   gene            complement(649042..650154)
FT                   /gene="pcnB"
FT                   /locus_tag="TPASS_0596"
FT   CDS_pept        complement(649042..650154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="TPASS_0596"
FT                   /product="polynucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71016"
FT                   /db_xref="GOA:A0A0H3BJI6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJI6"
FT                   /protein_id="ACD71016.1"
FT                   /translation="MLVRYSYDAKGRRLGRALVYTESEHGIPRQSVDAGAIRVVEALVG
FT                   AGYETYIVGGAVRDLVAGRTPKDFDIVTGAVPSRIRRLFRNSRIIGRRFRIVHVSCGSQ
FT                   LYEVSTFRSRVGEGSVCVPGTLEEDAWRRDFSVNALYYDPLRNVVIDCVGGMVDLKRRR
FT                   VRPLIPLRSIFVEDPVRMLRALKCSVMCESSIPFSVRRSIRRSVSLLGGCSPSRLTDEF
FT                   VKILFSGRSAALVRALCGYQLLLYLQPSVHYFMRDVPCFESAFFASLRVLDQAFVSGRV
FT                   KRVGQALTYVLRDFVGLVFGHADAPDEVYIRVYRACRSFVLPMNPPRVELEYAVRSCLG
FT                   GRGFAARAACTPSGRLCARENGVRCVFSSP"
FT   gene            complement(650262..652325)
FT                   /locus_tag="TPASS_0598"
FT   CDS_pept        complement(650262..652325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71017"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKU3"
FT                   /protein_id="ACD71017.1"
FT                   /translation="MGCCTLGLFADSVEKRAAKDVFTEPARFYPSQKSTLESARSDTSE
FT                   SENASSSVPSHSQQELAPDSAAPARNSVLSPAPPERREKQGAAVHGAEVTRAGAVSPRF
FT                   VGGLTKILAASDHTFFAAGNDGFLTQYTYPDYKPDTWQITPVSIKHCAVHPDRARIAVY
FT                   ETDGRNYHRVSVWNWRTKEILFAKRFTASVVSLSWIVQGSFLSVGTASREGVTVLDGSG
FT                   NTVSLFSEEPGVVLLTASGPRLVLSYAESGRLTYVDYSKKTTVKRLLTEKNLLSPMLIH
FT                   NGAHLVGYRDQRVYVIQSSSGAVLTEYPARSACFAHTFSDSLPVWIEPAELKYHWRIRK
FT                   AAQRSADFMLPDNARITSACSVRTRVIVGTDRGILYELQQGDDRRVTIRALNGERQIYA
FT                   SDVHGADEGAYFLADGSLYHSMASGGPYRVLVRGVKGTRFLPYRDGFIVWSAGKETEFL
FT                   HCAQKTSQHRMIYRARSTVSGVSVYGRMLVITEPFSGVSVVDIERGIRVFFHKAIGMQD
FT                   SLLITDDVIVATQSGLQPLVLLHMRTGETYTHAVGGDFAFGVRAHDTQHVYFFSLDTNA
FT                   GTTDLIHLRLQLQQPTESVVRRILSYKDEDIDAHMVMRRSLLVTNLGKGALVGHRVQQS
FT                   QVYRMSRAYALPKVAAITSNGVVSVNYDGSVSWYEGDGATLKATEFIRTEDF"
FT   gene            complement(652362..653018)
FT                   /locus_tag="TPASS_0599"
FT   CDS_pept        complement(652362..653018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71018"
FT                   /db_xref="InterPro:IPR025682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKX6"
FT                   /protein_id="ACD71018.1"
FT                   /translation="MMQLRCACERVFDIEHETVISLDEHPEFVARIQQGDFLSYQCPAC
FT                   GARIRAEIKTEFVWHAKNVHLLLVPERERLRCLAFCAGMHMSDGDSADFCEPFVLREHQ
FT                   TPVIGYAELADRVAILAWDLNPEIVEAVKFFVLEGAPHLGDKRVSCFFERCVGDTGSRV
FT                   MELHVYGIREQQTAIMPVPMNVYERVERERGKQAELFEALYVGAYLSYKNVFTDA"
FT   gene            complement(653025..654377)
FT                   /locus_tag="TPASS_0600"
FT   CDS_pept        complement(653025..654377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0600"
FT                   /product="possible zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71019"
FT                   /db_xref="GOA:A0A0H3BJ87"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ87"
FT                   /protein_id="ACD71019.1"
FT                   /translation="MIKIIIGVVVLGIVVLFHELGHFVAALWCRVEVLSFSVGMGPVLF
FT                   RKKFGKTEYRLSMLPLGGYCGMKGEQAFQTALDQKLSRIPVEPGSLYAVGPLKRMGIAF
FT                   AGPLANVLMAVMVLALVSALGSRVHTFGNRISPVYVYDSSDNSPARRVGLQDGDTILRI
FT                   GDQPIRYFSDIQKIVSQHAQRALPFVIERRGQLMHVTITPDRDAHTGMGRVGIYHYVPL
FT                   VVAAVDAHGAASRAGLEPEDKILAVAGRRVQHAVQLLALLKEFRKKSVVLTVLRSGKRR
FT                   YHTIALVRTENGAIDVGIEWKAHTVVIPGTSFFASVRAGIAETLRMCVLTVKGIGMLFR
FT                   GLQFQQAISGPLRITHVIGDVAQHGFQESFLTGLSQLCEFVALVCVSLFIMNLLPIPIL
FT                   DGGLILFACVELFMQRSIHPRVLYYLQFVGFAFVALIFLCAFWNDVNFLFH"
FT   gene            complement(654374..655525)
FT                   /gene="dxr"
FT                   /locus_tag="TPASS_0601"
FT   CDS_pept        complement(654374..655525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="TPASS_0601"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71020"
FT                   /db_xref="GOA:A0A0H3BIR3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIR3"
FT                   /protein_id="ACD71020.1"
FT                   /translation="MFWDRCSMSVRRVVVLGITGSIGAAALKLLRRFPDRFLLVGASGH
FT                   RQTEYARALAREFSLSDITMTGSCSEQEGRARIKRLLSSCEAEVVVNGIAGAAGLFASL
FT                   EVLKTRCTLALANKESVVLAASLLHAAARESGATIVPVDSEHAAIFQLIAAHGAHAVAQ
FT                   VVLTASGGPFRTFSKECLAHVTVEDALQHPTWRMGKKISVDSATLANKALEVIEAVQFF
FT                   RIPVDRVTVVVHPQSIVHALVQCHSGETYAQLSVPDMASPLLYALLYPDAPPAYQTPLD
FT                   FTSGLSLHFEPPRVDDFPLLRMGFDVARAQRAYPIAFNAANEEAVRAFLQRNIGFLDIA
FT                   HVTAQALQEDWRAIPQTFEEVMACDTRARMCARTCIAQRWRER"
FT   gene            complement(655501..656364)
FT                   /gene="cdsA"
FT                   /locus_tag="TPASS_0602"
FT   CDS_pept        complement(655501..656364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="TPASS_0602"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71021"
FT                   /db_xref="GOA:A0A0H3BJJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJJ1"
FT                   /protein_id="ACD71021.1"
FT                   /translation="MSAEIKRLLIFFFGVPTILMLVYAAPHAHFLAFHLVIFGSVMGAV
FT                   WEMHAMVSRRMCTYPLVLLIPFSLVLPLLGYAALWQPARGAESVLFIGALGTLLMSVFF
FT                   TELVYSFSASFENALERMASALLLVLYPGIFSLFFSLITRWRHAEIALVIFFLMVFTCD
FT                   SCAWFCGTLWGVNNRGIIPASPKKSIAGFIGGFAGSVGAGCFGSLVFGSRVTLSLGMLM
FT                   GVGALVGLTAIVGDLVESVMKRSAQVKDSGFFTPGRGGIMDNLDSLAPSLGTFYIACEC
FT                   FGIAAV"
FT   gene            complement(656361..657047)
FT                   /locus_tag="TPASS_0603"
FT   CDS_pept        complement(656361..657047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71022"
FT                   /db_xref="GOA:A0A0H3BKU8"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKU8"
FT                   /protein_id="ACD71022.1"
FT                   /translation="MQHVAIIMDGNGRWAERRGLRRSAGHRRGLQTAREIVAALCAIRV
FT                   PFVTLYVFSTENWKRSAHEVHFLMNLIRWYLKKEMSFYVEHAIRVVHLGCAQTLPPDVR
FT                   SQIEYVVERTRSHRGTTVALAINYGGKDEILRAVKKVLCSTSCPDGELLTEEAFGACLD
FT                   APQLPSVDFLIRTGGQQRMSNFLLWQSAYAEFYFTDILWPDFRVEDMLRALDEYRLRTR
FT                   TFGGLE"
FT   gene            complement(657053..657604)
FT                   /locus_tag="TPASS_0604"
FT   CDS_pept        complement(657053..657604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0604"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71023"
FT                   /db_xref="GOA:B2S3J4"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3J4"
FT                   /protein_id="ACD71023.1"
FT                   /translation="MGIAECYEQKMKKSLSALQEGFNTLRTERATAHLLDQITVDYYQQ
FT                   PTALSQVATVSVPEARLIIIQPWDKTLLADIERAILKSKLSLNPSNDGKVIRLVIPPLT
FT                   QERRKELVRQARALAEQARVAIRNIRREGIEEAKRGHKEGLLSEDALKAAEEAFQKATD
FT                   ASVADVARYLAEKEKDILEG"
FT   gene            complement(657708..658580)
FT                   /gene="tsf"
FT                   /locus_tag="TPASS_0605"
FT   CDS_pept        complement(657708..658580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="TPASS_0605"
FT                   /product="translation elongation factor TS"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71024"
FT                   /db_xref="GOA:B2S3J5"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3J5"
FT                   /protein_id="ACD71024.1"
FT                   /translation="MEIAARDVKSLRDKTGAGMMECKRALQECAGDALCAEKYLKERGL
FT                   AAIENRRGRATAEGVIVIKARHAEGAACGASAVAMVELVCETDFVAKNAEFIALAERIA
FT                   QAVLEHAYTEVNQVLRDMVVDLATRVRENMSLTRLALLRAGSAGAGQYLSHYVHPDKKT
FT                   GVVLSFSSDAPDVFLRSDVRAFAYDCCLHAAAYTPRYVRAEDVPAEYVREQREVFQAHV
FT                   ASLQKPAHVKESIVQGKLEKHLAEICFLKQPFVKDDKLSVEKKMAEVGARAGGALRFTQ
FT                   ALIYQLGVQ"
FT   gene            complement(658671..659546)
FT                   /gene="rpsB"
FT                   /locus_tag="TPASS_0606"
FT   CDS_pept        complement(658671..659546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="TPASS_0606"
FT                   /product="ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71025"
FT                   /db_xref="GOA:B2S3J6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3J6"
FT                   /protein_id="ACD71025.1"
FT                   /translation="MAVVTIKNLLESGVHFGHQVRRWDPRMKKYIFAERNGIHIIDLQK
FT                   TITAIREAYDMVRRTVSSGKSVLFVGTKKQSQQTIAKEAQRCGMFYVTNRWLGGMLTNF
FT                   STIRKSLSRLKKIERMEIDGTFEHLSKKEVASLRKEHAKLEKNLGGIKEMKELPGVVFI
FT                   IDTRKETIAIREARRVGIPIVAVVDTNCNPEGIDYPIPGNDDAIRAISLFTQLIANAVM
FT                   EAGNEHGLKIIENLQDEESGDELDESVSLHEEGREITDYENYTPPEEREYSVNDEGDVF
FT                   DEDESLYEGR"
FT   gene            complement(659515..659661)
FT                   /locus_tag="TPASS_0607"
FT   CDS_pept        complement(659515..659661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKY1"
FT                   /protein_id="ACD71026.1"
FT                   /translation="MTVCEGTRFSVLSRISPARVRVVKERRMRASALSVEEWYGSGDYQ
FT                   KSA"
FT   gene            659744..659817
FT                   /locus_tag="TPASS_t0030"
FT   tRNA            659744..659817
FT                   /locus_tag="TPASS_t0030"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg3; codon recognized: CGG"
FT   gene            complement(659911..660801)
FT                   /locus_tag="TPASS_0608"
FT   CDS_pept        complement(659911..660801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71027"
FT                   /db_xref="GOA:A0A0H3BJ91"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ91"
FT                   /protein_id="ACD71027.1"
FT                   /translation="MADPSACVFRSLRIPGHKPLTWCAKCSTMCPRVPCGSVSVPCAFC
FT                   TISFRRKCPMQQRFFLLGVCAFAFGVPVFPQQGTDPSVGAQASAGDGGMMTVEQAYLNS
FT                   AEGVVIKEMVESRGHDSKVLALQYIQEALEGGRGSDDLQEALSRLATAGLFRVIREQGR
FT                   VINDFPDIRLRACELLARLPSARTKDALIQVMCADREPSVVRAAVKSLGEVGINEQDET
FT                   TATIGWISRKFSAINPTGSLALEILNTYERLAPTVRDRRAVVESIMDIAADGRYAAAVR
FT                   ARALEVVKGVVSGGK"
FT   gene            661119..662690
FT                   /gene="asnS"
FT                   /locus_tag="TPASS_0609"
FT   CDS_pept        661119..662690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="TPASS_0609"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71028"
FT                   /db_xref="GOA:B2S3J9"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3J9"
FT                   /protein_id="ACD71028.1"
FT                   /translation="MRAMHPLLKEILTHPPSGQHECVHGWVRSKRETKRAVFISLSDGS
FT                   CPDTLQVTVPLPECSASLSSGAQAEQIPNVRDAVLQGETLAQTLKRVTTGACIRAEGAL
FT                   VPSPGAGQALELRACNLTVLGEAPAETYPLQKKSHSFEFLRAHAHLRARTSTFAACARV
FT                   RSALAGAVHRFFSERHFQYVHTPIITASDCEGAGELFRVTTFDPVRIAREAHAAGAAGN
FT                   PYALTYADDFFGKAARLTVSGQLQGEAYALALTRIYTFGPTFRAENSNTSRHLSEFWMV
FT                   EPEIAFARITDCMDVAEEFLAYLLRAALKDCAQDIAFLDERAAQHARSARGDTPLAARS
FT                   TARTPPVRTPGQLTRMLEDVARAPATRLTYTEAIKLLENSGRSFEFPVRWGCDLQSEHE
FT                   CFLTEEVFHGPVIVYDYPKEIKAFYMKLNADGTTVRSMDLLVPGLGEIMGGSEREEQFE
FT                   VLCARIRASGFDPHDYRWYTDLRRFGTAPHAGFGLGFERLLQYVTGLGNIRDVIPFPRT
FT                   PRTADF"
FT   gene            662700..664781
FT                   /gene="tprH"
FT                   /locus_tag="TPASS_0610"
FT   CDS_pept        662700..664781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprH"
FT                   /locus_tag="TPASS_0610"
FT                   /product="protein TprH"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71029"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIR8"
FT                   /protein_id="ACD71029.1"
FT                   /translation="MKGVRCPCLYACRVLYSQSKIRRRRTLLSPSAAVRSSCHDPPGHS
FT                   AGRRVRSVGTWALLFMSSAAGLCAETRLHTLASTPRISGFARLQWGITLPYDPAVGPPP
FT                   PVPPRENGDGDDSDVVNVQIQGNGAQGQEVEESEKEKARIRQITHGFRSTTHLCVTVPL
FT                   FLKSDRIRRAGTLSDGGLWTEISIKDLEVNFQTKKPGEPFTLVTEETAIEATLHCFGAY
FT                   MTIGTAPLFRANFAQLWKPFLADLYKEEEVRFAPGFDGIGGRLGYRAQNVGSSGVSLDI
FT                   CFLSFASNGSWDAPAPAPAPPGGAAEEALHSKYGFGADATLSYAPWKRELVRAEVAASA
FT                   TLGKGYKRVSHKQKRHYRQNDVLWNAGARITLTPLSDFKVVLALDMGNHYAGRKTLDYL
FT                   APILIDMEKTKVTPGGPVAYAIAQRVLQLPEYAQKLDSVKNGMSANGSSVRDIATKIVQ
FT                   AEQTNPTVSSNPLLAALLTVLWQQALDTYALDALLTLQWRWFACGVYVATAPASVFGAM
FT                   VFPTYGSTHTDGGGFLRVETKAGDAYTHLIDGLEAGMDVRCYIPLTHGLYIDNGKGYYV
FT                   SPMGVWKLPDTHINLPVMGKVWARYLIPLGETAWLKPSLAVYGTTNRFNYNLKTENLVH
FT                   ERCVQYQVGLTLSPIEKVTLHAQWEQGQLEPTPYMVITETVTSRRYFGTFVCGMTINW"
FT   gene            664923..665702
FT                   /locus_tag="TPASS_0611"
FT   CDS_pept        664923..665702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0611"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71030"
FT                   /db_xref="GOA:A0A0H3BJJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJJ7"
FT                   /protein_id="ACD71030.1"
FT                   /translation="MPTLLDIRDLCMSIADRPILKSLNLTLNTGEVHAVMGPNGAGKST
FT                   LAGTIVGNPHCTIERGEIYFQGQCINDVPVYERARRGIFLSFQTPEEVPGLSVEEFLRA
FT                   AKEAVLGTKVSVLDFHTQLRAKLARLRISEAYASRGLNVGFSGGEKKKNEILQLAVLEP
FT                   KLAILDETDSGLDVDATRIVFEGIDDIRTPDMGFLIITHHREVLEYIKPDVVHILVDGT
FT                   IVKTGDVSLVHYVVEHGYADFATPRAGEQGGTPVSPE"
FT   gene            665783..667222
FT                   /locus_tag="TPASS_0612"
FT   CDS_pept        665783..667222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71031"
FT                   /db_xref="GOA:A0A0H3BKV3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKV3"
FT                   /protein_id="ACD71031.1"
FT                   /translation="MNTQQQRQLLQPRRRTYVSDIKRGIYDVKDAVTYTYSTGKGLNAQ
FT                   VVEKISRRKREPQWMLDLRLRSLRYFMKRPMPEWGADISDLDIQEIVHYIVSDFKPIAE
FT                   SWDDVPEEIKKTFDRLGIPEAERRSLAGVGAQYDSEVVYHNLRADLEQQGVVYLDMESA
FT                   VHKHEDIVRAHFMHLIKPNEHKFAALHGAVWSGGSFVYVPKGVQVDLPLQSYFRLNANQ
FT                   SGQFEHTLIIVDEGASLHFIEGCSAPKYYKNALHAGAVELYVKKNARLRYSTIENWSRN
FT                   LYNLNTKRAIVDEDGVIEWISGSFGSRVTMLYPMSILRGDRSRSEFTGITFASAGQYLD
FT                   TGTKTVHLGRNTVSEVHARSISKNGGTANYRGLLSIGPKADGAKAVAECESLMLDNQSH
FT                   TDTIPIIDVRTDNVDIGHEAKIGRISDRVVFYLMQRGLDEQTAISLIVRGFVEPVSKEL
FT                   PLEYAVELNNLISIELEGAIG"
FT   gene            667249..668397
FT                   /locus_tag="TPASS_0613"
FT   CDS_pept        667249..668397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71032"
FT                   /db_xref="GOA:A0A0H3BKY4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKY4"
FT                   /protein_id="ACD71032.1"
FT                   /translation="MKKREFFKRLGYHAQDVASQPFSRTQVTSSSALVRSSSIEHFLCT
FT                   EPERAARAFDFRTRDRQRHCGLGEAYVQEVKEKRNAGVYLSVPRTSETVHVLIRFTMDT
FT                   HNRVLYDQTFLDIQEGARVKVLVCVDAQGYTPQDAPALVGPQALERAPFRNGLVSVQVG
FT                   RGASVELIKVQNTHPTAVNFETVHLHAQESAQVRCYDVQIGAQISGVSNSAFLRDEWAR
FT                   VEIHPLYFIDKARRMDLEHNLIVEGKNSHAHICACGVVKDGARKTFRGNIFLHRGCSHS
FT                   VARFSDRTILLDRTAVGVSIPTIFCDEDDVVGEHAASFETIGSDVLYYLMSRGLDEYGA
FT                   KRLIIEAAFKPVFALIDDAHIRETLVRNFDESLDRAHRKRKA"
FT   gene            668394..669608
FT                   /gene="nifS1"
FT                   /locus_tag="TPASS_0614"
FT   CDS_pept        668394..669608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS1"
FT                   /locus_tag="TPASS_0614"
FT                   /product="nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71033"
FT                   /db_xref="GOA:A0A0H3BJ96"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJ96"
FT                   /protein_id="ACD71033.1"
FT                   /translation="MSGPNYKADFPLLLRSPRVHYLDSAATTQRPAPVLERVMHYHTHL
FT                   NGNAGRGSHELAVESALLIENTRKKTAQFINAAPTHDIVFTKSCTESLNIIAHCYALPR
FT                   LRAGDEIVLAISNHHANIVPWQHVCRCTGATIQWLYPDAEGNLDIQEAQKKIRACTKIV
FT                   SFSAVVNATGAVNPAQELTALAHQVGAVVVIDGAQAMVHGVPNVADLGCDFFVFSGHKM
FT                   FSLFGVGVLCAPHTLLESMPPFLYGGGMVDFVTEQESVFKGAPHKYEGGSANTAAVVSL
FT                   CAAIEYCESLESSAVRASVHALDAALLARLEELPFLETYHARARERLGIIAFNVKNVHS
FT                   HDTAHILGEEGVMVRSGDHCSKPFMTHLSIQSCCRASFCIYNTMEDVEALTRALHAVGR
FT                   IFQCS"
FT   gene            669659..670102
FT                   /gene="nifU"
FT                   /locus_tag="TPASS_0615"
FT   CDS_pept        669659..670102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="TPASS_0615"
FT                   /product="nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71034"
FT                   /db_xref="GOA:A0A0H3BIS4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIS4"
FT                   /protein_id="ACD71034.1"
FT                   /translation="MNAEAIYRQVLLEYARKQEHRRVLEGPVGIERGHNPSCGDDLTLL
FT                   IKREGDRIADVAFLGTGCAVSTASTNILIELIKGASVAQAQKTVALFFHMMAQQCLTDQ
FT                   ERAHLQDACILACFASMPARIKCATLSWHNADILLHHKKDTDA"
FT   gene            670123..670887
FT                   /gene="rpiA"
FT                   /locus_tag="TPASS_0616"
FT   CDS_pept        670123..670887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="TPASS_0616"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71035"
FT                   /db_xref="GOA:B2S3K6"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3K6"
FT                   /protein_id="ACD71035.1"
FT                   /translation="MHERNTTTNTPLDVTAQKLLVAQRSVDTLVQEGVLHAHMSIGLGT
FT                   GSTAMPAVKRIADHLARGTLSDIAAVPTSFQTALICERYNIPLFSLSSKRIGGKLDVTI
FT                   DGADEIDTQNFVIKGGGAALLQEKIAAYNSAHFVIIVDETKVVETLGTRAALPIEVVPE
FT                   ARMSVMRTLQDWGLSVHIREAVRKKGPVVTDHGNFILDARWQSLPTRTPQDMERALNAL
FT                   PGVIENGLFTERTVRVFVAHADGSVEERSASF"
FT   gene            complement(670914..671192)
FT                   /locus_tag="TPASS_0617"
FT   CDS_pept        complement(670914..671192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71036"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK2"
FT                   /protein_id="ACD71036.1"
FT                   /translation="MCSFEHGGWYVPKTVLSLLRRRKCQDARAESEELGITGICQNYAV
FT                   PVQLGVQHYFGAHWGIDATATVSFGVDTKLAKFRIPYTLRVGPVFRT"
FT   gene            complement(671288..671647)
FT                   /locus_tag="TPASS_0618"
FT   CDS_pept        complement(671288..671647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71037"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKV7"
FT                   /protein_id="ACD71037.1"
FT                   /translation="MWRKCLGKVVLLGCALPCVAARISVSPKLGAYGDARGGPDLWGLC
FT                   IKATDAEEVSGDPDDTEMEYLPPRYAPETPLVGLDVAFRAENGFLLQLTVDAALTRLMF
FT                   RGQCLAGYSFRPGGG"
FT   gene            complement(671703..672515)
FT                   /locus_tag="TPASS_0619"
FT   CDS_pept        complement(671703..672515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71038"
FT                   /db_xref="InterPro:IPR024471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKZ1"
FT                   /protein_id="ACD71038.1"
FT                   /translation="MRGCRVGQRTGTVGVRVFPVGLCALSLQARDCRGMCGKRLGKVMV
FT                   LGCMLPGVAARVSLSPKLGVYGDARGGSDLWGICIQAPTMPDTENQAPPRYAPETPLVG
FT                   LDVAFRAENGFLLQLTVDAALTRLMFCGRCLAGYSFRPGEGSTHLSVAAGFECTALIYD
FT                   SQHFLSVLGQGLLQPSSSSYSAGNWHRPRSLLGVLTCTAKEVGAIHEESRIKGVCQNYA
FT                   VPVQLGVQHYFGAHWGIDATATVSFGIDTKLAKFRIPYTLRVGPVFRT"
FT   gene            complement(672512..674341)
FT                   /gene="tprI"
FT                   /locus_tag="TPASS_0620"
FT   CDS_pept        complement(672512..674341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprI"
FT                   /locus_tag="TPASS_0620"
FT                   /product="protein TprI"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71039"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJA0"
FT                   /protein_id="ACD71039.1"
FT                   /translation="MGRQVMQAGVLAGMVCAASGYAGVLTPQVSGTAQLQWGIAFQKNP
FT                   RTGPGKHTHGFRTTNSLTISLPLVSKHTHTRRGEARSGVWAQLQLKDLAVELASSKSST
FT                   ALSFTKXTASFQATLHCYGAYLTVGTSPSCVVNFAQLWKPFVTRAYSEKDTRYAPGFSG
FT                   SGAKLGYQAHNVGNSGVDVDIGFLSFLSNGAWDSTDTTHSKYGFGADATLSYGVDRQRL
FT                   LTLELAGNATLDQNYVKGTEDSTNENKTALLWGVGGRLTLEPGAGFRFSFALDAGNQHQ
FT                   DPADAGNRLLATGSSREKFDSAFDALRVEQYRVKDKYLEFLLGQMAESSILERVGLALT
FT                   LQDGTLVSTLTKVATDSGDRFIQMALVKLLPQRAQAEQRLQEIVAPSQSDIVLIMLLTW
FT                   LERARLDRFNADALLTAQWTYVSAGLYGATAGTNVFGKRVLPALRSWHFDFAGFLKLET
FT                   KSGDPYTHLLTGLNAGVEARVYIPLTYIRYRNNGGYELNGAVPPGTINMPILGKAWCSY
FT                   RIPLGSHAWLTPHTSVLGTTNRFNVINPAYTLLNERALQYQVGLTFSPFEKVELSAQWE
FT                   QGVLADAPYMGIAESMWSERYFGTFICGVKVVW"
FT   gene            complement(674399..676675)
FT                   /gene="tprJ"
FT                   /locus_tag="TPASS_0621"
FT   CDS_pept        complement(674399..676675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tprJ"
FT                   /locus_tag="TPASS_0621"
FT                   /product="protein TprJ"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71040"
FT                   /db_xref="InterPro:IPR003857"
FT                   /db_xref="InterPro:IPR003872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIT0"
FT                   /protein_id="ACD71040.1"
FT                   /translation="MGCMRWGSVLCVVVGVGASGGVLGQEFSPKLTGSATLEWGISYGK
FT                   GVGSHGQAPGAVMGTGPYNLKHGFRTTNTVGVSFPLVMRTTHTRRGQHPALYAELKVAD
FT                   LQADLSQGKAGFAVKRKGKVEATLHCYGAYLTIGKNPTFLTNFARLWKPWVTAQYQEDA
FT                   VQYAPGFGGLGGKVGYRAQDIGGSGVSLDVGFLSFASNGAWDSTDPTHSKYGFGADLKL
FT                   MYARAGHPLCTVELASNVTLEDGYLIGAQKDANNQNKDKLLWNVGGRLTLEPGAGFRFS
FT                   FALDAGNQHQSAQDFQNRTQRAQSELTALSNNLFQGESQKQEAWVTQVVQQATQTVTAG
FT                   VRSALESRGTTYINALEAVQPNPAKPTGKVVQNLHTPQGSPPNLPPLPALPAFSLMGQV
FT                   LLQYDAEQVVKGFEQVQTQIVTEINQKVQAAVAKNNANMQAVGGSLGDTARMVGEALIK
FT                   QQLSRKQNSILTMVSVQDEVKQDLADLVPMMRTEITAFFASVQQHITEEVKKKTDALNA
FT                   GQQIRQAIQNLRASAWRAFLMGVSAVCLYLDTYNVAFDALFTAQWKWLSSGIYFATAPA
FT                   NVFGTRVLDNTIASCGDFAGFLKLETKSGDPYTHLLTGLDAGVETRVYIPLTHDLYKNN
FT                   NGNPLPSGGSSGHIGLPVVGKAWCSYRIPVQDYGWVKPSVTVHASTNRAHLNAPAAGGA
FT                   VGATYLTKEYCAQLRAGISASLIEKTVFSLDWEQGMLSDVPYLLVSECLTQGIGRIVCG
FT                   VTLSW"
FT   gene            complement(676735..678516)
FT                   /locus_tag="TPASS_0622"
FT   CDS_pept        complement(676735..678516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71041"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJK7"
FT                   /protein_id="ACD71041.1"
FT                   /translation="MGALTKSIDRAIGVSVGFVLIPVFLCCRSSSKVVPTRAGTDPVSS
FT                   ASQAPEVAAHPVRGTALDVPDRRAIRTKLMDPKILFLIETASPASLREAAACIQRDPAG
FT                   LTPHNRLYLRVCAALMQLVYPQEAVSWHVPLYNTAHPYLTALDDVEKGTYPLIPGEPDF
FT                   FSDIIPPLTLLKKRLPDEVHADCRERLTRARTQAPHSLLPFLLFGYLHEQHGELSEAES
FT                   AYRSAWEKDASCYPAGICYARMLVQRGETALALPIARLLLHRFPKDRAVQLLQAQIHSA
FT                   RQEWSAAQPYVAALLRQQPEDNAALLLHIRILVAQREYQKAHASLDSFAERDSSDKTYL
FT                   LLRAQVAKEWSKNDASAHDFLQQAYRLYPRDVQVLLACAQHCFETGHSLAQKNMRSFIA
FT                   LVLRADAHNAQALRLLTQYELAQGNWEQAVSRAERLNTAYPSEAHQELLIRAYSGSGRA
FT                   QEAISLARRLYHSAQPPSETVIVLYLDTLYEARHYREIRAVIAARSASARGTLRSIFSY
FT                   YEALLSVHEEERLSLLRASLLSDPRNGRTLFALYEWYRKKKDFRKAQYYLHQVIALDPN
FT                   NAQHRALSKQLDTLIGQ"
FT   gene            677933..680272
FT                   /gene="dniR"
FT                   /locus_tag="TPASS_0623"
FT   CDS_pept        677933..680272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dniR"
FT                   /locus_tag="TPASS_0623"
FT                   /product="membrane-bound lytic murein transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71042"
FT                   /db_xref="GOA:A0A0H3BKW2"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKW2"
FT                   /protein_id="ACD71042.1"
FT                   /translation="MRARVRRSRQSACTSSGRRFFNRVSGGMISEKKSGSPGMSGYVPF
FT                   STSSSAVRYGCAVLYSGTCQETASCGYTSCISAAHTRRYSRLCGVNPAGSRCMHAAASR
FT                   NEAGEAVSIKKSIFGSISFVRIARRSGTSSAVPRTGCAATSGAWDAEETGSVPARVGTT
FT                   FEELRQQRKTGISTKPTLTPMARSMLLVSAPIETRFYLPAWQSCHLHKTPVVTVPTTYA
FT                   YPAHRRFFSLYAVFNAHGASLVLPTQDMLGWLPPRAKRAYRRLTVFLREIITARACSLF
FT                   LFLLRCFPAGPCARARRLSFLLFLCGAAACPPLWGAYAAHHALRAQSVPDTLIQRALVL
FT                   GPLVHPLYPPMQSFKEQYRSARYREYLSVVMQRSAPYRPFIEKLLRDAHLPVELLFLPV
FT                   VESGFLERAVSKSGAVGIWQFMRNSIAGSAMRVSDWVDERRDPWKASVAAVKKLQWNYT
FT                   QLRDWPLALAAYNCGLGAIKRAIAQAGTADFWHLSERGFLRDETVRYVPKFLAVAEVLS
FT                   RSHEHGIAWGAAHTPEETTTVTVSRAVDLNLLAQAAGMDAQLLHTLNPALRYSITPPNA
FT                   AYTLRVPSTHAQAVQAVLNRPGAVLVHHTLHTIRSGDTLYALARRYGLGVDTLKAHNRA
FT                   HSATHLKIGQKLIIPTIRTGQTRRAPLRGAGTRAPGVMDQKEHAVPEVSALPSSSMTPP
FT                   TPGGADTRAGADAPAPPSVPPPPESTAARATPAAPFVGKHVVQQGDTLWSLAKRYGVSV
FT                   ENLAEENNLAVDATLSLGMILKTPRR"
FT   gene            680276..681706
FT                   /locus_tag="TPASS_0624"
FT   CDS_pept        680276..681706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71043"
FT                   /db_xref="GOA:A0A0H3BKZ5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKZ5"
FT                   /protein_id="ACD71043.1"
FT                   /translation="MGVSCLTRAASFSNQCRFPFGALSLVWTHASAPHVVRSSARRFIL
FT                   LLLFVLFSHAPSGAQTQDAVHTDAVQDWKNGTINAQLTLDLARARMRLPADRTAASQFL
FT                   RYKAPAQLKDVYLSVLVDSQNRVGDCLAHEKIRLADITALVDAGHHAVTTLSPSVRSLQ
FT                   LSHQTPLTALARLFVTHETAYVPAIPPTSAVSRPYTGILIDARGSLPVHGEYVSEPLSA
FT                   CLFPKIWSTDMDLIYEKNMVHPDRAKAWGVVRYGSVWDEKMYRDRIGTTPLKIIARGVF
FT                   GQQRTDPIIASKDAAQILARPENLRLLAEGNVIILCDEAALRVHVPYPLVDEHFYFAYH
FT                   DVKRFLTDERSPGVGVRSGINTLKITVYDVRFVANSPEILASEKDRVDVIATALKKMGP
FT                   YTRFLIEGHTADLHRPQEEAALSVARAQRMAQELSRRGIEMTRITTAGHGATKPIAPSD
FT                   THANKAKNRRVEITILRD"
FT   gene            681706..682458
FT                   /locus_tag="TPASS_0625"
FT   CDS_pept        681706..682458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71044"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJA6"
FT                   /protein_id="ACD71044.1"
FT                   /translation="MHVPRSILRAGYFSQVKRTCDDVPMAFCSQAQLKGRSTMIKPRAY
FT                   ALLGVFFLYACASTPREEDVPEKFTPADLMLRAQESYDAGNITWARFYYQTVLDRFPNN
FT                   ESAVISAEFELAHILVKQKSWQDAYNRLMYILKKYEAAGSARLPPAYYKLTLIDLSRVK
FT                   PHLNLETANTKATEYQKNYQEELKQRQELRQKLLQERTQKMLEALHQEETPEQDARDTA
FT                   KKKTDQEEHTMRKANAPKTKASGEAPTP"
FT   gene            682455..683630
FT                   /locus_tag="TPASS_0626"
FT   CDS_pept        682455..683630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0626"
FT                   /product="possible exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71045"
FT                   /db_xref="GOA:A0A0H3BIT6"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIT6"
FT                   /protein_id="ACD71045.1"
FT                   /translation="MKILHTADLHLGKTLHEVSLFASQKKMLGDLCTLLAQDNYAALII
FT                   AGDIYDRCVPSAESVSLFSSFLQNIKRSMPRLPIYLIPGNHDSAQRLSFAQELLKQQGV
FT                   FIAQDPEESTRPHLLCHEGETVQLFLLPFLHAGAFSYLDEENTTCLIHTQSELLQEASR
FT                   RLQRAVSLDTPSILVAHLFTQKGISCESERPFVGNAVYADPHWFDFFTYVALGHLHKCQ
FT                   KITERMYYSGSPLPYSFDEANTQKVALSVEIHCNTKGFPIHVTPLPLEPLIPLRTIRDS
FT                   FHALYTGDRYLLYQRDFLEITLTDPALVHNPIGLLKPRYPGLLSIKQENAFAFDIPPPY
FT                   SSNEGIAPCTHHSLRTHFDVFMHEVSPTPDDREKGALFQELFDEMQQEFSS"
FT   gene            683627..686770
FT                   /gene="sbcC"
FT                   /locus_tag="TPASS_0627"
FT   CDS_pept        683627..686770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="TPASS_0627"
FT                   /product="exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71046"
FT                   /db_xref="GOA:A0A0H3BJL2"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJL2"
FT                   /protein_id="ACD71046.1"
FT                   /translation="MKPMRLTLHNIGPFVGTHTVDFTALGPIFLVCGKTGSGKTTLFDA
FT                   IAYALYGKPLGTRAEVIRSLRSHYAAPSEAAFATLEFSLGTKIYRVHRTLTCTLSHRKT
FT                   EQPEQLYLEQKKGHGWERIACAHKSETECVIHDLLKLNSKEFERVVMLPQGECAQFLKA
FT                   NSKEKKETLMNLFPVDQYTALMERAKKKSLHAKAVLETLRSQLETLCAECMPDTYHERK
FT                   QTLEAELQHARDALQQTRISHAYYTQKREALEAQLKKQQLCKELRARIETYRAQEPVHA
FT                   ETQKRIDRARKAAPLAAHIKHVTQCEQDAQRIHAEIQEKMRSREQLLMKRAAHVAQQSS
FT                   IEEQRRLLQTLHSACIHIEDAHDVATSIRDISCQAHTLTQHIHTLAQQKTTLTQQEQSL
FT                   CKELDILQREAGTIDTRTSAFNDLQIQLAHAKKTQELSQRYAELCAAHATCTAQCEKLE
FT                   KIHAQKSAYSTRAREQLLQTKEQIHLQETRTHAVVLARLLEHQEPCPVCGSCIHPNPAR
FT                   QDIDNLEPLTRRMQRIEQTYAQLETSEKDVYHILTSERERRASYSAQMQEIQHSFSILT
FT                   SCDTRSSCDIPNVQKITVRVLDLTEKLSRAKDMLACAQHALLRKKQPEQDLQDVRAHLQ
FT                   QCSQELAKKETALHALQETLTQQRVRIHALSIRLPKELLASNLLAPQKMQHEKESVAYW
FT                   KEMLAHCQTLMRELHTHIEEYDREFNEIENASSALGADIAAREDALNHVQKEYMHLART
FT                   VCCARTEAHFNNNEEVTAALMTDAELSHAAAEIQFFNELRAADTHLLKTLEAEIGTEIP
FT                   SDLDELNAQCHTLVKDEENFLSRIEILSATLHTLTHQYLKYEECSKQLAQKTQESAKLI
FT                   TLSDELNGINQKKIQFDAWALISFLHEITAYANIRLQKMSEGRYHLRVADSHVNARGYQ
FT                   GLALLVADAYTGSVRPSATLSGGETFMASISLALGLADSIQTRSGGIVLDSLFIDEGFG
FT                   SLDEASLDKAIGILDEIREGSRMIGIISHVHELRTRIPHKILIKKTNAGSHVMQGDAE"
FT   gene            686767..688248
FT                   /locus_tag="TPASS_0628"
FT   CDS_pept        686767..688248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71047"
FT                   /db_xref="GOA:A0A0H3BKW7"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKW7"
FT                   /protein_id="ACD71047.1"
FT                   /translation="MKTSALFLDFYELTMAQGYFFHKPHECAVFEVFFRKHPFAGGYSI
FT                   FAGLDPLLTAIEQFRFSGEDIDYLRTLHLFHDDFLSYLASFRFSGDIHALEEGSVIFPH
FT                   EPIIRVHARLVEALLLEGLILNTINFQSLIATKTARMWRASGEGVLMEFGLRRAQGYDG
FT                   ALSATRAAAIGGATGTSNTLAAKLYGIRPMGTMAHAWVMSFDSEEEAFERYAALYGSAS
FT                   VFLIDTYHTLESGIQNAIAIGTRLKAAGKSFGVRLDSGDMQYLSVQVRAALDAAGLPEA
FT                   RIAVSNELDETIIESLVLSGAPIDAWGVGTHLVTGGADSAFTGVYKMSARATTQPAHTQ
FT                   HGHAASQRLPHWDDAHWLPVMKVSDNPAKTTTPGIKQVWRLYDAAGQYKADVIGLADEV
FT                   IEPQVAQRYIHPFYNLQSFTFAAHQVEPLLRTVMQAGNRLRAGESVQEIHARMRAQLQR
FT                   LDKSYVRLLNPHVYKVSLTERLAQLKNTLITALRR"
FT   gene            688419..689243
FT                   /locus_tag="TPASS_0629"
FT   CDS_pept        688419..689243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKZ9"
FT                   /protein_id="ACD71048.1"
FT                   /translation="MDLGMTMAGFLRGLWCVVGTSVCAQTLQEAPAHFLLEGTDFAARV
FT                   LRMSISARNVPSYWFEEGVWSEAPSASSRLPAKNKSTPGVPRRVTRALPRVKPDVFVFG
FT                   NEHETVFWGQLNTIEHARYVVHRAVHPLDAHAHERYYEPLLKRFHFYCLEGRTPITSVS
FT                   LCLFALDVSTRLIWAYALPSQVEMVWGTCIPRAWIPLEMHSHVRARYPKAKFYQFDPIG
FT                   FVDSEGKVVLYPWALEQHAQRPQDFLVYEPQQGDWEQVASQTGPGHSPYRAM"
FT   gene            689413..690324
FT                   /gene="cheR"
FT                   /locus_tag="TPASS_0630"
FT   CDS_pept        689413..690324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="TPASS_0630"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71049"
FT                   /db_xref="GOA:A0A0H3BJA9"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJA9"
FT                   /protein_id="ACD71049.1"
FT                   /translation="MTAATEKSDITRSYLTLGKGVRPMSTLSDAEFAAFKTLIYEHSGI
FT                   TFSALNRSVLESRIRSRLRELALPSACAYYQQVLASSAELSALLDSVTTNLTRFFRNKA
FT                   HFDSFSHYVIPELVKAKRSVGEHSITVWSAGCSTGEEPYTIAMLLKRYAPAAFSCQVIA
FT                   SDLSLKSLLVARQGYYPRARVSGVPDEYLRAYFRETQEGYQINADIRKMVRFDYHNLKH
FT                   RSMHRNVDVLFCRNVLIYFDETAQKAVIERFWDAMSAHSFLFIGHSESLFGMNTKFSFL
FT                   KTPWGCLYQKNDEGSAHECHAR"
FT   gene            690371..691582
FT                   /gene="cheB"
FT                   /locus_tag="TPASS_0631"
FT   CDS_pept        690371..691582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="TPASS_0631"
FT                   /product="protein-glutamate methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71050"
FT                   /db_xref="GOA:A0A0H3BIU1"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIU1"
FT                   /protein_id="ACD71050.1"
FT                   /translation="MKNTNDIAVLIVDDSALMRKVIGKVIEGAPGLSIAGKAMNGRFAL
FT                   DMLERVQPDVILLDLEMPHMNGLQFLEQRKRLRIDIPVIILSSIAKEGARVTMQCLELG
FT                   ASDFVTKPFGSESAHLRTVSRKIVDYVTAYGRRYKLLRRTRRCLAMDTPVERPAGEEDL
FT                   NCLDTQERASLPSVCARAPARDRASYTITPTEGARQTRIVPLRESGALQIIAIGVSTGG
FT                   PSALRHIFAQLDADLPQPVVVVQHMPAGFTREFAYSLNQVCALEVKEAQEGDLVRRGRV
FT                   LIAPGDRHLTVERRSLATVAHINSDEPENGHRPSVDVLFESVARHFENRALGILMTGMG
FT                   RDGAAQLARLYTEGSRTIAQDADSCIVYGMPRVACELGAVGEQVSLDDMAATINRYGKV
FT                   FASS"
FT   gene            691687..692700
FT                   /gene="trpS"
FT                   /locus_tag="TPASS_0632"
FT   CDS_pept        691687..692700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="TPASS_0632"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71051"
FT                   /db_xref="GOA:A0A0H3BJM0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJM0"
FT                   /protein_id="ACD71051.1"
FT                   /translation="MLRVLTGDRPTGRLHLGHYAGSLGTRLRIQSEHECFFIIADLHTL
FT                   TTRHGRAQLAELPALVRELVLDYLACGIDAQRAVIYLQSAVPEVTELAFIFANLVTVPR
FT                   LQRIPSLKEMAQAANLSELPFGLLGYPVLQAADILLARAHLVPVGKDNESHVELTREVA
FT                   KRFNRLYGEVFPLPRALLSDCATLVGTDGQAKMSKSLGNAIFLSDDEETVRRKVRAMYT
FT                   DPARTRADIPGRVEGNPVFAYHDAFNPNTDEVAHFKERYRAGRVGDTEVKDALARALNT
FT                   FLEPIRARRAQLEQQPAYLARVLEEGCARMRAEARKTMQRVKEAMGLSARPLVHLP"
FT   gene            692841..693716
FT                   /gene="msrA"
FT                   /locus_tag="TPASS_0633"
FT   CDS_pept        692841..693716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="TPASS_0633"
FT                   /product="protein-methionine-S-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71052"
FT                   /db_xref="GOA:A0A0H3BKX2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKX2"
FT                   /protein_id="ACD71052.1"
FT                   /translation="MLANLQHLSDIQYRVTQQSATETPFKNEFWNSYQPGFYLDVVSGE
FT                   LLFLSEDKFDSGCGWPSFSAPAYARAVIEKEDRTHNMLRTEVRSRNANSHLGHVFKDGP
FT                   PERGGLRYCINSAALRFVAREEGTALFAAGCFWSTEAYFRRVKGVLRVRVGYTGGTTKS
FT                   PTYRNVCTGTTGHAEAVEILFDPQVISYEDLLKHFFRMHDPTSLNKQGGDVGTQYRSAI
FT                   FYLSGTQKQQAETLMGRYAGAGKFTRPLVTTLEEARDFYPAEEYHQDYLTKNPGGYCHV
FT                   SLHLASEPLE"
FT   gene            693835..696306
FT                   /gene="lig"
FT                   /locus_tag="TPASS_0634"
FT   CDS_pept        693835..696306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="TPASS_0634"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71053"
FT                   /db_xref="GOA:B2S3M4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3M4"
FT                   /protein_id="ACD71053.1"
FT                   /translation="MSTAQRRVQELEKLILHHQDRYYNAESDISDDAFDALWEELARLD
FT                   PGNPLLKAIGSDSQRDAVKKRHIVPMGSQHKAADEESFSAWAKKNALQAFLVQHKLDGV
FT                   SLELQYERGHFCCALTRGNGIVGDDVTANVRGMRGFVPTLTAEWGPCGNLPFTGGVRGE
FT                   VIMHKDIHRSHYPTHANCRNTVNGILKRKDGRGRTHLHIVCYDAVPGTPGKPFTGSLPF
FT                   ADETEKLAWLARQGFVTVHSHRCANAQEVVALRSEIMRTRELLPYSIDGLVVKSTDLDF
FT                   QDAQLPRPKKQIAFKFSTQEAITTLRDVQWQTSGVTYTPIGITDPVRLAGTTVKRANLC
FT                   NPNMLTKLCLKIGSHVLISKRGEIIPKIEALVSTPAHAQEIHIPTQCTSCNTVLENSGS
FT                   RLFCPNVNCPLLSHHRITRWIECLEIKHVGTELIQRLFEEKKVRRIPDLYTLTCEDLIE
FT                   IEHVGNATAKKILEAIHHKKEIALQTFIAGFGIEGIGETMGEKLICAGFDTLEKVLHAT
FT                   TETLESIYQFGTELAKSVVTGIARVKDDMCELLDRGFVRILAKQQAESPLRGKSFCFSG
FT                   SLRNGDRATIHRIRALGGVVRTSVTRDLSYLIFESLSQPYRTAQKLKKEQGVALEIISE
FT                   DEFCRLLDQASASCTHTGETVHPLQGKSFYFSGASRSMNHKHAQEKVRALGGDVASSVT
FT                   AQLDYLVFYSQSTRYRTACALGIQIISEETLHKLIATAQSPLHTDAHVHAPLHGMSFCF
FT                   SGDLDGMTRAQAIALVQRLGGTVKTAVSTQLTYLVSNDPHGQSRKCQNAVRCGVRIISE
FT                   HVFLALCTPGT"
FT   gene            complement(696341..697111)
FT                   /locus_tag="TPASS_0636"
FT   CDS_pept        complement(696341..697111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71054"
FT                   /db_xref="GOA:A0A0H3BL04"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BL04"
FT                   /protein_id="ACD71054.1"
FT                   /translation="MCVASRSWYAQALVLSLSAFGEGHKSVTLFVRLQDEAFILRAALF
FT                   GGAQSKLRGLVIPYTTGRVWVYSNPRTSMHKIVDFSVTHSRVALRDSIVRVWCAAICVD
FT                   IIEASKGTISWTLVTAFLDGISLSSDGACKHALLRFLWRVLIGEGVAPNITSCSRCATQ
FT                   YAVSVSGVSRVAYLTQGESFVCAACAAPAEHRFELNAEAWHFLNTVKECTPRHARALVL
FT                   SQESYCELKQLLFCLITKMSGKKLKTLEHAHAVL"
FT   gene            complement(697149..698099)
FT                   /gene="miaA"
FT                   /locus_tag="TPASS_0637"
FT   CDS_pept        complement(697149..698099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="TPASS_0637"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71055"
FT                   /db_xref="GOA:B2S3M6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3M6"
FT                   /protein_id="ACD71055.1"
FT                   /translation="MRLETQALVPYPVRFDRSHHDALVVLGATATGKTALAVALAQKYQ
FT                   GEIISADSRQVYRGLDVGTGKDLALYGSVPYHLIDVCDPYEEYNVFRFQQAVYGIVPSI
FT                   LRAHKVPIIVGGTGLYLDAVLRQYALVPVERNQALRASLRGASLSHMRAVYFSLKDSHA
FT                   VHNKTDLEDPARLMRAIEIAVFHATHPELLQQARETRPMMRAKVYGIQYPRSMLRARIR
FT                   ARLEQRIRGGLIEEVAALHKGGVSWQRLEYFGLEYRFTAQYLQGIIATRDEYVDLLFRA
FT                   ISRFAKRQETWFRRMQRLGVKIHWLVHTENGFVLR"
FT   gene            complement(698323..698757)
FT                   /locus_tag="TPASS_0638"
FT   CDS_pept        complement(698323..698757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71056"
FT                   /db_xref="GOA:A0A0H3BJB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJB5"
FT                   /protein_id="ACD71056.1"
FT                   /translation="MGTLRRFPASVLQIALALFLLASGARDLVHVDAGVFNAAVYFLGG
FT                   LFRGHVAIGVLTLAVSLCCLTAGFFLLVDFLRPELSCVSAVLALFVVLWALNMVLVDVV
FT                   GAFGRGKVLQNVSSALEHLHHTAVDLLVLGALIFVRQHTR"
FT   gene            complement(698838..698911)
FT                   /locus_tag="TPASS_t0031"
FT   tRNA            complement(698838..698911)
FT                   /locus_tag="TPASS_t0031"
FT                   /product="tRNA-Arg"
FT                   /note="tRNA-Arg4; codon recognized: CGA"
FT   gene            complement(698926..698997)
FT                   /locus_tag="TPASS_t0032"
FT   tRNA            complement(698926..698997)
FT                   /locus_tag="TPASS_t0032"
FT                   /product="tRNA-His"
FT                   /note="tRNA-His1; codon recognized: CAC"
FT   gene            699134..699206
FT                   /locus_tag="TPASS_t0033"
FT   tRNA            699134..699206
FT                   /locus_tag="TPASS_t0033"
FT                   /product="tRNA-Phe"
FT                   /note="tRNA-Phe1; codon recognized: UUC"
FT   gene            699177..701141
FT                   /gene="mcp3"
FT                   /locus_tag="TPASS_0639"
FT   CDS_pept        699177..701141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp3"
FT                   /locus_tag="TPASS_0639"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71057"
FT                   /db_xref="GOA:A0A0H3BIU6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIU6"
FT                   /protein_id="ACD71057.1"
FT                   /translation="MSTVRFCPTAMLPPSGEGLCALDRPSLRCYRARSCELMPEGATMY
FT                   AGTYSTPPISVLLRELVLSCCWVPLLFLSASAAXXFGDGQFVELLLSPASVLYLLCLFP
FT                   LLHYRALCAAFIRGEDEARFSKRVNSYGRTALRASVLLSCFVPFVSILARSPFETGPQM
FT                   AVYVMLSAGGCLLFAPALHFLLTRPLERWAAFLPLRESSVRANWTRMLLTIAIALFVAT
FT                   LLLVSAPLLVRTDSQNITPAELLTMAGTFGLCASAVSCMEFLLCAYLTSREITRLRVLA
FT                   ECIGTGDYTCADVPRETRTSIGLLARSLSSLRDKDRAFFSRFLQLTQSSSAIAHTAETD
FT                   IAHLEEAARTTKEEIDHVNENVTAQTATISSSKEIVGTMVEGVGRLNASVEAESETVTR
FT                   SITLVEQMVEKIHSIEKIIESNDARVGRLREETNRAGNLTNRSLELTQNISKSSKALLQ
FT                   ASLVIRKIASQTTLLAMNAAIEAAHAGQDGRGFAVVADEIRKLAEESNEQGKIISSVLV
FT                   QLTEKIEHIAQQAESLSKQFSNLFVLAEEVKQRESTVMHAMEEQSSGGEYIRRSMEAIT
FT                   GNRRRIRGGISLMLKDGELVLKDMNELAHNTGGITVAMHDMAASTSRILDAVTSVKIIA
FT                   SENKNAMDMLTNQLTQLRL"
FT   gene            701165..703009
FT                   /gene="mcp4"
FT                   /locus_tag="TPASS_0640"
FT   CDS_pept        701165..703009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcp4"
FT                   /locus_tag="TPASS_0640"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71058"
FT                   /db_xref="GOA:A0A0H3BJM5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJM5"
FT                   /protein_id="ACD71058.1"
FT                   /translation="MNTEHAVSDFAVLRRAVVMSVAWVPATSLVAYIAGVIDGSMLSAL
FT                   LTSVSFFCALALMLGASLTLYYVLLMSVKKHQNDSAAAEAAFLRYTWISPLPPAVAAVV
FT                   YPVCAALEVGFSSSHVLLLSYYLSSVGAALCLIPFFHHPFFYTLQEWAHFIPLRETRLG
FT                   YYSLSREISVVLVSGLFSMFCVGFSSLLLPLHGEQELAHVVITHNLPCASLICVLSVIV
FT                   MIRIGRHLDLANQGILTFIQNRLSGDASAASMRVVRRNEFGFLTQSLNKMHKSTRFFLI
FT                   ASRGKMARARKIANSFVRNARTSCAAINEIISQAHKAEDKIKHQSRTIFETQKHVQHIV
FT                   GNIDRFNGHIGEQVDTVTDAASSVEQMVRNIESVTQVLSDNSNVIETLLLEAKLAQDAT
FT                   IQSADVGREVLHASEALAEAGAVIQHIASQTNLLAMNASIEATYCKESGQGFEVVASEI
FT                   RRLAEDASKQGKHISAVLRDVKTEIEKVSESALAVQAQFALIFSITTDIKAQEEVISQS
FT                   MVEQTKDSVHVLHAIQHITEITRTLQENSGAILDNSKHVEEAMLALSRITSEIDSSVSS
FT                   MHKNSEQVKKYASSITEIGQKNKDSITDLVTELSNMRL"
FT   gene            complement(703027..704355)
FT                   /gene="hisS"
FT                   /locus_tag="TPASS_0641"
FT   CDS_pept        complement(703027..704355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="TPASS_0641"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71059"
FT                   /db_xref="GOA:B2S3N0"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3N0"
FT                   /protein_id="ACD71059.1"
FT                   /translation="MRVGSAVSPKVLKGFRDLLPDEEIERALLVEKLTVALRQMGFVPI
FT                   DTPALEYTEVLLRKSEGDTEKQMFRFVDKGGRDVALRFDLTVPLARFVATHYARLYFPF
FT                   KRYHFAKVWRGEKPQMGRYREFTQCDFDIVGSDSVCADFEILKSIRHMLYMAGAEHIRI
FT                   HVAHRGLFDRFLRALSLSDQAEHILRIIDKRAKMAPHVLTAQLESLCDPVRVQKIMTYV
FT                   SAGEVDGVAPSFEHTLSAIETLTGGVSEESTRLRKIYELLCAVNIQSSYVFDPSITRGF
FT                   DYYTGMVCETFLTQLPHIGSVCSGGRYDHLTALYMKDAVSGVGASIGLDRLYAAFQQLG
FT                   MSREHVCFVQALIFCQDSALMDVYQKLCSYFAVQVATEVFPDPRKLSQQYAFAEKKGIR
FT                   WGIFVEQRNAVVEDCLLVLRDLSTRKDTRLPAHEVRRRMAAEG"
FT   gene            704496..706256
FT                   /gene="manB"
FT                   /locus_tag="TPASS_0642"
FT   CDS_pept        704496..706256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="TPASS_0642"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71060"
FT                   /db_xref="GOA:A0A0H3BKX8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKX8"
FT                   /protein_id="ACD71060.1"
FT                   /translation="MHSSQLFERARLYLEEETDPFFAQQVRDLVAQNNIAELEERFLQT
FT                   LSFGTAGLRGVVGGGTNRMNPFMIKKITHAIALYLLKTFPEKAARGALRAVIAYDSRVH
FT                   SRLFAHTAAHVFLAHDITAYLFSDPRPTPELSYAVQYLTCDVGIVVTASHNPPQYNGYK
FT                   VYWNDGAQIAHPHEKNITEEMNAITSVVNLEEKVPVKRSAPTIIDAEIDEPYCTSIKEK
FT                   LFRPGLTKETVQSMRIAYTPLHGTGALHVERILGDMGFSIMTVPEQRLPDGNFPTVSSP
FT                   NPEDPAALVHACAYADRVHAEVLMATDPDADRFACAVRNTRGVLQLLTGNQMGALFTDY
FT                   ILLTLQEQNNMPARPAIVRSVVTSPLSDRIARTYGATCVECLTGFKWICGTAEKISQSG
FT                   AYSYVYGFEESYGHNFGIQVRDKDGINAAALCAEMGVYWKLRGMSLIDRLHQLFRTHGL
FT                   FCEKTLNKTYAGVAGVSTMNAIMNTLRRQPLTQIARKRVMKVRDIYLGVEFSPENPAQT
FT                   SALSFPQSNVLQYFVQDGSIVSIRPSGTEQKIKCYIIHPLTVSTSIEEAEQAGNMFITA
FT                   VEQEMGTYLQ"
FT   gene            706253..706900
FT                   /gene="dnaQ"
FT                   /locus_tag="TPASS_0643"
FT   CDS_pept        706253..706900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="TPASS_0643"
FT                   /product="DNA polymerase III, subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71061"
FT                   /db_xref="GOA:A0A0H3BL09"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BL09"
FT                   /protein_id="ACD71061.1"
FT                   /translation="MIYDWVFAVHEHVAFTAFDTETTGLKAEEDRIIEIGAVTFDRKGI
FT                   IARFSTLIFPDRAIPPDVSKINHITDDMLVNKPRFCEIVSDFSRFIKGTVLVAHNANFD
FT                   VEFLNAELSLCKKQPLSHKVVDTYAMAQAVFPGLGRHQYRLQNLALQFGLTVHAAHRAE
FT                   DDARVCMELFTTMIAHHAKQNGHCVNHAQSPTIKKLIQEIQASSTDCSQELF"
FT   gene            complement(706897..708483)
FT                   /gene="lysS1"
FT                   /locus_tag="TPASS_0644"
FT   CDS_pept        complement(706897..708483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS1"
FT                   /locus_tag="TPASS_0644"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71062"
FT                   /db_xref="GOA:A0A0H3BJB9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJB9"
FT                   /protein_id="ACD71062.1"
FT                   /translation="MSICEKSLHWADKVAHKIIKECADCDQYTCASGITPSGTVHIGNF
FT                   REIISVDLVVRALRDQGKSVRFVHSWDDYDVFRRIPDNVPAQDELKQYIRMPITSVPDP
FT                   FQQEDSYARHHEREIESALPEVGIYPEYVYQSKQYQAGVYAQEIKIALDNRHRIQAILN
FT                   EYRDEQHKISGTYWPVSVFCTACHKDCTTVDAWDSHWCLQYHCECGHGEQVDLRQTSAV
FT                   KLSWRVDWAMRWSKEHVVFEPAGKDHHSQGGSFDTARLISDHIYHWPAPVSFRYDFIGL
FT                   KGLPGKMSSSAGKVVGLRDVLEVYQPEVLRYLFVSTRPNTEFSISFDLDVLKIYEDYDK
FT                   SERVAWGIHAAKSEHEFMRHKRIYELSQVRGMPPCISYQVPFRHVCNILQINSGDISAV
FT                   LAFFSDIHKDQIERFVRRCQCAWNWIRDAGAPDDFKFTLKEDGVRVPLSAEITEALRLI
FT                   RDTLVPRTDVLSEKELSAELYAVARQIPVGSKELFTALYQVLIGKNQGPRLAGFMKVIG
FT                   TQRLHRMLSVY"
FT   gene            complement(708514..708690)
FT                   /locus_tag="TPASS_0645"
FT   CDS_pept        complement(708514..708690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIV1"
FT                   /protein_id="ACD71063.1"
FT                   /translation="MRAVLTRTQFLFSLYRGSDHTVCQADASTHRMAVVCIRHCHLCGS
FT                   VGCARGKCVLAWL"
FT   gene            complement(708749..710071)
FT                   /locus_tag="TPASS_0646"
FT   CDS_pept        complement(708749..710071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71064"
FT                   /db_xref="GOA:A0A0H3BJN0"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN0"
FT                   /protein_id="ACD71064.1"
FT                   /translation="MGRMRKVACAFRKLWCRFVVLSISILVSCSVVTRHPLRLGFFTFF
FT                   LLGSFLVLVSSCTRWMGRELHGQRLFALTYGDAENQLHFPDAGYAQSQSNIQLCMKDGI
FT                   FYVAHAATGKVMRMTSFGDVLAVIFNPEKNAMTPQFSEGLQSAAITTRRAVPYPLHAPT
FT                   FLAVDSQNTLYVVDAVLPEHVQHDPEENLALVNTILLFDEEGRFMHAIGQQGIGGTPFP
FT                   AIEGVYVNSADELVVVCRSVDAMRVYWFNAQRVPIHQRALPFSPLPTSFAAQEKGYAFV
FT                   ERVLPDVSERRLIAKVDYYTAVHDPATGANSSVRYAKSSVYFISLETGVYEWKVDLPAH
FT                   EVSGTENQERGPYKKAFSLLGVSAQQGILCVSPDRFGYAALLLDLRSFTIRQRSIHMRS
FT                   DTLVYNVFHFSPTGILSSVLATDTEAVVMWWRFDRILSRIK"
FT   gene            complement(709983..711263)
FT                   /gene="serS"
FT                   /locus_tag="TPASS_0647"
FT   CDS_pept        complement(709983..711263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="TPASS_0647"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71065"
FT                   /db_xref="GOA:B2S3N6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3N6"
FT                   /protein_id="ACD71065.1"
FT                   /translation="MLDYRFIRENVDAVKENVKVRNVHADVDAIVHLYDQRVKLLAELQ
FT                   ELQRARNENAQTMKSSLDALARSACVETGRALKDRIAHSERLLVQISDQLLSATQALPN
FT                   MTHMCTPHGRSDSDNLEIKRCGVPPCFSFSPRDHVELARLLDIVDFEAGKKVSGIKFYY
FT                   LKREGVLLEQALIMFGLQFLQERGFVPFLTPDIAREGMVCGLGFNPRGSGSNIYRIEGE
FT                   HRCLVATAEITLGAYHAGEVLEERSLPRLYAGLSHCFRKEAGAAGQFSRGLYRVHQFTK
FT                   LEMFAYCTPSDSECLHERLRSLEEEIFTALEIPFRVVEVCAGDLGAPAYRKWDLEAWMP
FT                   GRQGGSWGEVTSASNCTDYQARRLNVRYKDAEGKKHYVHMLNGTALAISRVLIALLENG
FT                   QDAEGRVRIPQALVPFCGFEYLYPRVL"
FT   gene            complement(711313..713361)
FT                   /locus_tag="TPASS_0648"
FT   CDS_pept        complement(711313..713361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71066"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKY3"
FT                   /protein_id="ACD71066.1"
FT                   /translation="MYLSCGVIPSLHVYLSGHRGKGKSMKGLLCVYYGALCSIVFAQTG
FT                   VQLYEAGRKAHVQEDWHAAIEFYQEALKKNASYNLAYRGLAECFYALGEYDQALHHVRK
FT                   AQKLMAQDLSLEKLCAFSLVGQGELDQARSLFEEILARYPNDVDARFGLAEIEVSKGRL
FT                   SSARLLYQAALERQAENRKALLSLALISYEAGHYPRALTYVERALQYHGDNAQVHFFAA
FT                   YLATLRAHYEDAERYLERALHIKSAYPRARALLSAVLYARGAYERAVAQCDQRIRADRT
FT                   QVDAWYVKTLSLLKLGKHTEALATAKVGLTVDPRDDLMRILLEEIAIVHLEYEDEYRMQ
FT                   LARFHTQKADGFARRNMSRQALDEYRRALKVYPYDGAAREAYARLLLRFGYPERSLEQL
FT                   KFLQSIGKSSARINDAVEAYEKTHARSIKNRWRVDALYLDKAHLSISLFYHPDPANALH
FT                   PEAERFFLTQVQDSFAYNRRLKVTGYSARSHSYREAFRTAREAGDDYFALITMQEHGQD
FT                   LRVRLELYVASTGSRAHTFDAYRSGNDRYQSVLRRIMQMLNDRLPIMGTVVRRHQSEAV
FT                   IDLGTQDAELQGKSLEVVKRRAVSVLKEGVGLAYRREDVLGHFTVTKVSEDMSEGVLRR
FT                   VGYYDHISVGDAVICEPRLPDSSATTSDTFVHDGAMGMLLALLRSIR"
FT   gene            complement(713306..714103)
FT                   /gene="tlyC"
FT                   /locus_tag="TPASS_0649"
FT   CDS_pept        complement(713306..714103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="TPASS_0649"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71067"
FT                   /db_xref="GOA:A0A0H3BL14"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BL14"
FT                   /protein_id="ACD71067.1"
FT                   /translation="MGVIDWLRRRHAVTHIFQQPLNEEKQDMIRGIVDLSDTSVREVMI
FT                   PRIDVDFLELSMSGETLVEKVTESGHSRFPVYEQTIDNVVGVLYVKDLIKLFGRPQEVR
FT                   LERLLRKPFFVPESKRIDSLLREFKRRHVHIAIAVDEYGGVSGIACMEDIIEEIVGDIQ
FT                   DEFDHEREDIEPLGQGVWLCDARVDLEDLSECLHTVFPSQEFGTLGGFVFNLFGKIPVK
FT                   YEKVSWGAFDFIIQDMEAHKINTIKIVSVLRGDSEPACVSERP"
FT   gene            complement(714091..714573)
FT                   /locus_tag="TPASS_0650"
FT   CDS_pept        complement(714091..714573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71068"
FT                   /db_xref="GOA:B2S3N9"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3N9"
FT                   /protein_id="ACD71068.1"
FT                   /translation="MSEVNKVSVSCEGFCPPPWIGQVAPFVCAVLDSQAISHWDLSIVC
FT                   CTDAFIRRLNYDYRGIDSPTDVLSFENDGEYCDDAGTRFFLAGDIIISLESVRENSERF
FT                   HVAAHEEFKRVLIHGILHLSGMDHQDNSPGQEMLRLQERILAQHCRVLSSGIPWES"
FT   gene            complement(714579..716990)
FT                   /locus_tag="TPASS_0651"
FT   CDS_pept        complement(714579..716990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0651"
FT                   /product="hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71069"
FT                   /db_xref="GOA:A0A0H3BJC4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJC4"
FT                   /protein_id="ACD71069.1"
FT                   /translation="MAYAVSRTSPPGARALNLALSFVVLSIATAVSISEQHDPARLNLA
FT                   DFAVGRVAERNVVSPVFLSLTDELATQRQYARRKKEIPAVFERRLDLEQAEVRAYQAFC
FT                   HALQKARVGMALDTSSDGGGGAADYEEERSLHAAHDRASAHVHLLQQKFVHFSRQTLRS
FT                   LLQLDDDTFESLLRVGTQVLARIFAQGVVQLSDHALKDFNPHTITISEERPFHAPSDMS
FT                   APVASQASAGDLPSASVPLSPDASADEAENAAGDVFSRTQAIETLIRSDQLAARVHALA
FT                   SDFGLTSQAALLFSSLGPFLRPNIVFDPIQSERHVRNALARLRPVTLSIHPNEIIVRRG
FT                   FIVSATDYARLQALAHSKLSVDRSLLVSSLLLLAFLYLLAFFLFSKRMAHPPLKLRVEL
FT                   LILYTSVAGYLCTLFLSKIAALPAPLDSIPFQPTALCIMLVTALVSHRSAVTSSFLIAF
FT                   AVLIASQFHTEPTLFALLSGVSASACMRVMSSRLDIVKSSCVLAVAQPFLAATLMFAFP
FT                   HAYTDAIFLLTGVAISGFLNGILVLGLLPILEALTNAPTVFRLMELSDLNVPIMKKMLL
FT                   TVSGTYNHTMMVATLAENACRSIGAHSLLARVGAYYHDIGKMENGEYFVENQTGDSKHL
FT                   DLNPRLSATVIRSHVKLGVEKAHQLRLPQEVIDIIAEHHGNSLITYFYEKARELDPNVD
FT                   REDFTYPGVPPRTKESAVVMLADVVEASCRTLNKPTIPRLGKFIDKVVQQKIETHQLDN
FT                   SDLTFRDVQVVKECFVRILAGYYHSRIEYPHQRDSDQQQLVSVAQGSYKE"
FT   gene            717166..718305
FT                   /gene="potA"
FT                   /locus_tag="TPASS_0652"
FT   CDS_pept        717166..718305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potA"
FT                   /locus_tag="TPASS_0652"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71070"
FT                   /db_xref="GOA:A0A0H3BIV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIV8"
FT                   /protein_id="ACD71070.1"
FT                   /translation="MRQTVKGCAVTIDQVSKAYGHCLAVDRATVHIRQGEFFSILGPSG
FT                   CGKTTLLRIIAGFEQPDSGDLTFDHVSVLGVGANKRRSNTVFQSYALFPHLSVYENIAF
FT                   PLRLKRLSKNLIRERVHEYLHLVQLDEHLHKKPHQLSGGQQQRVAIARALVCEPGVLLL
FT                   DEPLSALDAKLRSNLLIELDTLHDQTGITFVFITHDQSEALSVSDRIAVMNKGKILQIG
FT                   TPYEIYEQPATDFVAKFIGETNSFLSTVVSCTAIENEEFMLSLQVPELDRTLTVTADNP
FT                   IDPGRRVCFTVRPEKIHISLEEPGTTSAPLNVFRGFVEEPVYAGFQSKFFVQLESGAII
FT                   QVFQQHQKYLDTGPEIAWKDTVYVSWSAHDGYVVEDIES"
FT   gene            718302..719201
FT                   /gene="potB"
FT                   /locus_tag="TPASS_0653"
FT   CDS_pept        718302..719201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potB"
FT                   /locus_tag="TPASS_0653"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71071"
FT                   /db_xref="GOA:A0A0H3BJN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN4"
FT                   /protein_id="ACD71071.1"
FT                   /translation="MSSRLRVARRRTVGSLGFWCTLPLSAWLTVFFLCPLTVVAVYSFL
FT                   QKGLYGGVVWKFSIRAYAQVLTSGYGALLARTLLISTGVTCLCVLLALPAGYALSRSRR
FT                   QTFFLFLIIVPFWTNSLIRINAWITILGNQGFLNEALKSLGFITRSLPLLYHNGAVIVV
FT                   LTYMFLPYAIFPIFAAIDRFDFSLLESACDLGSTPTGAIIRVLLPNIKTGIATAVFFTF
FT                   IPVFGSYTVPLLVGGKDSYLIGNAIVDQVRIVGNWPLASAFAMLVTLAGGVGVLWILAE
FT                   SGACNTTPPPCGGRRSYA"
FT   gene            719194..720012
FT                   /gene="potC"
FT                   /locus_tag="TPASS_0654"
FT   CDS_pept        719194..720012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potC"
FT                   /locus_tag="TPASS_0654"
FT                   /product="spermidine/putrescine ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71072"
FT                   /db_xref="GOA:A0A0H3BKY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKY8"
FT                   /protein_id="ACD71072.1"
FT                   /translation="MPNCRLIHTRARTPLRCSFSAVLLAAVVSFLFLPLAVIALFSFNK
FT                   DKSLIWTGFSLRWYTELFFYSEKLWSSFLNSVLIASVSALVATIVGTAAAIAIRWYRFS
FT                   GRLYAQVMSLLPMLLPEVITGMAMLVFFSLVRLPLGRASIITAHITFCLPFVLLLILTR
FT                   IDTFDLSLIEAAQDLGANEWQALGKIVIPAIMPGILSGFLLSVTLSLEDFVITFFVAGP
FT                   GSTTLPLYVFSMIRYGVSPIINALSLIMMAGIVGVAYLLRNSLKTIVHSK"
FT   gene            720048..721094
FT                   /gene="potD"
FT                   /locus_tag="TPASS_0655"
FT   CDS_pept        720048..721094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potD"
FT                   /locus_tag="TPASS_0655"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71073"
FT                   /db_xref="GOA:A0A0H3BL20"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BL20"
FT                   /protein_id="ACD71073.1"
FT                   /translation="MKRFCVSSSRILSLLFLSLWMGSCLQTRQDVLYLYNWTYYTPTSL
FT                   IKKFEQQYNVQVVYDDYASNEDMFAKLSIGASGYDLVVPSGDFVSIMKRKHLLEKIDLS
FT                   KIPNVQFIKESVRARIAYDPKMEYSVPYYLGAAGIAVNKKAVPSYARTWSIFSRKDLAY
FT                   RMSMMDDMREVMGAALASLGYNVNTKNEQELAQAAILVTDHWKPNLVKFDSDGYAKSFA
FT                   SGDFVVAHGFAEAFFAETPEAMHEHIDFFIPQDVASPVYVDSFCIPKGARNRDLAHAFI
FT                   NFFLEPAHYAEFLDTFGFPSTIHREAAAYQKKTPYYSEHDLERGTLKTDVGAAIEHYNA
FT                   HWNAVRFR"
FT   gene            721063..721164
FT                   /locus_tag="TPASS_0656"
FT   CDS_pept        721063..721164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJC8"
FT                   /protein_id="ACD71074.1"
FT                   /translation="MRTGTRCDLGELSHPRKTLPPRGMGILCNYTGN"
FT   gene            complement(721149..721370)
FT                   /gene="csrA"
FT                   /locus_tag="TPASS_0657"
FT   CDS_pept        complement(721149..721370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="TPASS_0657"
FT                   /product="carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71075"
FT                   /db_xref="GOA:B2S3P6"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3P6"
FT                   /protein_id="ACD71075.1"
FT                   /translation="MLILSRKTNQKIFIGDSIELTIIEIRGDQVKVGVEAPRSVKIFRQ
FT                   EVYEEIQRENRAASDSPWSPNSLPQLPV"
FT   gene            complement(721364..721816)
FT                   /locus_tag="TPASS_0658"
FT   CDS_pept        complement(721364..721816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0658"
FT                   /product="possible transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71076"
FT                   /db_xref="GOA:B2S3P7"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2S3P7"
FT                   /protein_id="ACD71076.1"
FT                   /translation="MEIQTKTLGTQTVEAHQIITLERGLYGFEKYHRFALFDAVQVPFI
FT                   HMQSLDDPALSFIAIDPFLFRPDYELDIDDVLLQPLDISSPTDVLVFALVTIPPDGSAV
FT                   TANLQGPLIVNKKNRKAMQVAMGGDRWRTKHDIVAEMAERRAQEQC"
FT   gene            complement(721835..723085)
FT                   /gene="flgL"
FT                   /locus_tag="TPASS_0659"
FT   CDS_pept        complement(721835..723085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="TPASS_0659"
FT                   /product="flagellar hook-associated protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71077"
FT                   /db_xref="GOA:A0A0H3BIW4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIW4"
FT                   /protein_id="ACD71077.1"
FT                   /translation="MGVKRISSHMQGTDSAFFLREQESRLRKVNNQLATQRRIQQLRDD
FT                   PLAAGHSVRYKSSLARLDRFERNTKTLRDQYQIAEGFMTSALNVVQRLREMAVAGANGT
FT                   YTPDDLKKMASEADELLQELVHNANAVSADGVRVFSGTKVFTEPFETVMGNVEGLGSEV
FT                   ITQVRYHGSLDPKNVEIDEHSYVGTHQAGSRVFWAERQILLSSVDARAYVLQQDARVTV
FT                   DGVSIPLVAGDNVYAIISKINDSGAAVRAYLDPVTNGLNMETSDARQLWLQDEDEANVF
FT                   ASLGLITEGQRPPYNVSAGARVSGGSIFDMAIAVRNALLAGDQESLGGKILGSADGAVD
FT                   NLSLRLAETGARYARAQATLARFNSHIPNVVAAESRESDIDLTQAITDLKMFEYTHQAT
FT                   LSTVGSLYKHTLLDYLR"
FT   gene            complement(723119..724996)
FT                   /gene="flgK"
FT                   /locus_tag="TPASS_0660"
FT   CDS_pept        complement(723119..724996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="TPASS_0660"
FT                   /product="flagellar hook-associated protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71078"
FT                   /db_xref="GOA:A0A0H3BJN8"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJN8"
FT                   /protein_id="ACD71078.1"
FT                   /translation="MSTFASIELGKRALYAHKQSVQTAGHNVSNSSTPGYSRQRVNLDS
FT                   FEPLYRPDLSRAQLPGQIGQGVTIGSIARLRDQLLDSRIVSQTDEQGYWSTRDAYVRLL
FT                   EQVYNEPEDIAVRTRLDQFWDGWQELSVYPEARAARQVVLTRAQTLTDAIHHQYRGLVG
FT                   IRDMLNADIEATVEQVNDLLAKIAQLNEQIVKSKAMGDNPNDLLDRRDTLVESLAHRIE
FT                   VRVDVRDEDESYVIHSAGLEVVQGKSYKTLGLVSGTTPEGYVSVVWKDSGDRAHFSGGK
FT                   LAALIELRDTDVRDELRKLDTMAMNFVDLVNNVHRNAMGLNGKTGLDFFKEQYFINNVD
FT                   GNFDRDGDGQYDSSYIFRISGAHALDAREQVGLTGVITLSAADGTVEVPYAATDMVADV
FT                   VARINQANAEVTAYLDQNHKLVLKATTAHNSDNPDFVIRHVEDSGRFLAGYAGLLAASG
FT                   AEGAFDWQRADAIAALDQAGAQHAVSPIAHPAGWMELNPAVLSDVYSVAAGYPSAEGLP
FT                   HAGDNRAALAIASLRNSPVMIGNRHTFDEFFAEVTTAIGLKGEQAERSMQMHAAILKEL
FT                   TDMRDATSGVNIDEELADIIKFQHGYNASARFIAAVNEMLDTVINRMGV"
FT   gene            complement(725102..725614)
FT                   /locus_tag="TPASS_0661"
FT   CDS_pept        complement(725102..725614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0661"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKZ3"
FT                   /protein_id="ACD71079.1"
FT                   /translation="MDRERALHRAGQVEAILVAQIELVGQVIQVQRSVYESLRTRAWEH
FT                   VESFVSRAQALSREFLHLDKRCFLLLQEVRPYGDAPVDFDSFFAYLRRADVNVHDAVVA
FT                   LYRTLRSKVASSKNEHDAIQHYLTHARGLAHALVSALTCEQQGSSYTKDGCPVRCAPGS
FT                   LVFDRVL"
FT   gene            complement(725737..726735)
FT                   /gene="cbbA"
FT                   /locus_tag="TPASS_0662"
FT   CDS_pept        complement(725737..726735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbA"
FT                   /locus_tag="TPASS_0662"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71080"
FT                   /db_xref="GOA:A0A0H3BL27"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BL27"
FT                   /protein_id="ACD71080.1"
FT                   /translation="MTSYKALGLVNTKDLFAKAVKGGYAIPAYNFNNLEQLQAIIQACV
FT                   ETRSPVILQVSSGARKYANATLLRNMARGAVEYAHELGVDIPIVLHLDHGDSLELCIDC
FT                   IESGFSSVMIDGSALPYDENVALSRKVCEYAHARADYVTVEGELGVLAGVEDDVVAEKS
FT                   HYTMPDEVEDFVKKTGVDSLAISIGTSHGRAKFTPEQCTRNADGVLIPPPLRFDILAEI
FT                   EKRIPGFPIVLHGASSVPVEYVREVERYGGNLPDSVGIPEEQLRKAAKSAVCKVNIDSD
FT                   GRLAMTAAIRRVLTTKVDEFDPRKYLGPARDELKKLYMHKNKEVLGSAGRA"
FT   gene            727002..727730
FT                   /locus_tag="TPASS_0663"
FT   CDS_pept        727002..727730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0663"
FT                   /product="possible outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71081"
FT                   /db_xref="GOA:A0A0H3BJD3"
FT                   /db_xref="InterPro:IPR006714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJD3"
FT                   /protein_id="ACD71081.1"
FT                   /translation="MKQGCFMVAGFALTCAFLVSPLAAQRSKVNYQAYFIDDFDGASED
FT                   QGLAWRAAGSKFITKGFPILKYFEGMPQAVRMAGSWQGKDKEARFIGVECKFNRQGNNW
FT                   LDLIPTKGGSDYEIPLRGVVSGFDVWVWGAGYQYSLEALVRDCTGRVHTLLIGNLDFQG
FT                   WKNLSVSVPTHIPQTSRYLGSAQHLSFVGFRIRTXPSERVDDFYVFFDQFKALANMHID
FT                   FYDGHELRNAQFKEEGESGK"
FT   gene            727727..728452
FT                   /gene="flaA2"
FT                   /locus_tag="TPASS_0664"
FT   CDS_pept        727727..728452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaA2"
FT                   /locus_tag="TPASS_0664"
FT                   /product="flagellar filament outer layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71082"
FT                   /db_xref="GOA:A0A0H3BIW9"
FT                   /db_xref="InterPro:IPR006714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BIW9"
FT                   /protein_id="ACD71082.1"
FT                   /translation="MKKIAVVSVGVLVFSAHAQEAAGSRDVADPSRIGMYAAAQRLKEV
FT                   SVDKFENEGTWVVSMSSDEGTIKGRLFEGGPARKRPIPEEGDMKIPDSKVFGAKVSFYR
FT                   RGYNSFEVSSVKPLPVEGVAKTVSVWVAGRGYPHSLSLLLEDFWGQRFELHMGQLDFSG
FT                   WKLMSVAIPPQHVDGKTGIVQKSRRFPNQSGLNIVGFRVDCDPLEAYGNYYVYFDDLRV
FT                   VTDLYDVESREPDDMSDAW"
FT   gene            complement(728470..729225)
FT                   /locus_tag="TPASS_0665"
FT   CDS_pept        complement(728470..729225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BJP2"
FT                   /protein_id="ACD71083.1"
FT                   /translation="MTINTCRETGLHRALKDYFSPRGSRQEVELRGSICDVVHPDGTIV
FT                   EVQTSGLGRLEAKLKKLLPYHQVMVVYPVSRRLYIRMLNEDGSERHYRKSPKEGSFFQI
FT                   YREIGRLHDLLDHEHLSLHIVYIHSEVIKVDDRKGRSRYKKPRIVDRKLLEVQSSEEFR
FT                   NKGSLAQPLLSKLPEIFCCDDLAQTGTGVHCRYALRFLRRNGMATPHSKRGRTKLYRKE
FT                   PPGDNRSPPPWQEPHGEGLAEKLSPGPAR"
FT   gene            complement(729222..729515)
FT                   /locus_tag="TPASS_0666"
FT   CDS_pept        complement(729222..729515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TPASS_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BKZ8"
FT                   /protein_id="ACD71084.1"
FT                   /translation="MQKGSGASSVMTLYEYYLIFPDGECREISGPPCERSLLDMNGHPL
FT                   RVPLSSNRVIAYRVAGKRTVAGGRGVVGIWYTLEQLDALELLEYVSGPLGQR"
FT   gene            complement(729559..731226)
FT                   /gene="udk"
FT                   /locus_tag="TPASS_0667"
FT   CDS_pept        complement(729559..731226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="TPASS_0667"
FT                   /product="uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TPASS_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACD71085"
FT                   /db_xref="GOA:A0A0H3BL31"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3BL31"
FT                   /p