(data stored in ACNUC7421 zone)

EMBL: CP000806

ID   CP000806; SV 1; circular; genomic DNA; STD; PRO; 4934271 BP.
XX
AC   CP000806;
XX
PR   Project:PRJNA20319;
XX
DT   02-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Cyanothece sp. ATCC 51142 circular chromosome, complete sequence.
XX
KW   .
XX
OS   Crocosphaera subtropica ATCC 51142
OC   Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
OC   Aphanothecaceae; Crocosphaera; Crocosphaera subtropica.
XX
RN   [1]
RP   1-4934271
RX   DOI; 10.1073/pnas.0805418105.
RX   PUBMED; 18812508.
RA   Welsh E.A., Liberton M., Stockel J., Loh T., Elvitigala T., Wang C.,
RA   Wollam A., Fulton R.S., Clifton S.W., Jacobs J.M., Aurora R., Ghosh B.K.,
RA   Sherman L.A., Smith R.D., Wilson R.K., Pakrasi H.B.;
RT   "The genome of Cyanothece 51142, a unicellular diazotrophic cyanobacterium
RT   important in the marine nitrogen cycle";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(39):15094-15099(2008).
XX
RN   [2]
RP   1-4934271
RA   Welsh E.A., Liberton M., Stockel J., Sato H., Loh T., Wang C., Wollam A.,
RA   Fulton R.S., Clifton S.W., Jacobs J.M., Aurora R., Sherman L.A.,
RA   Smith R.D., Wilson R.K., Pakrasi H.B.;
RT   ;
RL   Submitted (22-AUG-2007) to the INSDC.
RL   Department of Biology, Washington University in Saint Louis, One Brookings
RL   Drive, Campus Box 1137, Saint Louis, MO 63130, USA
XX
DR   MD5; 486889523c9a5425b0b1701ffda1be53.
DR   BioSample; SAMN02604312.
DR   EnsemblGenomes-Gn; EBG00001104150.
DR   EnsemblGenomes-Gn; EBG00001104151.
DR   EnsemblGenomes-Gn; EBG00001104152.
DR   EnsemblGenomes-Gn; EBG00001104153.
DR   EnsemblGenomes-Gn; EBG00001104154.
DR   EnsemblGenomes-Gn; EBG00001104155.
DR   EnsemblGenomes-Gn; EBG00001104156.
DR   EnsemblGenomes-Gn; EBG00001104157.
DR   EnsemblGenomes-Gn; EBG00001104158.
DR   EnsemblGenomes-Gn; EBG00001104159.
DR   EnsemblGenomes-Gn; EBG00001104160.
DR   EnsemblGenomes-Gn; EBG00001104161.
DR   EnsemblGenomes-Gn; EBG00001104162.
DR   EnsemblGenomes-Gn; EBG00001104163.
DR   EnsemblGenomes-Gn; EBG00001104164.
DR   EnsemblGenomes-Gn; EBG00001104165.
DR   EnsemblGenomes-Gn; EBG00001104166.
DR   EnsemblGenomes-Gn; EBG00001104167.
DR   EnsemblGenomes-Gn; EBG00001104168.
DR   EnsemblGenomes-Gn; EBG00001104169.
DR   EnsemblGenomes-Gn; EBG00001104170.
DR   EnsemblGenomes-Gn; EBG00001104171.
DR   EnsemblGenomes-Gn; EBG00001104172.
DR   EnsemblGenomes-Gn; EBG00001104173.
DR   EnsemblGenomes-Gn; EBG00001104174.
DR   EnsemblGenomes-Gn; EBG00001104175.
DR   EnsemblGenomes-Gn; EBG00001104176.
DR   EnsemblGenomes-Gn; EBG00001104177.
DR   EnsemblGenomes-Gn; EBG00001104178.
DR   EnsemblGenomes-Gn; EBG00001104179.
DR   EnsemblGenomes-Gn; EBG00001104180.
DR   EnsemblGenomes-Gn; EBG00001104181.
DR   EnsemblGenomes-Gn; EBG00001104182.
DR   EnsemblGenomes-Gn; EBG00001104183.
DR   EnsemblGenomes-Gn; EBG00001104184.
DR   EnsemblGenomes-Gn; EBG00001104185.
DR   EnsemblGenomes-Gn; EBG00001104186.
DR   EnsemblGenomes-Gn; EBG00001104187.
DR   EnsemblGenomes-Gn; EBG00001104188.
DR   EnsemblGenomes-Gn; EBG00001104189.
DR   EnsemblGenomes-Gn; EBG00001104190.
DR   EnsemblGenomes-Gn; EBG00001104191.
DR   EnsemblGenomes-Gn; EBG00001104192.
DR   EnsemblGenomes-Gn; EBG00001104193.
DR   EnsemblGenomes-Gn; EBG00001104194.
DR   EnsemblGenomes-Gn; EBG00001104195.
DR   EnsemblGenomes-Gn; EBG00001104196.
DR   EnsemblGenomes-Gn; EBG00001104197.
DR   EnsemblGenomes-Gn; EBG00001104198.
DR   EnsemblGenomes-Gn; EBG00001104199.
DR   EnsemblGenomes-Gn; EBG00001104200.
DR   EnsemblGenomes-Gn; EBG00001104201.
DR   EnsemblGenomes-Gn; EBG00001104202.
DR   EnsemblGenomes-Gn; EBG00001104203.
DR   EnsemblGenomes-Gn; EBG00001104204.
DR   EnsemblGenomes-Gn; EBG00001104205.
DR   EnsemblGenomes-Gn; EBG00001104206.
DR   EnsemblGenomes-Gn; EBG00001104207.
DR   EnsemblGenomes-Gn; EBG00001104208.
DR   EnsemblGenomes-Gn; EBG00001104209.
DR   EnsemblGenomes-Gn; EBG00001104210.
DR   EnsemblGenomes-Gn; EBG00001104211.
DR   EnsemblGenomes-Gn; EBG00001104212.
DR   EnsemblGenomes-Gn; EBG00001104213.
DR   EnsemblGenomes-Gn; EBG00001104214.
DR   EnsemblGenomes-Gn; cce_RNA001.
DR   EnsemblGenomes-Gn; cce_RNA002.
DR   EnsemblGenomes-Gn; cce_RNA003.
DR   EnsemblGenomes-Gn; cce_RNA004.
DR   EnsemblGenomes-Gn; cce_RNA005.
DR   EnsemblGenomes-Gn; cce_RNA006.
DR   EnsemblGenomes-Gn; cce_RNA007.
DR   EnsemblGenomes-Gn; cce_RNA008.
DR   EnsemblGenomes-Gn; cce_RNA009.
DR   EnsemblGenomes-Gn; cce_RNA010.
DR   EnsemblGenomes-Gn; cce_RNA011.
DR   EnsemblGenomes-Gn; cce_RNA012.
DR   EnsemblGenomes-Gn; cce_RNA013.
DR   EnsemblGenomes-Gn; cce_RNA014.
DR   EnsemblGenomes-Gn; cce_RNA015.
DR   EnsemblGenomes-Gn; cce_RNA016.
DR   EnsemblGenomes-Gn; cce_RNA017.
DR   EnsemblGenomes-Gn; cce_RNA018.
DR   EnsemblGenomes-Gn; cce_RNA019.
DR   EnsemblGenomes-Gn; cce_RNA020.
DR   EnsemblGenomes-Gn; cce_RNA021.
DR   EnsemblGenomes-Gn; cce_RNA022.
DR   EnsemblGenomes-Gn; cce_RNA023.
DR   EnsemblGenomes-Gn; cce_RNA024.
DR   EnsemblGenomes-Gn; cce_RNA025.
DR   EnsemblGenomes-Gn; cce_RNA026.
DR   EnsemblGenomes-Gn; cce_RNA027.
DR   EnsemblGenomes-Gn; cce_RNA028.
DR   EnsemblGenomes-Gn; cce_RNA029.
DR   EnsemblGenomes-Gn; cce_RNA030.
DR   EnsemblGenomes-Gn; cce_RNA031.
DR   EnsemblGenomes-Gn; cce_RNA032.
DR   EnsemblGenomes-Gn; cce_RNA033.
DR   EnsemblGenomes-Gn; cce_RNA034.
DR   EnsemblGenomes-Gn; cce_RNA035.
DR   EnsemblGenomes-Gn; cce_RNA037.
DR   EnsemblGenomes-Gn; cce_RNA038.
DR   EnsemblGenomes-Gn; cce_RNA039.
DR   EnsemblGenomes-Gn; cce_RNA040.
DR   EnsemblGenomes-Gn; cce_RNA041.
DR   EnsemblGenomes-Gn; cce_RNA042.
DR   EnsemblGenomes-Gn; cce_RNA043.
DR   EnsemblGenomes-Gn; cce_RNA044.
DR   EnsemblGenomes-Gn; cce_RNA045.
DR   EnsemblGenomes-Gn; cce_RNA046.
DR   EnsemblGenomes-Gn; cce_RNA047.
DR   EnsemblGenomes-Gn; cce_RNA048.
DR   EnsemblGenomes-Gn; cce_RNA049.
DR   EnsemblGenomes-Gn; cce_RNA050.
DR   EnsemblGenomes-Gn; cce_RNA051.
DR   EnsemblGenomes-Gn; cce_RNA052.
DR   EnsemblGenomes-Gn; cce_RNA053.
DR   EnsemblGenomes-Gn; cce_RNA054.
DR   EnsemblGenomes-Gn; cce_RNA055.
DR   EnsemblGenomes-Tr; EBT00001695775.
DR   EnsemblGenomes-Tr; EBT00001695776.
DR   EnsemblGenomes-Tr; EBT00001695777.
DR   EnsemblGenomes-Tr; EBT00001695778.
DR   EnsemblGenomes-Tr; EBT00001695779.
DR   EnsemblGenomes-Tr; EBT00001695780.
DR   EnsemblGenomes-Tr; EBT00001695781.
DR   EnsemblGenomes-Tr; EBT00001695782.
DR   EnsemblGenomes-Tr; EBT00001695783.
DR   EnsemblGenomes-Tr; EBT00001695784.
DR   EnsemblGenomes-Tr; EBT00001695785.
DR   EnsemblGenomes-Tr; EBT00001695786.
DR   EnsemblGenomes-Tr; EBT00001695787.
DR   EnsemblGenomes-Tr; EBT00001695788.
DR   EnsemblGenomes-Tr; EBT00001695789.
DR   EnsemblGenomes-Tr; EBT00001695790.
DR   EnsemblGenomes-Tr; EBT00001695791.
DR   EnsemblGenomes-Tr; EBT00001695792.
DR   EnsemblGenomes-Tr; EBT00001695793.
DR   EnsemblGenomes-Tr; EBT00001695794.
DR   EnsemblGenomes-Tr; EBT00001695795.
DR   EnsemblGenomes-Tr; EBT00001695796.
DR   EnsemblGenomes-Tr; EBT00001695797.
DR   EnsemblGenomes-Tr; EBT00001695798.
DR   EnsemblGenomes-Tr; EBT00001695799.
DR   EnsemblGenomes-Tr; EBT00001695800.
DR   EnsemblGenomes-Tr; EBT00001695801.
DR   EnsemblGenomes-Tr; EBT00001695802.
DR   EnsemblGenomes-Tr; EBT00001695803.
DR   EnsemblGenomes-Tr; EBT00001695804.
DR   EnsemblGenomes-Tr; EBT00001695805.
DR   EnsemblGenomes-Tr; EBT00001695806.
DR   EnsemblGenomes-Tr; EBT00001695807.
DR   EnsemblGenomes-Tr; EBT00001695808.
DR   EnsemblGenomes-Tr; EBT00001695809.
DR   EnsemblGenomes-Tr; EBT00001695810.
DR   EnsemblGenomes-Tr; EBT00001695811.
DR   EnsemblGenomes-Tr; EBT00001695812.
DR   EnsemblGenomes-Tr; EBT00001695813.
DR   EnsemblGenomes-Tr; EBT00001695814.
DR   EnsemblGenomes-Tr; EBT00001695815.
DR   EnsemblGenomes-Tr; EBT00001695816.
DR   EnsemblGenomes-Tr; EBT00001695817.
DR   EnsemblGenomes-Tr; EBT00001695818.
DR   EnsemblGenomes-Tr; EBT00001695819.
DR   EnsemblGenomes-Tr; EBT00001695820.
DR   EnsemblGenomes-Tr; EBT00001695821.
DR   EnsemblGenomes-Tr; EBT00001695822.
DR   EnsemblGenomes-Tr; EBT00001695823.
DR   EnsemblGenomes-Tr; EBT00001695824.
DR   EnsemblGenomes-Tr; EBT00001695825.
DR   EnsemblGenomes-Tr; EBT00001695826.
DR   EnsemblGenomes-Tr; EBT00001695827.
DR   EnsemblGenomes-Tr; EBT00001695828.
DR   EnsemblGenomes-Tr; EBT00001695829.
DR   EnsemblGenomes-Tr; EBT00001695830.
DR   EnsemblGenomes-Tr; EBT00001695831.
DR   EnsemblGenomes-Tr; EBT00001695832.
DR   EnsemblGenomes-Tr; EBT00001695833.
DR   EnsemblGenomes-Tr; EBT00001695834.
DR   EnsemblGenomes-Tr; EBT00001695835.
DR   EnsemblGenomes-Tr; EBT00001695836.
DR   EnsemblGenomes-Tr; EBT00001695837.
DR   EnsemblGenomes-Tr; EBT00001695838.
DR   EnsemblGenomes-Tr; EBT00001695839.
DR   EnsemblGenomes-Tr; cce_RNA001-1.
DR   EnsemblGenomes-Tr; cce_RNA002-1.
DR   EnsemblGenomes-Tr; cce_RNA003-1.
DR   EnsemblGenomes-Tr; cce_RNA004-1.
DR   EnsemblGenomes-Tr; cce_RNA005-1.
DR   EnsemblGenomes-Tr; cce_RNA006-1.
DR   EnsemblGenomes-Tr; cce_RNA007-1.
DR   EnsemblGenomes-Tr; cce_RNA008-1.
DR   EnsemblGenomes-Tr; cce_RNA009-1.
DR   EnsemblGenomes-Tr; cce_RNA010-1.
DR   EnsemblGenomes-Tr; cce_RNA011-1.
DR   EnsemblGenomes-Tr; cce_RNA012-1.
DR   EnsemblGenomes-Tr; cce_RNA013-1.
DR   EnsemblGenomes-Tr; cce_RNA014-1.
DR   EnsemblGenomes-Tr; cce_RNA015-1.
DR   EnsemblGenomes-Tr; cce_RNA016-1.
DR   EnsemblGenomes-Tr; cce_RNA017-1.
DR   EnsemblGenomes-Tr; cce_RNA018-1.
DR   EnsemblGenomes-Tr; cce_RNA019-1.
DR   EnsemblGenomes-Tr; cce_RNA020-1.
DR   EnsemblGenomes-Tr; cce_RNA021-1.
DR   EnsemblGenomes-Tr; cce_RNA022-1.
DR   EnsemblGenomes-Tr; cce_RNA023-1.
DR   EnsemblGenomes-Tr; cce_RNA024-1.
DR   EnsemblGenomes-Tr; cce_RNA025-1.
DR   EnsemblGenomes-Tr; cce_RNA026-1.
DR   EnsemblGenomes-Tr; cce_RNA027-1.
DR   EnsemblGenomes-Tr; cce_RNA028-1.
DR   EnsemblGenomes-Tr; cce_RNA029-1.
DR   EnsemblGenomes-Tr; cce_RNA030-1.
DR   EnsemblGenomes-Tr; cce_RNA031-1.
DR   EnsemblGenomes-Tr; cce_RNA032-1.
DR   EnsemblGenomes-Tr; cce_RNA033-1.
DR   EnsemblGenomes-Tr; cce_RNA034-1.
DR   EnsemblGenomes-Tr; cce_RNA035-1.
DR   EnsemblGenomes-Tr; cce_RNA037-1.
DR   EnsemblGenomes-Tr; cce_RNA038-1.
DR   EnsemblGenomes-Tr; cce_RNA039-1.
DR   EnsemblGenomes-Tr; cce_RNA040-1.
DR   EnsemblGenomes-Tr; cce_RNA041-1.
DR   EnsemblGenomes-Tr; cce_RNA042-1.
DR   EnsemblGenomes-Tr; cce_RNA043-1.
DR   EnsemblGenomes-Tr; cce_RNA044-1.
DR   EnsemblGenomes-Tr; cce_RNA045-1.
DR   EnsemblGenomes-Tr; cce_RNA046-1.
DR   EnsemblGenomes-Tr; cce_RNA047-1.
DR   EnsemblGenomes-Tr; cce_RNA048-1.
DR   EnsemblGenomes-Tr; cce_RNA049-1.
DR   EnsemblGenomes-Tr; cce_RNA050-1.
DR   EnsemblGenomes-Tr; cce_RNA051-1.
DR   EnsemblGenomes-Tr; cce_RNA052-1.
DR   EnsemblGenomes-Tr; cce_RNA053-1.
DR   EnsemblGenomes-Tr; cce_RNA054-1.
DR   EnsemblGenomes-Tr; cce_RNA055-1.
DR   EuropePMC; PMC2329701; 18427117.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2567498; 18812508.
DR   EuropePMC; PMC3251135; 22123943.
DR   EuropePMC; PMC3261843; 22133144.
DR   EuropePMC; PMC3641832; 22289180.
DR   EuropePMC; PMC3707797; 19336042.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00028; Intron_gpI.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01739; glnA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000806.
DR   SILVA-SSU; CP000806.
DR   StrainInfo; 115227; 0.
XX
CC   Bacteria available from the ATCC Cell Biology Collection: ATCC
CC   51142.  Products annotated as 'unknown' have been observed in
CC   high-throughput proteomics experiments.  Products annotated as
CC   'conserved hypothetical protein' have orthologs in at least 6 other
CC   cyanobacterial genomes.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4934271
FT                   /organism="Crocosphaera subtropica ATCC 51142"
FT                   /chromosome="circular"
FT                   /strain="ATCC 51142"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:43989"
FT                   /culture_collection="ATCC:51142"
FT   gene            complement(1..921)
FT                   /locus_tag="cce_0001"
FT   CDS_pept        complement(1..921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49353"
FT                   /db_xref="GOA:B1WYC3"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49353.1"
FT                   /translation="MKFKQSLDLMSSIIVFLNLYLKASKAPPHTLTGLSLEERDPQIIE
FT                   ELMPFFGWIYQHYFRVQTDGWEHIPKNGKVLLIGSHNGGLAAPDTVMMTYDWFRQFGTK
FT                   RLAYALMDRRIWQFLPGLAHLATQVGAIQPTPRLARTALRRGSALLIYPGGAKDVFRPY
FT                   HLRHRINFQGHRGFIQLALQEDVTIIPFISYGAHSTLIVLEDIYPHLQQLHRWGMPWLG
FT                   GIDPGVFPIYLGWPWGVAIGPLPNIPFPLKLHTRVCPPIIFERYGQSASHDREYVHQCY
FT                   RQVVETMQRELDQLVIEEESACITF"
FT   gene            complement(918..1925)
FT                   /locus_tag="cce_0002"
FT   CDS_pept        complement(918..1925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0002"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49354"
FT                   /db_xref="GOA:B1WYC4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49354.1"
FT                   /translation="MAMEVKQMMRAMVLEAAKEKLRLELRPIPEPDDKQLLLKIQACGV
FT                   CRTDLHIVDGELTQAKFPLILGHEIVGTVEAVGKGVKRFSLGERVGVPWLGGTCQHCCY
FT                   CRTQQENLCEKARFTGYHLDGGYAEYTVANEQFCFAIPKRYSDLEVAPLLCAGLIGYRS
FT                   YRLVGDREKIGFYGFGAAAHILLQVARHQGRQVYAFTRPGDELGQDFARSLGAVWAGGS
FT                   EQSPPDSLDGAIIFAPVGALVPVALKAVTPGGVVVCAGIHMSDIPSFPYKILWQERVLR
FT                   SVANLTRQDGEDFFALAKQIPIQTQVSSFPLTEANVALDCLRQGKIKGAAVLVP"
FT   gene            complement(2017..2229)
FT                   /locus_tag="cce_0003"
FT   CDS_pept        complement(2017..2229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49355"
FT                   /db_xref="GOA:B1WYC5"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49355.1"
FT                   /translation="MEERTMTEKLYLMISGVIFALIGSLHLLRIIFQWPAMVGAWTVPF
FT                   VLSVAAVILAGILTVWAFRLSRTMV"
FT   gene            complement(2458..5619)
FT                   /gene="czcA"
FT                   /locus_tag="cce_0004"
FT   CDS_pept        complement(2458..5619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="cce_0004"
FT                   /product="cation efflux system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49356"
FT                   /db_xref="GOA:B1WYC6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49356.1"
FT                   /translation="MLNSLLNQIIKNSITQRWLIVIGAILITLWGIVNITQMPLDVFPE
FT                   FAPPQVDVQTEVPGLAPEEIEAQITVPIESAVNGLPGVTTVRSSSKVGLSMVQVVFDQN
FT                   ADIYKARQAVTERLQQISGQFPENAHAPEISPLVSPLGTILQYAFTVNGQTSLMELRRL
FT                   VEGTVSNQILSVPGVSQVTVYGGDERQEQVLVDPEKLRSLNVSLTDVTEAAKGSNSNAP
FT                   GGFLIGGGQELLIRGIGKVQTIEDLQTSVVKVKDGEPILLKDVATVQTGSALKRGDGSF
FT                   NGQPAVVMMINKQPDVDTPTVTKAVETVIASLETTFPADVNIARTFRQANFIDAAIRNV
FT                   SGSLIQGIIIVSVIMLLFLMNWRTAMITLSAIPLSLIIGLLFMKAFGLGINTMTLGGLV
FT                   VAIGSVVDDSIVDMENCYRGLRNNQAQDNPKHPFQVVYDTSVEVRLAVIFSTVIIIVVF
FT                   APIFSLTGVEGRIFAPMGLAYLLSIAASTLVAMTVSPALCAILLANQTLPPDGTFISRF
FT                   VIKHYRPLLNLSLKLPKIILCCALAALIATFAIVPSLGRVFLPEFQEKSMVNSMVLFPG
FT                   VSLDMTNRAGMALYNSLKDNPLYEWVQVRAGRAPGDADGAGVSMAHVDVELSDLALKDR
FT                   ENSVKQLREAFLELPGVAPNIGGFISHRMDEVLSGVRSAIAIKIFGPDLIELRQVGEQV
FT                   RDAIEPIEGIVDLQLEPQLPIRQVQIQYDRSAAANYGLTMQGISEVVETALNGQVVAQI
FT                   PDNQQLIDITVGLDPSKRNNLDAIRSIPISTPTGQMIPLSAVAKVTYGMGANVVNREDV
FT                   SRLIVVSANVAERDLGSVVADIQETIRQQVQLPKGYFVQYGGQFEAEQNATNNLLVYSI
FT                   LAAIIITILMFFSVKSFPATIAIMINLPLALVGGIVSIIFSGGVMSIASLIGFITLFGV
FT                   AVRNGLLLVDNYNNKFAQGMKLKDVIVKGSLDRVNAILMTALTSALGMLPLAVASGAGN
FT                   EILQPLAIVVLGGLFTSTALTLLVIPALYAQFGKWLMPKSPPANQTKNFQGNKPLVSVN
FT                   QDTTG"
FT   gene            complement(5811..6437)
FT                   /locus_tag="cce_0005"
FT   CDS_pept        complement(5811..6437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49357"
FT                   /db_xref="GOA:B1WYC7"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49357.1"
FT                   /translation="MMMKSLSLMSLLSLSLTLGAATVVLSHVGHGDEFQATGGIERVEV
FT                   NPENDQVLGIMVTPIEQTSTNGVMIPVTALVEADGKQLVFVKYENFYEPVEVTTGETQG
FT                   DLMEVTEGLSVGEQLVTQGSLSLYAESRKTKTAETEATSEPMMTPETTSKSEDAENAVK
FT                   ASESATAETSGGFPMMTVAAIGGGVVVLVGGALAVMGSGGKKKNS"
FT   gene            complement(6523..7227)
FT                   /locus_tag="cce_0006"
FT   CDS_pept        complement(6523..7227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0006"
FT                   /product="hypothetical protein"
FT                   /note="contains a glycoside hydrolase, family 24 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49358"
FT                   /db_xref="GOA:B1WYC8"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49358.1"
FT                   /translation="MIIQHSQPKRKGTKYRLKKPYKLVFNLIIVVGLIGLVYSFKKNTQ
FT                   PLVNPSLVTHLPELEMSGGDPYIRALMLTISASESNHKNSYYLLYGGSHVHNLQQHPDQ
FT                   CIPINIGPNRGNCSTAAGRYQFLNSTWQEKARKYHPNPQKNYRQYIYSFEPKYQDIVVY
FT                   RWLKDHHQWNVDLLTLLKQDQVEEVLRKLSNVWTSLGGGIEDNSMTPHLPSIYRYFLAQ
FT                   ELNRENADQNSL"
FT   gene            complement(7381..7635)
FT                   /locus_tag="cce_0007"
FT   CDS_pept        complement(7381..7635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49359"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYC9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49359.1"
FT                   /translation="MTLQEIINSLDDLSQEDITYLFEILRLKLSDVKTNNQEQIIDNDD
FT                   TFWDMTLRFREQMEKEGIEFTDEDFVDLRDRSIGREINF"
FT   gene            complement(7874..8119)
FT                   /locus_tag="cce_0008"
FT   CDS_pept        complement(7874..8119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49360"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49360.1"
FT                   /translation="MKVIVDTCIWSLAFRKRQQTNDVITQTLRDLITDGRVLLLGTVRQ
FT                   EILSGIKHREQFEKLRNNLQAFPNLLTDTEDYEIAA"
FT   gene            complement(8116..8316)
FT                   /locus_tag="cce_0009"
FT   CDS_pept        complement(8116..8316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0009"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49361"
FT                   /db_xref="InterPro:IPR019239"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49361.1"
FT                   /translation="MATNLEIDDQLIQEALKIGGHSTKREVVEAALKEYVQRRKQLEIT
FT                   ELFGTIEYEDDYDYKQQRNQS"
FT   gene            complement(8424..8759)
FT                   /gene="xisI1"
FT                   /locus_tag="cce_0010"
FT   CDS_pept        complement(8424..8759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xisI1"
FT                   /locus_tag="cce_0010"
FT                   /product="probable fdxN element excision controlling factor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49362"
FT                   /db_xref="InterPro:IPR014968"
FT                   /db_xref="InterPro:IPR035943"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49362.1"
FT                   /translation="MEKIAEYRLYIQQLLTEYAQGSPSDEDIETELIFDRERDHYQVVY
FT                   TGWKNRQSVYGCVLHLDIKNDKIWIQHDGTEIGIANELVNLGVPKQDIVLAFHEPLVRE
FT                   YTEFAVD"
FT   gene            complement(8804..9163)
FT                   /gene="xisH1"
FT                   /locus_tag="cce_0011"
FT   CDS_pept        complement(8804..9163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xisH1"
FT                   /locus_tag="cce_0011"
FT                   /product="probable fdxN element excision controlling factor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49363"
FT                   /db_xref="GOA:B1WYD3"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014919"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49363.1"
FT                   /translation="MSAKDIFHHAVRKGLEKEGWSITDDPLRIRVGRVDMQIDLGTERM
FT                   IAAEKDGEKIAVEIKSFVGTSNISEFHTALGQFLNYRVALENKQPERFLYLAIPQGVYQ
FT                   TFFSLPFVEMIIERF"
FT   gene            9322..10008
FT                   /locus_tag="cce_0012"
FT   CDS_pept        9322..10008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0012"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49364"
FT                   /db_xref="GOA:B1WYD4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49364.1"
FT                   /translation="MRILLVEDEEDLGLAIKQVLVSEKYIVDWVVDGVEAWHYLDNQWT
FT                   DYSVAIIDWLLPKLSGLELCQRLRSHQNPLPVLMLTALGQPENRITGLDAGADDYLVKP
FT                   FIMEELLARLRALQRRSPQFQPQTLSIGQFSLDDANNALCVNVTQPPQTIPLTVKEFQI
FT                   FAYLMKHPDRIISGSKIRNQLWDLDAEPMSNVVAAQMRLIRRKLASYNCICPIETIRGQ
FT                   GYRFNS"
FT   gene            complement(9984..10079)
FT                   /locus_tag="cce_0013"
FT   CDS_pept        complement(9984..10079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49365"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49365.1"
FT                   /translation="MLNQDVTISQHQSEFNHYLDHVRYQLLKRYP"
FT   gene            10104..11072
FT                   /locus_tag="cce_0014"
FT   CDS_pept        10104..11072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0014"
FT                   /product="putative site-specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49366"
FT                   /db_xref="GOA:B1WYD6"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49366.1"
FT                   /translation="MIKLVQSMDQQKQPKKKTNSPFRYPGGKFYARKLILASLPEHDSY
FT                   CEPFAGGASIFFAKPTVKNNILNDKDEDLVNCYISIRDHVEKLISLLDGIPAKKELHSY
FT                   YKNEFQPQNDLERAMRWYYLNRTSYSGIMKPQNCYWGYGDKYSMRPENWPYHLRTTSER
FT                   LQGVDIYCLDFEELIGSLSDGYFLFIDPPYFNADQDKFYTCSFTTEDHQRLCSLLQKNK
FT                   SKYNFLITYDNSPEIKEMYNWCVSVQDNQWNYTINRTDDQQNSRNLGDGYKGSRYKGRE
FT                   LFITNYDINSVVGITPLNLDQQGTKINSTENRYLQLSLFEN"
FT   gene            complement(11087..12172)
FT                   /locus_tag="cce_0015"
FT   CDS_pept        complement(11087..12172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0015"
FT                   /product="unknown"
FT                   /note="contains a Lambda repressor-like, DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49367"
FT                   /db_xref="GOA:B1WYD7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49367.1"
FT                   /translation="MPSKLSMKDEILRQFGQKLQKWRLIQNLSQEQLAEIINVDRTYIS
FT                   LLERGKRNPSLICIKSLAEALNINLNELILIPEWQENLQNFCHKYNIDMENLADVLNDP
FT                   KVIPMIRGKAFEFTIKTLISNILPSARYQISNPKINAQTGLEDVDVAIYDQEQDKIYSA
FT                   ECKLAAKGEFKLDNNIPRIKVKCMRSRTLGETAARQKAKRTNLDFELLMIHNDQYVIQD
FT                   FDLVVTSIANAFYETDEQGLFYWCPPEEAKDFLTKINATTQDEAFYKIYIARSDQLSVN
FT                   GSNKTGQKVIKCTRTKKRKTGKKDAQGNDLYHRTCPEVLKNLNMKYCHFIPNYPVIYFD
FT                   PQTGEPLSPWVKLENLESLLY"
FT   gene            12308..13660
FT                   /locus_tag="cce_0016"
FT   CDS_pept        12308..13660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0016"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49368"
FT                   /db_xref="GOA:B1WYD8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49368.1"
FT                   /translation="MKTSQLFRHSRLRLAVWYTLVMGVILSVSGLGIYRSLVQSNWKAM
FT                   EREIESIAGTLHDSLEPMLPPSENPTTVLKGILPELCLVGQTCHSNPSLIERHTIGISD
FT                   RNTYYIRLFNHQRKLLAFSPNQPDNLSQTLNPEPWQTIKSNGIRYHQFTIILHSSDTHD
FT                   LGINSSWGYLQLGRNLKPFDAEVKRLQVIFILGFPFVLGLVVISSWWLSGLAMQPIYQS
FT                   YQQQQQFTANAAHELRSPLASLLATIEAILRIPPSQPQDLNKMLHTLERQGRRLSYLVT
FT                   DLLLLTSLEGQSSSKGFQSCCLNDLVSDLIEEFSELATVANIDLIEQIPDEEIDVLGDE
FT                   SQLYRLVSNLMANAIQYTPNGGEVVVSLKTKENMALITIKDTRIGISREEQKRIFERFY
FT                   RVDSDRNRKTGGTGLGLAIAQAIAHHHQGYITIQSQLGKGSLFTIYLPRAK"
FT   gene            complement(13675..15171)
FT                   /locus_tag="cce_0017"
FT   CDS_pept        complement(13675..15171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0017"
FT                   /product="hypothetical protein"
FT                   /note="contains a peptidase M50 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49369"
FT                   /db_xref="GOA:B1WYD9"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYD9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49369.1"
FT                   /translation="MWLLLIILGAITYYLAKKTVAPITRTPIWMIWLVMMMPAVVWTIW
FT                   YEVNGEDQQIPLLWIIVPLVICFTLYVWLIRLGKIPSSDQPKETIPDSPPQLQNLDTPT
FT                   QDSEQVRPITATEEKSLRDCFPWGVYYLQNLDYRPQAILCRGKLRTAPEKAYNSIKKNI
FT                   EQVFGDRFLILFQEGLQGKPFFALVPNPWSKSETEDNKSKENLKRPLFALGLLFLTLLT
FT                   TTLVGTISIAGVAKETISNDPSVLLQGLPYSLGLITILGVHEFSHYLTAVRYKIATTLP
FT                   YFIPIPFFLGTFGAFIQMKSPVPHRKALFDVGVAGPLGGFIITLPLLLWGISLSEIVPM
FT                   PTAENASLLNIEALDPRFSFLFAILVKLVLGSSFIAGKALHLHPLAVAGYIGLIVTALN
FT                   LMPVGQLDGGHIVHAMFGQRTAVIVGQITRIFMLVLAMIRPEFLIWAILLFLMPIMDQP
FT                   ALNDVTELDDIRDFVGLFSLTLLILILLPVPGAISQWLQI"
FT   gene            15284..15931
FT                   /locus_tag="cce_0018"
FT   CDS_pept        15284..15931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0018"
FT                   /product="unknown"
FT                   /note="contains a beta-lactamase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49370"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49370.1"
FT                   /translation="MNLNTIKSPKPPRLLLEGLFAFAPNREILGGTAYFIVEKSGNILI
FT                   DCPAYHDDYLQFIREQGGVTWLFLTHRGGISPSLKLWQKALECDIIIQEQEAYLLPTLP
FT                   VRSFEREITITERITGIWTPGHSTGSSCLYWQQHGGVLFTGRHLLPEKNGNPVPLKLEK
FT                   TFHWGRQLQSVAHLCDRFSADSLHYICPGANTGFLRGKGLIDNAYERLTQVC"
FT   gene            16051..16416
FT                   /locus_tag="cce_0019"
FT   CDS_pept        16051..16416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0019"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49371"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49371.1"
FT                   /translation="MAGFFGLFSGRKAKFVDEQDNTPSQPQKKEAFFLDNDSAKTLGDT
FT                   EFMRKPITIRRTFARGGELVQDISSLEKKKAGSNSVVSNKSKETSASQGTTSVNSDRRK
FT                   SDTSMDMFRNMARNMKK"
FT   gene            complement(16468..17781)
FT                   /locus_tag="cce_0020"
FT   CDS_pept        complement(16468..17781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49372"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49372.1"
FT                   /translation="MCILCNCFSFYQSKVGNKIKLIHSNLSMAIMVKKEVLFMSNGHGE
FT                   DLNASLILQELHKIAPDISITAMPLVGEGNAYRSLHLPLIGQPKTLPSGGIFYMNPLTL
FT                   LKDVFAGLISLTIYQIRTLLKYCSRYHLIIAVGDIFPVTMAYISGRPFVAFLVSTSSFY
FT                   EGKLQLPWLTRWCLRSPRCLAIFTRDAFTAEDLQQQGLHNAYFLGYPIMDILTPTGKNL
FT                   HLDDNIPTIALLPGSRVPEAIDNLELLLQVSESLATLEKVQFRVALVQAIKETHLKRLA
FT                   EKLGWQYHSLGILVKDTIRIECYYQAFADIIDNCNLAIGMAGTAVEQVVGLGKPVIQLP
FT                   GKGPQFTYAFAEAQMRLLGISVKTIGKSYKNPYLCTEATQTIQAILKDKNYLENCRKNG
FT                   QERVGKPGGSLSIATAIAKLLCSEQKIFQKSNKKKGLN"
FT   gene            17969..18325
FT                   /locus_tag="cce_0021"
FT   CDS_pept        17969..18325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0021"
FT                   /product="unknown"
FT                   /note="contains HesB/YadR/YfhF domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49373"
FT                   /db_xref="GOA:B1WYE3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49373.1"
FT                   /translation="MTQATQTPAKGIQLTETALKHVLMLREQQGKDLCLRVGVRQGGCS
FT                   GMSYMMDFDDPSNIGEQDEVFDYDGFQIICDRKSLLYLYGLVLDYSNAMIGGGFEFTNP
FT                   NANQTCGCGKSFGV"
FT   gene            18407..18832
FT                   /locus_tag="cce_0022"
FT   CDS_pept        18407..18832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0022"
FT                   /product="unknown"
FT                   /note="contains a TPR-like helical domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49374"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49374.1"
FT                   /translation="MTETAATAFEQGLERYKQGESLDTLIPHFKQICDRAPKNPTAWAC
FT                   LAWLYLLADKPELALKAAKKSVKIDNRPPQARINLALAMLDTGAKGVRDHIEAAQQMMS
FT                   LDEEIHKDVVENIEDGLSRKPDWKSLQRVKKWLLSPE"
FT   gene            19689..19770
FT                   /locus_tag="cce_RNA001"
FT   tRNA            19689..19770
FT                   /locus_tag="cce_RNA001"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG; tRNA-Leu1"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            20166..20432
FT                   /locus_tag="cce_0023"
FT   CDS_pept        20166..20432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49375"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49375.1"
FT                   /translation="MSKNITLELVLELAKQLTPIEQARLVKEMTPNKQTLNYDIPTEPI
FT                   PDEKQRLGLKKAGEAVDQMLIKHGVTEDELVEDFRKLREGHRS"
FT   gene            20432..20749
FT                   /locus_tag="cce_0024"
FT   CDS_pept        20432..20749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49376"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49376.1"
FT                   /translation="MSNETCLVLDANIIIRALMNKKNLSAEKALETLNILLNFITIVDR
FT                   SLYSQFEKNARERMRTRDIDDWPILALSLVFNCPIWTEDTDFFCAGVATWTTDRIHLLF
FT                   E"
FT   gene            20793..21221
FT                   /locus_tag="cce_0025"
FT   CDS_pept        20793..21221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0025"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49377"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49377.1"
FT                   /translation="MLTTKPRFQTFKEYLKYDDNSDKLYELFNGKLIEITPESGLNIEI
FT                   ANFLFLKFASLVGHRRVRGHGLELEVRGEPKNRYPDLTIIREEHIQQLSKRNTIRLFMS
FT                   PPLLVVEVVSPGDIQRERDYIAKRIQYQDCCIPEILDC"
FT   gene            21253..21369
FT                   /locus_tag="cce_0026"
FT   CDS_pept        21253..21369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49378"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49378.1"
FT                   /translation="MKGESYQEVGNFSQDNLVKSPNFPELKLTVAEIFQGIS"
FT   gene            complement(21413..22405)
FT                   /locus_tag="cce_0027"
FT   CDS_pept        complement(21413..22405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0027"
FT                   /product="hypothetical protein"
FT                   /note="contains a RelA/SpoT domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49379"
FT                   /db_xref="GOA:B1WYE9"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYE9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49379.1"
FT                   /translation="MTWIKPEYSKTQVGKAGDALIGKSDKLSFDEASEILSNWRGSHAF
FT                   PLNNVQSSLRNKARTIDPDFLITQRLKRIVSIKNELERFSTMKLHRMQDIGGCRIILNS
FT                   VDGVYKLVNDIKTSPSLDIQKIDDYITSPKESGYRSIHLISKYCGKKEEYKDLRIEIQI
FT                   RSKIQHYWATAVETIDTFTKQQLKTGNGDDDWFTFFDYMSKAMDNLERKQNVSNKITRE
FT                   IKNYEKKLKVMEKLTVYSIMGEVLEESKSRNGFFLLILNPENNFLNIQFFRTKQINLAT
FT                   EEYIKTEKNSPESNVVLVEAKSIQDLKKGYPNYFADSEKFLKYLKKVIK"
FT   gene            complement(22493..23080)
FT                   /locus_tag="cce_0028"
FT   CDS_pept        complement(22493..23080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0028"
FT                   /product="unknown"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49380"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49380.1"
FT                   /translation="MNSNTVSLSAPLNLDIDLTDEQFFQLCQNNRDLRFERTATGQLII
FT                   MPPTGSETSDRNAELTYQLRAWSRQSQLGKSFDSSGGFKLPNGAERSPDASWIHKDRWN
FT                   GLTAAEKEKFAPLCPDFVVELMSPSDSLEKTRLKMQEYRENGARLGWLINRRQQQVEIY
FT                   RPDQEVEILENPQFLSGEGVLPDFTLDLTDIW"
FT   gene            complement(23555..24754)
FT                   /locus_tag="cce_0029"
FT   CDS_pept        complement(23555..24754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0029"
FT                   /product="rfrA family pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49381"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49381.1"
FT                   /translation="MKTLTGILVLTSLALTPIVRAENAADLQQLMETGECIGCDLQDAD
FT                   LRNLDLSGANLEDANLINSKLHNSNLSNANLKGANLVNADMDGVTFRNANLQEAQMRGV
FT                   LMADADLEGANLQGADFTLHDGERAILTGSNLRNANLTGAYLRGIKLKEANLEGANLSY
FT                   TDFTTDYPRNSTAKTAFDMALLAVPFAIPGAVLGGVGAIVIPEAASYNADVSYANLQGA
FT                   TLTGANLQDINLHEANLRNANLENANLHHAYLVNSDFRYANLTGARLSDINMEGANFSY
FT                   ATLPEANFHLSYLVNTDFSHANLAHANLTEINMENANFSDANLVGAVFNSSYLVGANMS
FT                   DAMLTSAQLKDINMSGANLAAANLENANLSDSNLTNANLCGAIMPDSDVSQIGCTAVNY
FT                   "
FT   gene            25133..25804
FT                   /gene="hisIE"
FT                   /locus_tag="cce_0030"
FT   CDS_pept        25133..25804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisIE"
FT                   /locus_tag="cce_0030"
FT                   /product="histidine biosynthesis bifunctional protein,
FT                   phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49382"
FT                   /db_xref="GOA:B1WYF2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49382.1"
FT                   /translation="MGRLSMSSVFSDHPLSKAIPLDKIRYNEQGLVPAIAQDYLDGTVL
FT                   MLAWMNQESLQKTLETGETWYWSRSRQELWHKGATSGHIQKVKSIRYDCDSDALLISIE
FT                   QVGDIACHTGERSCFHQLEENEKLAPPADTLSGLYEIICQRRDNPVEGSYTRKLLEGGD
FT                   NKILKKIGEEAAEVVMACKDDEKEAIASEVADLFYHTLVALSYHQVDIKDVYRKLQERK
FT                   R"
FT   gene            25816..25968
FT                   /locus_tag="cce_0031"
FT   CDS_pept        25816..25968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49383"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49383.1"
FT                   /translation="MTFTKTANSLEEFLKLPETKPVCEYINGNDDHLPILNGLELELST
FT                   NEIFA"
FT   gene            complement(26024..28018)
FT                   /gene="feoB1"
FT                   /locus_tag="cce_0032"
FT   CDS_pept        complement(26024..28018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB1"
FT                   /locus_tag="cce_0032"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49384"
FT                   /db_xref="GOA:B1WYF4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49384.1"
FT                   /translation="MTHCHSPGVTLYPELTHKRVGVLGMPNVGKSTLFNQITGASAFVG
FT                   NWPGVTVDLLEAEVELEGETVEFVDLPGIYDLEGYSEDERVVQDFFERFPVNLVLVVLN
FT                   AGQIDRQIRLALQVKALGIPGILILNMVDEANHFGIDIDSQKLEEKLGMPVALVSAKYN
FT                   RGILPAKHKISQVLAQSQAVTVPQDLTLKIEAHQQISPSAIAEVLEDTVKMPSNLYRTF
FT                   TQRLDSLLLHPVIGLPLFFLTVYLMFEFVWEVGLPSQDIADAVTTWLQTVAIDPLTAGL
FT                   PAFFRGFLVDGLYGGLATVASFVPLVVIFFFMMAIIEDSGYFSRAAYMMDSIMYRLGLD
FT                   GRSFVLLIMGFGCNIPAVMGARVMRSRSLRFLTILIMPFALCSARLTVFVFIIDALFDR
FT                   TWGPLVLLSLYLISFLVAFGTGFLMKGQFASKEPFVIELPPYRFPTLKQIWLRGWGELR
FT                   EFLRRATGFITAGVVGVWLMTNLPQGTANPIGSAGLTIALGVPLMVGMVTGGNAVKAFV
FT                   QKGGAWIIVGVLGVLLLTNLPGTGDASYAVRLGEFFAPVLSPIGIPQELTIALIFGFIA
FT                   KEIIVGSLATIYHLADPGAIQATLAQTISPIQAYSFMLFCLLYSPCVATLATIRSEAKS
FT                   VKFTLFTVVYGLVLAWVVSFIFYQVASLF"
FT   gene            complement(28095..28325)
FT                   /gene="feoA1"
FT                   /locus_tag="cce_0033"
FT   CDS_pept        complement(28095..28325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA1"
FT                   /locus_tag="cce_0033"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49385"
FT                   /db_xref="GOA:B1WYF5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49385.1"
FT                   /translation="MKLLNLKPGHSAIVSAINIDDPGLSRRLEAMGFTVGQEVKLLRKA
FT                   WLKGPLHVRVGMTTEVAMRRHEAEGIELEMR"
FT   gene            complement(28863..29153)
FT                   /locus_tag="cce_0034"
FT   CDS_pept        complement(28863..29153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0034"
FT                   /product="unknown"
FT                   /note="contains a Ferritin/ribonucleotide reductase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49386"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR030907"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49386.1"
FT                   /translation="MSNEGYHEPIHELSSETIEMHRAITSLMEELEAIDWYNQRVDVCK
FT                   NKELKAILAHNRDEEKEHAAMLLEWIRRQDSVFDEELKDYLFTEKTIAHES"
FT   gene            29685..30089
FT                   /locus_tag="cce_0035"
FT   CDS_pept        29685..30089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49387"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49387.1"
FT                   /translation="MMLRKIASVSILSLGACSSLLLSSPALASRHCKDVYLKVVNNTGN
FT                   QIKVIDLDYYDPAYQKWRSEPVPNEVIPDGQVWQETRRLEKVNEKNIRIRVEYRIPDPE
FT                   RNGGWSREVLTKESSRQVCSPGKVYEITLG"
FT   gene            complement(30292..31392)
FT                   /gene="ald"
FT                   /locus_tag="cce_0036"
FT   CDS_pept        complement(30292..31392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="cce_0036"
FT                   /product="alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49388"
FT                   /db_xref="GOA:B1WYF8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49388.1"
FT                   /translation="MRNYMKIGVPKEIKDQEFRVGLSPNSVRALCDKGHQVSVETKAGI
FT                   GSGFTDQEYEQAGAKIVSSAAQAWEQELVVKVKEPLSQEYPYLNTAKILFTYLHLAADK
FT                   DLTKALLSSQITAIAYETVELSDRRLPLLTPMSIIAGRLSVQFGARYLEKQQGGRGVLL
FT                   GGIPGVFAGRVVILGGGVVGTEAARIAVGMGAQVQIFDISVERLAYLETLFGSRVELLY
FT                   SNVSSIETAVPNADLLIGAVLVTGKRAPTLVSRELVSKMRPGSVIVDVAVDQGGCIETL
FT                   RTTSHSSPTYVEEGVVHFGVPNMPGAVPWTATQALNNSTLPYVLKLANDGLDALEKDAS
FT                   LAKGVNVKDGVLVHPAVQEVFQDLIG"
FT   gene            complement(31478..32005)
FT                   /locus_tag="cce_0037"
FT   CDS_pept        complement(31478..32005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0037"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49389"
FT                   /db_xref="GOA:B1WYF9"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYF9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49389.1"
FT                   /translation="MAKVTENDLKELKDLIIGNHQVLENRLTNIETQLTNVDTRLTSVE
FT                   TQLTNVDTRLTSVETQLTNVDTRLTSVETQLTNVDTRLTSIETQLTNVDTRLTSVEKGQ
FT                   TQLKEKLIEVDKQLVMVDTRLETWKPAVDKIPDLAEKVGELKNWRQFVIISITATISGV
FT                   LGWFLRGGNTKP"
FT   gene            31977..32090
FT                   /locus_tag="cce_0038"
FT   CDS_pept        31977..32090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49390"
FT                   /db_xref="GOA:B1WYG0"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49390.1"
FT                   /translation="MRSFSVTFAIIYAQIIGTIFILLGAALSELSLKHFFA"
FT   gene            complement(32307..33455)
FT                   /gene="rfbW"
FT                   /locus_tag="cce_0039"
FT   CDS_pept        complement(32307..33455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbW"
FT                   /locus_tag="cce_0039"
FT                   /product="mannosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49391"
FT                   /db_xref="GOA:B1WYG1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49391.1"
FT                   /translation="MGKNSRSNIKCVSIYYLRMNNQSKLLINLSLLLSKPTGITVYAKN
FT                   VFPYLKSLEPTLLSSQQYQDFNTYLVPNNLTPEQGTKGHLNRLLWTQFRLPKIYHTSSA
FT                   SLLFSPVPEAPLYSQCRSVVMVHDLIPLRFPKKISPLTPYFKYYIPQVLKQAEHIICNS
FT                   QATAKDIVDIFNIPAQKITPILLAYDDQHFRPLTIQKNAGTVPYFLYLGRHDPHKNVNR
FT                   IIEAFANLKNNKNYQLWLAGPTDKRYTPKLIEQAQAFGIKQQLKILDYVEYEQLPIIIN
FT                   QALALVFPSLWEGFGFPVLEAMGCGTPIITSNISSLPEVAGDAGLLINPYNVEEITAAM
FT                   ETIARDDKLRSQLKILGLQQAKKFSWQTTGEKTLETLKQFLN"
FT   gene            complement(33404..34561)
FT                   /gene="mtfB"
FT                   /locus_tag="cce_0040"
FT   CDS_pept        complement(33404..34561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtfB"
FT                   /locus_tag="cce_0040"
FT                   /product="mannosyl transferase B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49392"
FT                   /db_xref="GOA:B1WYG2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49392.1"
FT                   /translation="MFKVSIDATPVRGKLTGIGVYTLNLIQALYRLQEENNFILDIYFH
FT                   PSVKNWLNRNLSTPELLTPYLQVSSLPIPVSVANILAKYVPFILPYFETHLDQPDIIQG
FT                   TDHYIFPYRKAIKIMTIHDLTFIKFPNYSTKIVKGYLKRIKRCLSWTDAIITFSESTKQ
FT                   DIIQLLNIDPNIIYVTPQASRYSPNYLTRQILYDNRNIIDYYLYKPYFLFVSTLEPRKN
FT                   ILTLIEAFEYLKQNYKIPHQLILIGKKGWNYKDIFNKINTSQFKDDIQHLDYISDELVA
FT                   IFYSQAEAFIYPSFYEGFGLPILEAMTLGSPVITSHTSSLPEVAGDAALYIDPTDYYQL
FT                   AQIMLKVIDNSTLRKEMINKGKIQAEQFSWEKTAEATLNVYQSII"
FT   gene            complement(34566..35738)
FT                   /locus_tag="cce_0041"
FT   CDS_pept        complement(34566..35738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49393"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49393.1"
FT                   /translation="MSQDEGQTLSPIFVSLIPNLMEGEGHILPYHQSVNKAVNKLGWKH
FT                   KITVPIDNKVDNLPSGWDACLNNYDLEEEGNIIQKFLRIQGTWQLSISIRNYLQTNVIN
FT                   QSELSVIFLERFIHLQLFALYLALLWVPTDQLSVWLLYRRDTHKDKTRSIYKFLNALIK
FT                   KQLPPGKFKLLTDSDRLSESLSSYFKETVMVMPIPHTDINHCNINALDSSHILCWWPGS
FT                   PREEKGLKIINNLVNYSGENTKNINLVCAEKTQLKSVENGVNLKLIDNHLTREQYYHWF
FT                   GLSQIILLPYSFPAYEGRTSGIFTECIMAGKTPLVTKDTWMAYELTKHNLPELIIDWQE
FT                   PSQVFDTIRKVIKSDIIQDKIKKMQQSYQQFHSVDNYACVINQIYQEMMI"
FT   gene            complement(35752..36318)
FT                   /locus_tag="cce_0042"
FT   CDS_pept        complement(35752..36318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0042"
FT                   /product="histidinol-phosphate phosphatase, HAD-superfamily
FT                   hydrolase subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49394"
FT                   /db_xref="GOA:B1WYG4"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49394.1"
FT                   /translation="MITTLTPYTQLQKALFLDRDGVVIKYVPYLSQPEQVELPLGAGEA
FT                   LKRWQDAGYLLILITNQAGVGRGYYTLEDVDNVHNYIIDEYGKFGVTFDDIFLCPHHPQ
FT                   ENCSCRKPSPKMLIDASKKHGISLSQSFFVGDAPSDVECAINAECEPVLVLTGRGQETL
FT                   ENIAKYPRKVEIFDSLQDTVKLLKP"
FT   gene            complement(36330..36920)
FT                   /gene="gmhA"
FT                   /locus_tag="cce_0043"
FT   CDS_pept        complement(36330..36920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="cce_0043"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49395"
FT                   /db_xref="GOA:B1WYG5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WYG5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49395.1"
FT                   /translation="MNYWIQHRLNCLEQAFNPKYCRALEHTIGIVARQFKAGNKLLICG
FT                   NGGSAADAQHIAAEFVGRFQLHRKGLPAIALGTNPATLTAWSNDYEFETVFARQVEAFA
FT                   QPGDILWGISTSGKSANVIRAMEMAKDLGLLTIGMAGNNGGMLKDLTDYPLFVSEYHTP
FT                   YIQEIHLITYHRICEQVEAQLFAKAGLEAQIAV"
FT   gene            complement(36942..37874)
FT                   /locus_tag="cce_0044"
FT   CDS_pept        complement(36942..37874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0044"
FT                   /product="putative GDP-L-fucose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49396"
FT                   /db_xref="GOA:B1WYG6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49396.1"
FT                   /translation="MTMKILITGASGFLGTNLCSQLETQGHELIKLNSKNCDLTQPDSL
FT                   LQFNDLHYDQIYHLAAWTQAGDFCLYHPGEQWIINQQMNTNVLTWWQKHQPQAKFICMG
FT                   TSCAYDPDLPLVEENYLTGMPISSLFTYAMTKRMLYAGLLALNKQYGLNYLCLVPSTLY
FT                   GTGYHTDGRQMHFIFDLIRKIIRGKLYGEPVILWGDGTQSRELVFVEDFAKIAMNLAQT
FT                   VNNDLINIGAGEEFPIRHFAKLICERVGYDFNDIQFDTSRYVGAKSKCLVVDKLKQSLP
FT                   NFGLTPLELGLTKTIEWFWQEQEKLVPAH"
FT   gene            complement(38126..38692)
FT                   /locus_tag="cce_0045"
FT   CDS_pept        complement(38126..38692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0045"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49397"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNX3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49397.1"
FT                   /translation="MLKKRVEYWKVIRGIRVENLVFIDESGVNLAMLRLYARSLKGTRA
FT                   RGEKPQKRGHNISIIGALSLEKILAFANIYGSVNGVTFEAFIVTELVPKLWTGACVVMD
FT                   NAKIHLGEIVREAIEEAGASLMYLPPYSPEFSPIENFWSKVKAILRKIKARNYKDLIDS
FT                   LTFAMLQVTQKDIRNWFAHCCYCTS"
FT   gene            complement(38709..39074)
FT                   /locus_tag="cce_0046"
FT   CDS_pept        complement(38709..39074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0046"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49398"
FT                   /db_xref="GOA:B1WP35"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP35"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49398.1"
FT                   /translation="MRPYSIDLRNKIIEIWKKEKISIRKLAQHFGVSKSFIQKLIKKYK
FT                   ETGDIRPLPQGGRPPCKLNSEQLIILIELMEKNNDATFEELSELLEKATGVKVGKSTIG
FT                   RISQKLNYSLKKNLICS"
FT   gene            39503..39580
FT                   /locus_tag="cce_0047"
FT   CDS_pept        39503..39580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49399"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYG9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49399.1"
FT                   /translation="MKCDLEEINFRKANLKGTNLQKANL"
FT   gene            39608..39841
FT                   /locus_tag="cce_0048"
FT   CDS_pept        39608..39841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49400"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49400.1"
FT                   /translation="MHEFIYPVWENGNIDWNNGDSLKKITGKTGGTANLTQANLKDANL
FT                   TEILWMTPEQIKQAYNWETAKYDPDFKKQLGL"
FT   gene            39939..40235
FT                   /locus_tag="cce_0049"
FT   CDS_pept        39939..40235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0049"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF172"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49401"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49401.1"
FT                   /translation="MFSYEITSPTEARNSLFQLLEKVAKDHQVCIINRNDGENVALISE
FT                   SDLRSLVETVYLLRNPANARRLFDAIDESITGKIQPQTLEELKQELGIEQEEE"
FT   gene            40216..40527
FT                   /locus_tag="cce_0050"
FT   CDS_pept        40216..40527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0050"
FT                   /product="putative addiction module toxin, Txe/YoeB"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49402"
FT                   /db_xref="GOA:B1WYH2"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49402.1"
FT                   /translation="MNKKKNKQKNEKKSPIVKQIPGFSQQFKEDLKWWFKTDPKKASRI
FT                   LDLVTEVMKDPFQGIGKPEPLKYMDSNIWSRRIDLEHRLIYRVSQTQLDFLSCRFHYE"
FT   gene            40552..40812
FT                   /locus_tag="cce_0051"
FT   CDS_pept        40552..40812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49403"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49403.1"
FT                   /translation="MTQSITKSAVNIPPLENGDLGEIRFAVRLTRLEFETRYQEMTHVK
FT                   KAELIEGIVYMGSPLRINKHGAPHANIMAWLGFYKAYTNGV"
FT   gene            41733..42119
FT                   /locus_tag="cce_0052"
FT   CDS_pept        41733..42119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0052"
FT                   /product="DUF1499-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49404"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49404.1"
FT                   /translation="MFNFSGTRPNNLGVKNGQLTACPGTPNCVNSQSSDPQSKIAPLPM
FT                   ISITELKKIIESMERTTIIEETNDYLYAEFKTPLMGFVDDVEFYLDSDQNVIHVRSASR
FT                   LGKSDLGVNRKRVEEIRSKIEANN"
FT   gene            42170..43123
FT                   /locus_tag="cce_0053"
FT   CDS_pept        42170..43123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0053"
FT                   /product="unknown"
FT                   /note="contains a senescence marker protein-30 (SMP-30)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49405"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49405.1"
FT                   /translation="MAEPFTIGGQNGWYHDQGHWAGYFHTYDNFKQSNIDDKSRIIHVF
FT                   LPRDYEYSHESYPVIYMNDGDTAFFSGGQYYKSWNMGQILTRLYVTNQIRRVIVVAICP
FT                   IDRNYEYTHAPIKEGNWGGLQGYSDYVAFEVKPFIDANYRTLSNPENSMVLGSSHGGLA
FT                   AFYTAIKHPNQFQCVAALSPSFWVGLDSMIDPCFLDLSGDLLGSLEYSALIFAGLQTLQ
FT                   DPQLQPKIYLDWGLIREGGYHNAFMEARATARGREMRDLLINKFGYRYNENLFVVEDPI
FT                   GQHSEESWSGRMETVLQHFLGWPVLMKQLLEQQTVG"
FT   gene            43196..43266
FT                   /locus_tag="cce_RNA002"
FT   tRNA            43196..43266
FT                   /locus_tag="cce_RNA002"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA; tRNA-Gly1"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            43329..44159
FT                   /gene="lgt"
FT                   /locus_tag="cce_0054"
FT   CDS_pept        43329..44159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="cce_0054"
FT                   /product="polipoprotein diacylglyceryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49406"
FT                   /db_xref="GOA:B1WYH6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49406.1"
FT                   /translation="MLLGFQFQSPGPILIELGPLVIRWYGFLIASAVLIGVTLSQWLAK
FT                   RRHVNPDLIGDLAIWLVIGAIPCARLYYVIFQWQEYAQRPEDVIAIWKGGIAIHGAIIG
FT                   GTIAALIFARLNKISVWQLGDLVVPSLALGQAIGRWGNFFNSEAFGAPTNLPWRLYIPV
FT                   NNRPVEYLTSEYFHPTFLYESLWNFLVFLLLLWLFFWGLKHSHRFRVGTLSLVYLIAYS
FT                   CGRIWIEGLRTDSLMLGPLRVAQVISLVMISVGILGLVWLYRLQKPLPDVVSPQ"
FT   gene            44174..46723
FT                   /locus_tag="cce_0055"
FT   CDS_pept        44174..46723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0055"
FT                   /product="putative metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49407"
FT                   /db_xref="GOA:B1WYH7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49407.1"
FT                   /translation="MANFYLSYSFSSKESTRLSTEISFDVFTLTSHNMKTLQLLKRNLE
FT                   KLRQQYKNGRRSPLHEAQSLSKKAPSQRPHQSDWLTKLHKSKPIRQLHPPLMWGLTVIS
FT                   LTSVIGYRFYNQPQLSVGTVSPVKVVAPKDGTFEDEKTTEEKRKEVRTGIIPILQRDSQ
FT                   LTTQLKGELTKTITEIRQFRQQVGAFPFISVSSIPLKTQQYLRSVDEKTWQIIRSTLVN
FT                   NNSETADNLQPQTQEAITQLNSYENTTSSTTLKGLLDTIEQSRQRYHAAKREVLNAKTS
FT                   NLTPELLGTFLNLDDNTWQTTEKTLNITSNRILLQGLPPGMPDYLLNEIIKNQLESTAA
FT                   SVPQTAITDLLMKILQNKHNLTVDKEATKQRAEQAAQAVEPVIVEVKAGDVIVEAGEKI
FT                   TQEEFVLLDSFKLSRRGINWVGLGISAVIVMGTVTIFCVVSHKVHRPMRRRDHILLCML
FT                   SLSTPLLAIFNLGYTNLPAVGLLTSSFYGPTLAITQVVLLSGLSTFAATTINWSYVLAG
FT                   TAGGLLAASVAWKLRSRDELACLGGVVGLVQGSLYFIGYLIVAPVAGTIWSIVLPEAII
FT                   YGLSGIAWSVMALGISPYLERLFDLVTPIRLVELANPNCALLKRLATETPGTFQHTLFV
FT                   ACLAEAAARELHCNVELIRAGTLYHDIGKMHDPMGFIENQMGNPNKHDVINDPWVSVDI
FT                   IKKHVSEGLVMANKYGLPRVIRDFIPEHQGTLLISYFYYQAKQEAERNGTQMIAEEEFR
FT                   YAGPIPQSRETGIVMLADGCEAALRSLKEATPETALAMIQKIFKARWRDNQLKDSGIKY
FT                   EELPIIAEVFVKVWQQFHHQRIVYPKAALEPQNNKQA"
FT   gene            46743..47918
FT                   /locus_tag="cce_0056"
FT   CDS_pept        46743..47918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0056"
FT                   /product="hypothetical protein"
FT                   /note="contains an S-layer homology (SLH) domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49408"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49408.1"
FT                   /translation="MVDFFIMYRYIIVSLLFPFVTACSSISDLENRFSPNPELAEKQEN
FT                   VTQPTLEIPKNFPNIIPQYDNSKLQEISDNLTNKQGLIRWSSSDSIDQISKFYQEEFNN
FT                   NNWEISQSFNPENNTLIAQKDGLEVQLSFLSASNGNTDYSIRYQTLTDSTASNTEEKNT
FT                   SSQTKNDDSVNLNNVPESLQSYVKDVRQLGTVNLSNTNNKTVNESGIINRRTYARWLVE
FT                   TYNKFYENTPAKQIRLGVETSQPAFSDVSSNDPDFAVIQGLAEAGIIPSPLTGNSSASL
FT                   FRPNNPLTREDLVTWKVPLDMGKGLPQASIDNIKETWGFQDTTKIDTKAIQALYADFQN
FT                   GEQSNVRRVFGYTTLFQPDKGVTLAEAAASLWYFGYQGDGLSAEDVLSINN"
FT   gene            47940..49280
FT                   /locus_tag="cce_0057"
FT   CDS_pept        47940..49280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49409"
FT                   /db_xref="GOA:B1WYH9"
FT                   /db_xref="InterPro:IPR022227"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYH9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49409.1"
FT                   /translation="MSDIRESFIPFRRTDIIDLCLQDGKLQGKDVQLFQDFCDLLAAFF
FT                   HFRFHYTLEEIKDNYTVFNPNSDVQTLQNPSLEQYEEMENNVLQGFKYILERANYIQLP
FT                   DEIIQKSLQEKSLINLQTDVDFDDFDQLYCYYRGDIDKIITLKKFKVFEQEKIIDILER
FT                   VVLLIKFKGSGYFQAKAKKNKKYQDLNFTPGKMYLYFYKNIPKLDLDLLFPNIKTSMTW
FT                   KDKLLFGVPAIGAAVPLVVRAIPNILLIIVAILLLLKADSVVDSIEVDQRKVRDIMPIL
FT                   VATLSLTMTLGGFAVKQYTKYKSKEIKFQKEVSDTLFFKNLANNSSVFQALVDIAEEEE
FT                   CKEIILVYYHLLTSQEKLTPENLDHIIEQWMMEKLGIHIDFDIHGPLNNLEKIRGKIVY
FT                   EDNNEEQIKEVPLLSYDQQGNINILSLEQSKMILDYVWDNAFQYNGC"
FT   gene            49388..49675
FT                   /locus_tag="cce_0058"
FT   CDS_pept        49388..49675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0058"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49410"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYI0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49410.1"
FT                   /translation="MTEDRLTRIEKIVESNAKSIEALSDAVAQDRKERAQERKEWAQDR
FT                   RRIFEWMARLSAAQRDFYEVQADYIRHIEEIEDRLAQILDRLTPQNEDQP"
FT   gene            complement(49746..50306)
FT                   /locus_tag="cce_0059"
FT   CDS_pept        complement(49746..50306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49411"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYI1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49411.1"
FT                   /translation="MFNYTYLLNIGLYYSNAFKISFGNGSSKFSGTVNSPAHKPNGRNS
FT                   LLKIKSLSDFYQRISAYSDYVVYNVLKTLCYDLVRLEYDINYFGDEEIYYVLEWEEYLE
FT                   ECLKVFHELESFLSKNKCLTIEKCQYSNYDKYMTAKYHDPEKHRLNEAITEFFTPGYDD
FT                   SLVNEVLSDIASRYTGRNYFLNY"
FT   gene            complement(50403..51458)
FT                   /locus_tag="cce_0060"
FT   CDS_pept        complement(50403..51458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0060"
FT                   /product="unknown"
FT                   /note="contains DUF318, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49412"
FT                   /db_xref="GOA:B1WYI2"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYI2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49412.1"
FT                   /translation="MILLVIFSKKSYQLSIINYHFLNMSQLNYIYTLFISNLLISLPFL
FT                   LLGIVVSSGLLVFIDEHQLVAKLPRTRILAVIIGSSLGFLLPLGQYGNLPIVRRLLLQG
FT                   LPIPLCISFLIASPTVNPFVISNSWEVLGDHPRLVFLRILGAWLIAIIVGLIFSAYPEK
FT                   SVIINESSSVLQSRSTLVHSGTILAPSEEFQPFHRAGNLIYEYQGNIRTSGNIWQQLSL
FT                   FVENIIKEFIELGSILTVGVAISTTCQFFLPQAQLFQWGENPLNQILIMIVFGLLLSLN
FT                   SLGSAYFLTPVLSSVLYGSAFVFLLLNSLFNISSLILLLGIIRIKFASYIFILTAQLIL
FT                   VLGLVLNFYIS"
FT   gene            complement(51515..52972)
FT                   /gene="glcD"
FT                   /locus_tag="cce_0061"
FT   CDS_pept        complement(51515..52972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="cce_0061"
FT                   /product="glycolate oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49413"
FT                   /db_xref="GOA:B1WYI3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR004490"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYI3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49413.1"
FT                   /translation="MLLNRIFNDTDKKWRPIIKALEAAIGKDGVVRRKEELLTYECDGL
FT                   TAYRKRPAVVVLPRTTEEVAAAVKICHDYQIPWVARGAGTGLSGGALPVENCVLIVTAR
FT                   MKQILNIDLENQRVTVQPGVINNWVTQAVSGAGFYYAPDPSSQIICSIGGNVAENSGGV
FT                   HCLKYGVTTNHVLGLKLVIPDGSIIEVGGSIPEMPGYDLTGLFVGSEGTLGIATEITLK
FT                   ILKTPETICVVLADFTNVESAGQAVADIISAGVIPAGMEIMDNFCINAVEDTVKTNCYP
FT                   RDAAAILLVELDGLSVEVAAYKEKVAEICRKNGSREITTANDLETRLKLWKGRKAAFAA
FT                   AGNISPDYFVQDGVVPRTQLANVLEKIEQLGAEHGYRIANVFHAGDGNLHPLILYDNSI
FT                   PGQWEEVEKLGGEILKLCVELGGSLSGEHGIGSDKNEYMSYMFNEIDIETMQWVRQVFN
FT                   PDNLANPGKLFPTPRTCGEAANAKKLS"
FT   gene            53118..53684
FT                   /locus_tag="cce_0062"
FT   CDS_pept        53118..53684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0062"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49414"
FT                   /db_xref="GOA:B1WYI4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYI4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49414.1"
FT                   /translation="MALYNMTLQKWKILKSNFIIDNQWCRVRQDQVQLSDGAIIDDYFV
FT                   NVRPEIALILPITPHQEIVFVRQYRHGVQEILLELPAGTFDPKKEDSFSAAKRELEEET
FT                   GYIAQELIFMTTIYDNPVKDDNKIHIFVGLNVEKTGKVALDITEEIEVILVPIKDVIDK
FT                   IMSGDICVAGTISTIFMGLEFINEQ"
FT   gene            53783..54307
FT                   /gene="ruvC"
FT                   /locus_tag="cce_0063"
FT   CDS_pept        53783..54307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="cce_0063"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49415"
FT                   /db_xref="GOA:B1WYI5"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1WYI5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49415.1"
FT                   /translation="MEKIHSPNSELLTPNSGWLGIDPGLAIVGWAMLQESEQQLPLIID
FT                   YGTIETNKQLSTSQRLLEIESDLGELLTEFEPQGIAIEMPFFNRTIKAAGGVMQALGVI
FT                   NLVCYRETNIEPIFLHQASWKCHLGDGKAKKKEVAQMITTLFNLDKLPIDDSVDAIAIA
FT                   YAGLCGLRNNI"
FT   gene            complement(54304..55362)
FT                   /gene="argC"
FT                   /locus_tag="cce_0064"
FT   CDS_pept        complement(54304..55362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="cce_0064"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49416"
FT                   /db_xref="GOA:B1WYI6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WYI6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49416.1"
FT                   /translation="MGESEKISVGIIGASGYGGVQLVRLLQEHPLVDIVYLGGKGSAGQ
FT                   TYAEIYPHLGHAVDLTIEPIDTEAIASRCQVVFLGLPNGLACDIAPPLIAKGCKVLDLS
FT                   ADYRFKNLETYSSWYNKDRSDLDTAKTAVYGLPELYREEIKSASLIGCPGCYPTASLMA
FT                   LSPLLKQGLILPETTIIDAKSGTSGGGRQAKTHLLLAEAEGSFGAYGVAKHRHTPEIEQ
FT                   ISSDLAGHEVKVQFTPHLIPMVRGILSTVYATLRDPGLVREDLLTIYSAFYRSSPFVKI
FT                   LPNGLYPQTKWACGTNLCYLGIETDPRTDRVIVLSAIDNLIKGQAGQAVQCLNIMMGWE
FT                   ETLGLPQLCFYP"
FT   gene            complement(55575..56909)
FT                   /locus_tag="cce_0065"
FT   CDS_pept        complement(55575..56909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0065"
FT                   /product="probable transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49417"
FT                   /db_xref="GOA:B1WZ51"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ51"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49417.1"
FT                   /translation="MSLPALISISSFIGVMFAIMTERLHITAAAFLGALILVFAHIMTL
FT                   QEAFDYISKSHGTLALFFGVMVLVRAFEPTKIFEYLATQMVLMAKGSGKLLVIGIIGIT
FT                   TPICAILPNATTVMLLAPLIPPIAQEIGVDFVPLLILMVFVANSAGLLTLVGDPATFIV
FT                   GDAINLSFTDYLTRLSLGGAIAVITILVMAPFLFAKIWNKQFTNLAELPHPKINHPRVL
FT                   MLGGIIIAFVLLFFVIGESLPTPIPPASVALFGAVLALILAHQSKIDTVNNIFRDLDWS
FT                   TLLFFMSTFVLIGGLQKTGVTSYLSKLLAVVIGHNIILGALVLLFLVGILSSVVPNIPL
FT                   VVAMVPLLKEYIVNINLASPEILNPDFSGHLPPEVLPLFYAMMFGATLGGNGTLVGASS
FT                   NIVAAGVSEQHGKPISFKTFLKYGLPVMTMQLVVSALYVAIFLLK"
FT   gene            complement(56934..58718)
FT                   /locus_tag="cce_0066"
FT   CDS_pept        complement(56934..58718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0066"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49418"
FT                   /db_xref="GOA:B1WZ52"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ52"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49418.1"
FT                   /translation="MEILLTVSIMVMALIAFAFEWLPADLTAISVTVILMLLKLVSPEE
FT                   GISGFANTATITVMAMFILSAGITRTGVIQVVRDLLMKWGGKNASQQILVMGLIVGPIS
FT                   AFINNTAVVAIFLPIIEAWCKQQKISVSKLLIPLSYVTILGGMLTLIGTSTNILASGVS
FT                   KQLGYGEFSLFQFTGLGIITFLIGLVYLMIAAPKLLPERIPVKSHLISENYGLKDYVTE
FT                   LIILPSSSLVKQSLRQSGIQRKFDIDVLELIHNDTHFSQPLADKKLSVGDILLVRGSRE
FT                   SLLQIKDERGVEILADFKFSQLEEEITKNEEKVAEVLVLSNSRLIGSTLKDLRFRQRYN
FT                   ATVLAIRRGEELVRERLGKVSIKFGDLLLVQAPKESFIGLQTTRELLVLEERELETLRT
FT                   HKAWTALAIVFGVILLAALSILPILVSSLMGVILMVMTGCLKPGEIYGAVRWDIIFLLA
FT                   GLIPLGIAMENSGTTEWLANLLANLGGNFSGYWILTCFYIITSLMTEILSNNASVVLMI
FT                   PIAAEVAKSLSLNPMAFIFAVTFAASNSFLTPIGYQTNTMVYAPGGYKFSDFIKIGLWL
FT                   NLLFMIVTPLLITLIYGL"
FT   gene            complement(58742..61582)
FT                   /locus_tag="cce_0067"
FT   CDS_pept        complement(58742..61582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0067"
FT                   /product="cation-transporting ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49419"
FT                   /db_xref="GOA:B1WZ53"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ53"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49419.1"
FT                   /translation="MTFPTTSNQVSPVFPEIGFPWHTLSAEDSLNKFHSDQDQGLTLDQ
FT                   VHQRQKYFGPNELKDTGGRSPLTILWEQFTNIMLVMLMAVAVISAVLDMRKGTFPKDAV
FT                   AIFSIVVLNGLLGYLQESRAEKALAALKRLSSPKVRVIRHGNVQEISAKELVPGDIMLL
FT                   EAGVHIAADGRLIEAQNLQIRESALTGEAETVNKQAEIILPEDAPLGDRLNLVFQGTEV
FT                   VQGRAKVLITHIGMDTEIGRIASLIQGVETEDTPLQQRMSQLGNVLVSSSLVLVVLVVF
FT                   VGVLRSGWQNFEELLEVSLSMAVAVVPEGLPAVVTVTLAIGTQRMVRRHALIRKLPAVE
FT                   TLGSVTTICSDKTGTLTQNKMVVQQIQTGTYAYQVTGEGYAPDGEIIAQDSDEYEINEE
FT                   VKQLLTACVLCNDALLQKRGQHWEILGDPTEGALLTLAGKGGLYREDLWLEMPRVAEIP
FT                   FSSARKRMSVIVRVFSNNKTTEETLEAEFSSLVSSSYLMLTKGSPEIVLERCTAVYQGN
FT                   HVVPLSDDQRKHILAHNDRWAGKGLRVLGFAAKPLANIPEDDQEEMAENGLIWLGLVGM
FT                   LDAPRKEVKGAVLRCREAGIRPIMITGDHQLTAQAIATELGIAHAEDAILTGRDLQHIT
FT                   PRELEQLVSNVSVYARVAPEHKLQIVQALQNKGEFVAMTGDGVNDAPALKQADIGIAMG
FT                   ITGTDVSKEASDAILLDDNFATIVAATEEGRVVYDNIRRFIKYILGSNIGEVLVIAAAP
FT                   LIGLGGVPLSPLQILWMNLVTDGLPALALAMEPAEPNVMQRPPYSPRESIFSRGLGLYM
FT                   LRIGVIFAILTILLMVWAYDYVKTPGLAGDPNRWKTMVFTTLCLAQMGHALAVRSDSQL
FT                   TIQLNPFSNPYVLGAVTFTTLLQILLIYVAPLQSFFGTHFLSPTELLICFGFSALMFVW
FT                   IELEKLVSRWFFLRQK"
FT   gene            complement(61604..62221)
FT                   /gene="exoD2"
FT                   /locus_tag="cce_0068"
FT   CDS_pept        complement(61604..62221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoD2"
FT                   /locus_tag="cce_0068"
FT                   /product="exopolysaccharide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49420"
FT                   /db_xref="GOA:B1WZ54"
FT                   /db_xref="InterPro:IPR010331"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ54"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49420.1"
FT                   /translation="MLYSMNLKFSQDIETLLHHLILHPLTLREILCQTSERGFCLTISL
FT                   LVLPFLFPMPPGFSSILGGGCLLLSLQMALGRRSPWLPKQVATFQFPKSLTKHLLKNLK
FT                   KVTKWLEKFCRPRFFQVANHPFVWRGNGLCMAWLAILLMLPIPFTNPIPTIGILVLAVA
FT                   TLETDGLLICVGYVLTAMNTLFFGFLGYLAWSTPQLLPQIFQ"
FT   misc_feature    complement(62525..62646)
FT                   /note="ydaO/yuaA leader; Rfam score 43.60"
FT                   /inference="nucleotide motif:Rfam:RF00379"
FT   gene            complement(62560..62691)
FT                   /locus_tag="cce_0069"
FT   CDS_pept        complement(62560..62691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0069"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49421"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ55"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49421.1"
FT                   /translation="MNRVKESQPSFSRPYKGKRRKRGNQQWGAFLGKRQLERDNSQS"
FT   gene            62771..62899
FT                   /locus_tag="cce_0070"
FT   CDS_pept        62771..62899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49422"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ56"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49422.1"
FT                   /translation="MSQLLDFQPIQSILFNPCYIIKKNDKSENTNSLLTFAINSFN"
FT   gene            62924..64537
FT                   /locus_tag="cce_0071"
FT   CDS_pept        62924..64537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0071"
FT                   /product="unknown"
FT                   /note="contains a GTP-binding protein, HSR1-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49423"
FT                   /db_xref="GOA:B1WZ57"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ57"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49423.1"
FT                   /translation="MPLPRLIILILGLSVILGLIIWLINSIYRLYISISFTAPLLANFL
FT                   IFLIMGLLGLLIYAFIYYFNIFSSRRSKRRRDQRYRHLKLPEQKTEAAQENLNAIRRQL
FT                   ETIQDKVAQKALLNRSQEIAENLNRGEFKVVIFGTGSAGKTSLVNALLGEIIGQVQATM
FT                   GTTKIGETYALKLKGLSREILITDTPGILEAGIEGTEREKLARQLATEADLLLFVVDND
FT                   LRQSEYKPLQILVDIGKRSLLVFNKVDLYTEEEETQILQQLRERVKSFIPEQDVISVAA
FT                   NPQTFPSQTGQTIQPSPDILPLIKRLATILRAEGEDLIADNILLQSQRLGEEARQLIDR
FT                   QRKRQSDQIIDRYQWISAGVIAVTPLPVVDMLATAAVNAQMVIEIGKVYGCEINSDRGK
FT                   ELALSLGKTLVSLGVVKGAVDLLGKALQLHIATYLVGKAIQGVTAAYLTRIAGKSFVEY
FT                   FRQDQDWGDGGITEVVQRQFQLSRKDEFLKAFVKDAITKVVKPLSDSWEEETEEIEDST
FT                   LLKQPPLQQQAVLEEEEDDW"
FT   gene            64702..64992
FT                   /locus_tag="cce_0072"
FT   CDS_pept        64702..64992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0072"
FT                   /product="UPF YGGT-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49424"
FT                   /db_xref="GOA:B1WZ58"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ58"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49424.1"
FT                   /translation="MDSSITQLIFQTLSAFLNIYLVLLFVRILLSWFQSAEWAMNAMSF
FT                   LSPITDPYLNIFRSIIPPLGGIDFSAILAILALQFLSSAIDSLYVSSMTGF"
FT   gene            complement(65167..65616)
FT                   /locus_tag="cce_0073"
FT   CDS_pept        complement(65167..65616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0073"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49425"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ59"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49425.1"
FT                   /translation="MLQSIRTYAIAIIIGCVFSLLTSFWSQPALALTNIDLFDISYKDC
FT                   PPELAEGNVTSGGSSLPADCYIITGKAKNTSGKTVYDADVFGRILDANNEPALQNRSRV
FT                   GSIAEVPPGVSDFEVRITVPANQPTPLKLKKFKASGFTTKVSPIF"
FT   gene            65711..66640
FT                   /locus_tag="cce_0074"
FT   CDS_pept        65711..66640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49426"
FT                   /db_xref="GOA:B1WZ60"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ60"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49426.1"
FT                   /translation="MVRRFIQCLPILLAVSLLTLSIVTITHEFKAHNPTEILHYLSNLP
FT                   TTRKIGVIALTSLGYFIMTGYDFLGFHYIDKFLKPSKIIITAFISYAVGNTIGFTAFSG
FT                   TAIRYRFYGSWGISKLKIAQLIIFTHLTFWVGLLGVSGVVFLIDPLSLPNILNLPFQSA
FT                   HPIGFIFLILVSVYFLISFFRKRPLKIGSEFINFPSPKISLASIGIAAMDWGVASGVLY
FT                   LLLPLSKIVSFPGFFGIYILGLTAGLISNVPGGLGVFETVILLSLPNTISQADILGGLI
FT                   AYRAIYYFLPLIVAIILLIIKEIQQQRV"
FT   gene            complement(66754..66861)
FT                   /locus_tag="cce_0075"
FT   CDS_pept        complement(66754..66861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49427"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ61"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49427.1"
FT                   /translation="MRYSNHLKTLALGLWFQNSDTYKSSKNLKNNLKSS"
FT   gene            67186..67575
FT                   /locus_tag="cce_0076"
FT   CDS_pept        67186..67575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0076"
FT                   /product="putative PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49428"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ62"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49428.1"
FT                   /translation="MIVLDTHIWFWYINESFEQFPLEWVEKIRQAEGVGVSSISCYKIV
FT                   LAHSKGRLEINMDIQQWLIDALEPSGRELLPLTAEIAVRAVNLSPIHKDPFDRIIITTS
FT                   LKYQAKLASIDGLLRQYPELKNYLM"
FT   gene            67676..71257
FT                   /gene="metH"
FT                   /locus_tag="cce_0077"
FT   CDS_pept        67676..71257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="cce_0077"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49429"
FT                   /db_xref="GOA:B1WZ63"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ63"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49429.1"
FT                   /translation="MNSTFLNHLNSPKRPVLVFDGATGTSLQSQNLTADDFGGPEYEGC
FT                   NEYLVHTKPEAVEKVHRGFLEVGADVIETDTFGGTSIVLAEYDLADKAYYLNKKAAEIA
FT                   KKMAAEYSTPEKPRFVAGSMGPGTKLPTLGHIDFDTLRDAYIEQAEGLYDGGADLLIIE
FT                   TCQDVLQIKAALNAVEAVFEKKRNRLPIMVSITMETMGTMLVGTEISAALAILEPYKID
FT                   ILGLNCATGPEQMKEHIKYLSEHSPFIVSCIPNAGLPENVGGQAHYRLTPIELKMALMH
FT                   FIEDLGVQIIGGCCGTRPDHIKALSELSQDLTPKERHPDYEPSAASIYSTQPYIQDNSF
FT                   LIVGERLNASGSKKCRQLLDAEDWDSLVSLAKSQVKEGAHVLDVNVDYVGRDGVRDMHE
FT                   LASRLVNNITLPLMLDSTEWQKMESGLKVAGGKCILNSTNYEDGEERFLKVLELAKKYG
FT                   AGVVVGTIDEEGMGRTADKKFEIAKRAYNAAIDYGIPAHEIFFDPLALPISTGIEEDRE
FT                   NGKATVEAIKRIREELPGCHIILGISNISFGLNPAARQVLNSVFLYESMQVGLDGAIVS
FT                   ASKILPLVKIEEDHQKVCRDLIYDRREFDGDICTYDPLTKLTELFAGKTTKKDPSKTAS
FT                   LPIEERLKQHIIDGERLGLEDALSEALKQYPPLDIINVFLLDGMKTVGELFGSGQMQLP
FT                   FVLQSAQTMKAAVAYLEPFMDKEEGEENDSGKGKFLIATVKGDVHDIGKNLVDIILSNN
FT                   GYKVINLGIKQPVENIIQAYEEHQPDCIAMSGLLVKSTAFMKDNLEVFNERGIDVPVIL
FT                   GGAALTPKFVYEDCQNTYKGKVVYGKDAFSDLHFMDKLMPAKSAENWDNLQGFLGEFTD
FT                   NNSLFQEERGEKAAEKATEKNGKSSTQETPTVIDTKRSEAVEILEPATPPFWGTKILKS
FT                   NEFDLNEIFWYLDLQALIAGQWQFRKPKDQSREEYEAFLAEKVYPILEEWKQKVVTENL
FT                   LHPTVIYGYFPCQSQDNSLLVYDPETIRNANNKIPEDLDPIWKIDFPRQKSGRRLCIAD
FT                   FFSPKESGKIDVFPMQAVTVGDIATEYAQKLFAANDYTNYLYYHGMAVQTAEALAEWTH
FT                   AKIRRELGFADKEPDNIREMLQQHYQGSRYSFGYPACPNIQDQYKQLEVMGCDRINMYM
FT                   DESEQIYPEQSTTAIIAYHPVAKYFSA"
FT   gene            71619..74267
FT                   /locus_tag="cce_0078"
FT   CDS_pept        71619..74267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0078"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49430"
FT                   /db_xref="GOA:B1WZ64"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ64"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49430.1"
FT                   /translation="MQPHLMPQRLYQWFKSRNFALNATDTRYALVEASLIGVLSAIAAL
FT                   ILKQGVGWLGGWRVALANEFGGIVVLPLGGLILGYLAGWIIETLSPTATGGGITQVKAA
FT                   LARYPVPLSLRVAIVKLIGTILVLGGGLTLGRRAPTVHIGAALAAQLSSWVPTSPEHRR
FT                   QMIAAGAAAGLAAGFTTPIAGVLFVIEELMRDVSGLTLETAIVASFTGAVVSLILQSST
FT                   LNLPSSLLELPDITFSALDIPFYLLLGILAGVLGALFNRGLLLSVKIQHQFNLPLSWRI
FT                   GLMGMVSGIIIAVLPPFFRDNAGLRIILVTGELDWSRILLAFVAHFFLTILAYSANTPG
FT                   GLFGPALVLGSALGYLVGDFEQFLTGTGTQSSYALAGMGAFFTAVVRVPVTAIVFVFEL
FT                   NTDFNIVLPLMVTCAVSYIVAESVSRGSLYEHMLHARGIYINEAATGQDFLSKLTASQV
FT                   MESHVETLSSDLSLDEVLQAMSNSTHRGFPVVEQGQLVGIVTQTDLAKLKKVPGYTPLS
FT                   EFMTRRPITVQAESSLSDVLYLLNRYQLSRLPVTEGHKLVGIITRTDIIRIEANQLQGD
FT                   DTTINEVVPDPSYIAYQTRAPLAGEGRILLPLVNPDTATSLFKISAAIAQKQNQEIECL
FT                   QVITVPKHSDPAQTPVITQHSRQLLQRTERLGRQYHLPVHTQIRIAHDRAQAILDTIRE
FT                   RHIDLMVLQWTDDNHSPGTIFDPVIDVLIRKATCELVLVKLGQEKEAYPQTLDKDATWL
FT                   LPIAGGPNAKRAMELLPGLIKLYTRPRSPIIWLCQVFSPHKATPNYQSLEVAAKRLKEE
FT                   LERPVIPLPVRSQSVADAIIHLAEAETCDVVMLGVSREGLLVQVMQGNLPKMIAQQVKS
FT                   TVILVRGKLDN"
FT   gene            74361..74723
FT                   /locus_tag="cce_0079"
FT   CDS_pept        74361..74723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49431"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ65"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49431.1"
FT                   /translation="MTLMNYFYLRPEDLPPRTPIDDSLQRKLDQAVTHYFYESCDRLTQ
FT                   RVLSQGGWYVTTCGTALTLIIICVDRTHNWNILKFLPSLAKYLKEFAPATNVRIYPPPG
FT                   DGTSLEMTFKLPVMSR"
FT   gene            74981..76417
FT                   /gene="ctpB"
FT                   /locus_tag="cce_0080"
FT   CDS_pept        74981..76417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpB"
FT                   /locus_tag="cce_0080"
FT                   /product="carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49432"
FT                   /db_xref="GOA:B1WZ66"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ66"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49432.1"
FT                   /translation="MANINCFLIPVRHRKKPMNNIIKYLCRHQSLLLGGTLAAIFFHSL
FT                   ALPVNSAPQPEVLEDNPKAIVDEMWQIVNNEFVNRDFNRVDWQAKRRELLSQDYESPKQ
FT                   AYKAIREALEDLGDPYTRFLPPNEFSVLTSQTTGELSGIGVRLAIDKRTSEIYVIEAVK
FT                   NSPAMKAGLKRGDRLIRINGKPTALMSLEQAQEAITGDLGTEVSLQLSRREKGVFQVTL
FT                   EREQIEIPAVTYHLEEKEGHRIGYIKLDEFSSHATEQMKLAIEDLGKQQVSGYVLDLRG
FT                   NPGGLLFASVDIARLWMKKGEIVSTIDRKGGDRHFSANGTSLTDLPLVVLVNEWSASAS
FT                   EILAGALKENGRATVVGTTTYGKGTVQSVHNLSDGSGLAVTIARYYPPSGTDINHKGIS
FT                   PNVYLELTMEQQARLKNDPALMGTDADPQYNRAISILKGRSQPISSPSTPKPVGLRWEE
FT                   LQQTVKDPDPRWQRMQETVN"
FT   gene            76632..76934
FT                   /gene="rps14"
FT                   /locus_tag="cce_0081"
FT   CDS_pept        76632..76934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps14"
FT                   /locus_tag="cce_0081"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49433"
FT                   /db_xref="GOA:B1WZ67"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ67"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49433.1"
FT                   /translation="MAKKSMIEREKKRERLIAKYAEKRAALKEAFENAEDFEEKIEIHR
FT                   QIQRLPRNSAPSRHRNRCWLTGRPRGYYRDFGLSRNVLREWAHEGLLPGVVKSSW"
FT   gene            complement(76976..77311)
FT                   /locus_tag="cce_0082"
FT   CDS_pept        complement(76976..77311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0082"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49434"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ68"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49434.1"
FT                   /translation="MTAQPIPPITLPPIRNPQQEKEWLQVALQKWLNQEFIPEQVNETI
FT                   AQRAAQIFVRQRLEGENDLGSLVIAIVTEMQAFDFTESFFSEFAVANAVSELILDSLGF
FT                   DHCCGQG"
FT   gene            77338..77922
FT                   /gene="aat"
FT                   /locus_tag="cce_0083"
FT   CDS_pept        77338..77922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aat"
FT                   /locus_tag="cce_0083"
FT                   /product="leucyl/phenylalanyl-tRNA--protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49435"
FT                   /db_xref="GOA:B1WZ69"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ69"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49435.1"
FT                   /translation="MMEFSENVDPIIQGYAQGYFLMADENDVLGWYSSRQRALIPLDER
FT                   FHYPKSLKRVLNQNIFSVAINRNFLGVCYGCADRKTTWIAPELIDIYYQLHLAGYAHSF
FT                   ETWQGNELAGGILGITLGGAFIGESMFFRIPNGSKVAMVKLVEHLRQRGFTLFDAQLQN
FT                   DHLARFGSYLVSEIEYQKFLQDALKNPCVFV"
FT   gene            complement(77947..78894)
FT                   /locus_tag="cce_0084"
FT   CDS_pept        complement(77947..78894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0084"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49436"
FT                   /db_xref="GOA:B1WZ70"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WZ70"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49436.1"
FT                   /translation="MYFIFSTASLSSVTLIVMTNTDHPNQPNPPHLHTPVLCQEVIDGL
FT                   AIEPNGHYLDATLGRGGHSRLILEAFPDVRVTGIDLDEEAIAITQENFSLMGDKRLQVW
FT                   QGNFADYPGEIGEFNGIIADLGVSSPQFDVPERGFSFRHQAPLDMRMNREQSLTAGEII
FT                   NHWDQTSLADLFYQYGEERRSRAIARRLVQQRPFETTTELAEAIAKCFPPKQRYGRIHP
FT                   ATRVFQALRIAVNDELGSLERFLEKAPHWLKPGGRIGIISFHSLEDRRVKYSFRDSLLL
FT                   DVITKKPIIPQPEEEEKNPRSRSAKLRFAQRKPL"
FT   gene            78833..79561
FT                   /locus_tag="cce_0085"
FT   CDS_pept        78833..79561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49437"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ71"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49437.1"
FT                   /translation="MLVITIRVTEEREAVEKIKYKQILIFSFHSSAPYHTQTQSKPEFY
FT                   CYCANPYDHLCGNVQELIMLKIIQKKRNPGGDSVIIMDLAAQRMVFIHCSLLNLNRIFT
FT                   RSIMSSLVVFFGILHGCSWLPNVSPTPSPPPSNFSDEEVTNYARTVLKIEDQRQIAYEE
FT                   IETIIDNRPPEIACDQPETIKQLPDNAQKIAVEFCNQSKKIAQDSGLSSNQFNAITENA
FT                   QKDATLKKRIQNAMIRIRKP"
FT   gene            complement(79929..80726)
FT                   /locus_tag="cce_0086"
FT   CDS_pept        complement(79929..80726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0086"
FT                   /product="hypothetical protein"
FT                   /note="contains an alpha/beta hydrolase fold-1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49438"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ72"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49438.1"
FT                   /translation="MRLLSPFSSQVIAPLLIYFPGMDGTGKLFHRQGERLKDFFSIRCL
FT                   SIPSNDQSDWSTLVTNTVTLMRKELESHPHSSVYLCGESFGACLAIKVVLAAPELIEKV
FT                   ILVNPASSFNKRSFLKLGIELNQWIPNFVYKGSALLLLSFLGALNRMNNRDSKALFNAM
FT                   QSLPQEVVSWRLSLLRDFEINKKNLALFEKPILLLASQEDKLLPSVDEGKELVNYFPNS
FT                   SLTILPESGHACLLETDVNLLKILQQNNFLSEENHVKNNLYVK"
FT   gene            complement(80732..81652)
FT                   /locus_tag="cce_0087"
FT   CDS_pept        complement(80732..81652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0087"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49439"
FT                   /db_xref="GOA:B1WZ73"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR027629"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ73"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49439.1"
FT                   /translation="MTIHQKQAITIAVVGDVHDQWEQADNDALEQLNIDLILFVGDFGN
FT                   ESVPVVRKISEVSIPKAVIMGNHDAWYTASAWGRKQCPYNRQQEDWLEKQLELLGEIHI
FT                   GYSKLDFPQFNLSVVGSRPYSWGGPEWKNKSFLRDRYQVSNFAESTAKIMAAVQETSET
FT                   NIIFLGHNGPTGLGQHPEAICGKDWQPLGGDHGDPDFAQAIAQTYDLGKKIPLVTFGHM
FT                   HHRLRHTRSQLRTRLVTNEQGTVYLNAACVPRIIEENGQKLRNFSLVSLDNGKVSHISL
FT                   VWVDNEGAITTEDRLYEQPILSPIN"
FT   gene            complement(81711..82256)
FT                   /locus_tag="cce_0088"
FT   CDS_pept        complement(81711..82256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0088"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49440"
FT                   /db_xref="GOA:B1WZ74"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ74"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49440.1"
FT                   /translation="MARRPPPRYSDRRSNPSPPPSPKSNINYGTIALFGGIFVLGIGVG
FT                   IGVSSNASFDPKNVASREVIDKSAPNAELCVQYGASAIVADMRIFLTLNPFSVFVTQPQ
FT                   MQPGCVLRRSNMNLLEQKRLITSEQARDCRNRMNTFGFVGSLDNKPTIDCIYPNDAAGN
FT                   LFLNPPGSVNPRSEGENF"
FT   gene            82373..83197
FT                   /locus_tag="cce_0089"
FT   CDS_pept        82373..83197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0089"
FT                   /product="CHP1784-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49441"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ75"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49441.1"
FT                   /translation="MKTDTIFYRLFQSFPSIFFELIQVPVTQADNYRFDSVEVKQLAFR
FT                   IDGVFLPKNNNLDSPIYFCELQFQKDDQFYERFFAEIFLYLSKTELNNDWQGVIIYPNR
FT                   QIETQQTQRYQEVLNSPRITRIYLDELANLNQTSIGLATIKLITLPSAETIENTRQLIQ
FT                   RVKGEFNPDQKPQELLQLIETILVYKLPRLSRQKVEAMFSLDELKQTQYFQDVREEAKL
FT                   EGIQEGELRAKITSVPSLLALGLTVEQVAEALKLDIEQVRLIQNNNEQGADQ"
FT   gene            complement(83262..83768)
FT                   /locus_tag="cce_0090"
FT   CDS_pept        complement(83262..83768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0090"
FT                   /product="rfrA family pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49442"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ76"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49442.1"
FT                   /translation="MGDEIVMKIYYIRSIKEMRGVSNMKRNILNAILLATPILLASPVM
FT                   AGNPAHVQQLLETRMCQGCDLSNEDLRYAHLIGSDLREANLEGAILIEANLEGADLTGA
FT                   NLEGANLEGAMLTNATLNNSNLDNVNLANAKIYDADVTGASMENLDITNAQIFNTGIGV
FT                   GGETP"
FT   gene            83749..85494
FT                   /locus_tag="cce_0091"
FT   CDS_pept        83749..85494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0091"
FT                   /product="probable potassium efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49443"
FT                   /db_xref="GOA:B1WZ77"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ77"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49443.1"
FT                   /translation="MTISSPNRVIFLFPFSYNLILQLDSKGVSKEIIMFSFSSVFAEIA
FT                   CIMAIATAVGGLALWLRQPLIMAFIIVGILIGPAGLQIVSANEEVELLAELGIALLLFV
FT                   VGLKLDPHEIQSVGPVAIIAGMGQIIITGILGDVIASFLGFDLISAFYIGLSLTFSSTI
FT                   IVVKLLSDRQEIDALHGRIALGVLIVQDLVVVVAMILLTAFSEDSQQSLGQEIISVILK
FT                   GGIFLLFIAFLTRYVLPKLLHVLANSTELLLIFAISWAIALAAVGDGLGFSKEVGAFVA
FT                   GVSLASTTYRATIGARLVSLRDFLLLFFFINLGIHVNVSYLGSEIMSAVILSAFVLLGK
FT                   PLMIMVLMSIIGYQKYTSTITSLSLSQISEFSLIIATLGLDLGHINENVLGLITLVGLI
FT                   TMGVSTYMIIDSHTIYEKLLPVVSHFNKLIPHSHQKLGDLDAEKVDRVDIILFGLGRYG
FT                   GSLIKALQGSGLQVLGVDFNPELVRAWRNQGVLAFYGDAEDPEFAATLPLNKAKWVIST
FT                   LPGQRIGLTLLHTLEYQKFQGKIAVTSHTEREMKILKSAGSDLVLLPFRDAAHEAARLL
FT                   VSDLN"
FT   gene            complement(85621..85836)
FT                   /locus_tag="cce_0092"
FT   CDS_pept        complement(85621..85836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49444"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ78"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49444.1"
FT                   /translation="MYSGMAIIKNFMISPEEDDGIDEIGELPINVAQLNVTQQLDQAQQ
FT                   MIRESAEYPLNSCKNFVAAKVDKIWY"
FT   gene            86124..87719
FT                   /locus_tag="cce_0093"
FT   CDS_pept        86124..87719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0093"
FT                   /product="unknown"
FT                   /note="contains a toll-Interleukin receptor domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49445"
FT                   /db_xref="GOA:B1WZ79"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ79"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49445.1"
FT                   /translation="MYNQPDANKFEFDVFLAHNHDDKRQIRSIAHELKLRFIKPWFDEE
FT                   QVPPGTPFGRIIEEAIPKVKSAAIFIGKNGLGNWQKAEQQALNQRCVDEGIAMIPVLLP
FT                   EVDQVPEDIKTLFLIQLHSCVKFDKGIYDVKALDNLEWGITGRRPRREHYGILVNIPNY
FT                   QTSCFLAMPKRGLDSIYESLKDVAKEVSVKQLVNNTGIELIQTKNKSDQGFVGDINEII
FT                   HKIRSSEVVVGVCVSEEKSSQLDPDVAYELGLAHALGKPLCIITDKTTHQSLSDYILKD
FT                   IPEDEFIDYELSKSKGTLSDELKNKLEEILKSLKFPYLVEPRNRDISAINWEKTQCFLP
FT                   NFQNNFCNILRFGLEIHTEFPSLQTLLTSLYKEIEEVAETLQDPSTTRNLEKEINDVIK
FT                   AWKDYKQKYEGLYPLNSNNAQLREFKDTKDFNSLKDSFQSLQSDMSTRNQFGKQSYQAY
FT                   KIVIQIIEAYPNLHQRLSDILDNEEVFNMLQKFVNVDSLGKDVKRLIGDIDQLVYMRAG
FT                   TMMRNLAEMICCNQ"
FT   gene            87742..88899
FT                   /locus_tag="cce_0094"
FT   CDS_pept        87742..88899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0094"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49446"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ80"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49446.1"
FT                   /translation="MSTLECEVNQSLDFSSLKNCHEELYQKVSDIIIKQEISETQKEKN
FT                   DCSKEMQEVSDSVKNLLKNLAEFAPQVTSIDESNWVREASYEWGAVGDCLDLNLSLLDT
FT                   TEKHTKVGNIGQKILSLLPNEIPEFSLTPKISKKYLEKEAYCLGQARKERLLKKLLGEY
FT                   RHLIHNLIPSDLENMKMDWCSACTYFSSKILEGKLDFSSQIESDLYHYLEEVWLEDVKH
FT                   LRAYEIWWKKGHNRIYEESTTVNYYFQACQQIMASLVDPYIKAPFSRFEELKNYLKNCY
FT                   LTEEGKLDKDKSNTLIEIKAHRIWETTNNSNSSENWSSAQQYVEDFYENIIPAVVDGDL
FT                   ESITKVKNAIQAINDPTHYHIINCFEVALVIYFLPSDVLEDVEKL"
FT   gene            88917..89768
FT                   /locus_tag="cce_0095"
FT   CDS_pept        88917..89768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49447"
FT                   /db_xref="GOA:B1WZ81"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ81"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49447.1"
FT                   /translation="MKKHLLVSLALILSVVLVSKVPPLVNVSASNAPQINLEAEIQGLA
FT                   HSDVKDNIPRRTDFVIELYHDNSQHLTPPEIRKIYDEAYSQQVRKKRIVRKFVGSAIAI
FT                   LIIVLSILAIAIWLSDKTGVPTLKRVSVNLPFGIGCIELEINRVEQIVAWSLYVELVTR
FT                   IAIQPLKSDEGLLKEALTSLHSLFDTTRQILKEAGPVVGVSPQSVGGIAIAVLNQGIRP
FT                   FLAKWHPALEDWESKCLSTTSNKQHEKNWDQEPQLRHELELLRHHLKQYADALAKIADV
FT                   TF"
FT   gene            89798..90340
FT                   /locus_tag="cce_0096"
FT   CDS_pept        89798..90340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0096"
FT                   /product="putative NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49448"
FT                   /db_xref="GOA:B1WZ82"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ82"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49448.1"
FT                   /translation="MFIMNQERIIFGSDWVTVKETARGFQYLERKGKDSVAVFLLRRKK
FT                   LNSQAYEVMIRQQPLCIDNHELHGKLKLYPCPITGGIDQGETPEQAAIREVEEESGFSV
FT                   QVLPLGRYIVGTQTNEICYLYYADVTKLEPEEAKQDGTYFELISKNEWHDFEYLSQCDY
FT                   SACQIGYFRLKNVLDLD"
FT   gene            complement(90360..90971)
FT                   /locus_tag="cce_0097"
FT   CDS_pept        complement(90360..90971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0097"
FT                   /product="putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49449"
FT                   /db_xref="GOA:B1WZ83"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ83"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49449.1"
FT                   /translation="MEKPFQSALSAIILAGGKSSRMGKDKALIEIKGVPLLQRSATLIQ
FT                   AYANPIYIITPWIERYQRIVPSSCYLLQEVCPSGDSQGPLVGFAQALSHVKTEWVLLLA
FT                   CDLPNLTTQAIEEWLQQLHQVSDQVTACLPLHEKGWDPLCGFYRSSCLTSLESFIQAGG
FT                   RSFQQWLQCEYVQELFVSDRSVLFNCNTQMDLKGIIEKSR"
FT   gene            90954..91319
FT                   /locus_tag="cce_0098"
FT   CDS_pept        90954..91319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49450"
FT                   /db_xref="GOA:B1WZ84"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ84"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49450.1"
FT                   /translation="MERFFHFKLWAKAMNDRHHDPFQEQKLEKLQQITRLIPVVGWIPA
FT                   LWTVYHHQGTRQVLSVSRFSLRLTVIWAIAYSLLWLSSLQTSETLTLRLLYLNGLLTSG
FT                   YILVCLGLMFRVWQRKN"
FT   gene            complement(91529..91717)
FT                   /gene="nblA1"
FT                   /locus_tag="cce_0099"
FT   CDS_pept        complement(91529..91717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblA1"
FT                   /locus_tag="cce_0099"
FT                   /product="probable phycobilisome degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49451"
FT                   /db_xref="InterPro:IPR007574"
FT                   /db_xref="InterPro:IPR036904"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ85"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49451.1"
FT                   /translation="MEFIMDAKTFELSMEQQFQLQCLQQEFQDLEREQVIDYLIDTMQQ
FT                   IMARDNLIRDLMKNDLF"
FT   gene            complement(91762..91926)
FT                   /gene="nblA2"
FT                   /locus_tag="cce_0100"
FT   CDS_pept        complement(91762..91926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblA2"
FT                   /locus_tag="cce_0100"
FT                   /product="probable phycobilisome degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49452"
FT                   /db_xref="InterPro:IPR007574"
FT                   /db_xref="InterPro:IPR036904"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ86"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49452.1"
FT                   /translation="MENTSCNLTLEQQFEMKRIRDAATQMSREQALDLLIQASRLLMIK
FT                   TNVVRNLGK"
FT   gene            92425..92631
FT                   /locus_tag="cce_0101"
FT   CDS_pept        92425..92631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49453"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ87"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49453.1"
FT                   /translation="MIQLPDLSIVKEKLILMTQANKRQASFGYGVGSHGKVISCFLCTY
FT                   NQTKPKHGQFIKFFINSITGGIS"
FT   gene            92632..93084
FT                   /locus_tag="cce_0102"
FT   CDS_pept        92632..93084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0102"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49454"
FT                   /db_xref="GOA:B1WZ88"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ88"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49454.1"
FT                   /translation="MPIRLYVGNLPKENLERQTLEELFADGGEIVSIKVIKERKTGKCR
FT                   GFAFVTVPNDELADAFIEKYNGQSFMDNDLKIEKALPRNKGKDSPNEGNADNKPATKSK
FT                   KGGGKKRNTRSSSSSSSSSNESFQPDPRWADQLAQLKEMLAASSNN"
FT   gene            93212..93913
FT                   /gene="rpiA"
FT                   /locus_tag="cce_0103"
FT   CDS_pept        93212..93913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="cce_0103"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49455"
FT                   /db_xref="GOA:B1WZ89"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ89"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49455.1"
FT                   /translation="MSDPIVMMKQEVGKAAAARVKSDSIVGLGTGSTTAYAIQYIGERL
FT                   QSGELKNIVGVTTSFQAEVLARKYNIPLSTLDVVDRIDIAIDGADEVDPQKNLIKGGGA
FT                   AHTQEKIVDSLAEQFIVVVDGGKLVDKLGSTFLLPVEVIPKAVVPVMRKLEQLGGKPEL
FT                   RMGVKKAGPVVTDQGNLVIDVKFDSIDDPATLEKTINNIPGVLENGLFVGVTDVVLVGE
FT                   IIDNKPVVREI"
FT   gene            complement(94738..94842)
FT                   /locus_tag="cce_0104"
FT   CDS_pept        complement(94738..94842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49456"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ90"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49456.1"
FT                   /translation="MRRTLVELAAHCPFRDDILLMVQRLSSGQQLTFS"
FT   gene            complement(94839..96035)
FT                   /locus_tag="cce_0105"
FT   CDS_pept        complement(94839..96035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0105"
FT                   /product="hypothetical protein"
FT                   /note="contains a transposase, IS4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49457"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ91"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49457.1"
FT                   /translation="MLKQGEENWKVCQGIADCLEDEREQHKVKHPLFQLISQRIYQIAA
FT                   GYEDTNDSNYLRHDPIFKIICDKIPKMEAELLASQPTISRLENRITKQEIKRIRRFFVD
FT                   KFLQNYSSDPEQIVLDIDGFDAYTHGHQQLSLFHGYYGHQIYFPVLINEAKSGYPLLLH
FT                   LRPGNSHAGKGVLGLLRWLFWRLRKAWPSVKIILRGDGGFSLPEIMNLCEQKDIKYVFG
FT                   FSKNAVLKRKINYLLDLARLQYFRTQDKARLLGARSLAPCDGAGSHPLFDDVYYAAKTW
FT                   KAPRRIVMKAEWLKKGSNPRFLVTNLETEPQELYDNFYVQRGASSEHRIKELKLGINAD
FT                   RLSYHKFIVNQFRLFLCQAAYILMLELRASAEGTRLGMAQVSRLRETIIKIALKLLFL"
FT   gene            96076..96228
FT                   /locus_tag="cce_0106"
FT   CDS_pept        96076..96228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49458"
FT                   /db_xref="GOA:B1WZ92"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ92"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49458.1"
FT                   /translation="MTSNGFFVLKLKGSFLENVFMNNQWIYLTFIPPFIIVYSELFESI
FT                   VLTYS"
FT   gene            96374..96697
FT                   /locus_tag="cce_0107"
FT   CDS_pept        96374..96697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0107"
FT                   /product="reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49459"
FT                   /db_xref="GOA:B1WZ93"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ93"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49459.1"
FT                   /translation="MGKNPEMPKRTASLLKKQKGKCAHCGLFFKDEDTIELDHIIPKSK
FT                   GGKNEYKNWQLLHRHCHDEKTRTDGSLERSGNKTGCNSTIPKQLSDIPSNYRWINDMLV
FT                   TAY"
FT   gene            complement(96968..97285)
FT                   /locus_tag="cce_0108"
FT   CDS_pept        complement(96968..97285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49460"
FT                   /db_xref="GOA:B1WZ94"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ94"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49460.1"
FT                   /translation="MFGCSNWEMATVSNLIRSLFLSVLLSFVTPVLFVGGILGTLLTVS
FT                   YIPGIAILGEIGQELMLSFLSTFGEGYPVQGMLTIGVTCAMVGGLFDVFNFYLYQDIHS
FT                   Q"
FT   gene            97641..99500
FT                   /locus_tag="cce_0109"
FT   CDS_pept        97641..99500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0109"
FT                   /product="hypothetical protein"
FT                   /note="contains a polysaccharide deacetylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49461"
FT                   /db_xref="GOA:B1WZ95"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ95"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49461.1"
FT                   /translation="MFSTPSQWFSFKLALCCSSGLIMAIYSLILVNLIHQDNSTNNSKV
FT                   TSTHLEQERNCQFSASESHSNLPKLGLTINSSALVSQTVFSDIDLNLQDCLNGIISVGK
FT                   SHHKQQLIISPTTFPVLWNAAKNANQAISKPFPYIHESARAAKVPIFMYHDILPKKEVF
FT                   FDVTPEELENHFKYIQEKGLTPISLDLLLDHLQKGIPLPDKPILLSFDDGYGGHYDHVY
FT                   PLLKKYNYPAVFSVYVKKMDGTTARSSLTWEQLQQLADDPLITIASHTISHPRDLRELS
FT                   DDELFQEVMMSKEILEEKLGIPIKYFTYPEGKHDARVKQWAMAAGYKMALSMSNEEEIF
FT                   AGESPDLLSIGRFGQSQLQVVSGDAWGGYPGEHLDGGFNFTATITKREHQIDGIELVII
FT                   NGGKPSTIHADSRYQVSEIMAKSEAVAAVDGGFFSLKYLDSNVMIGPVMSQGEEFTPGN
FT                   QSENPRLNGRPLVLISDQWVKFVPFDADIHNTWAGVANESDEGEFITDTFVAAAWLVKD
FT                   SLAQPYESFGNLFDFHVPRHRAFWGIHRSGQPMIGVSKNPVDSIQLGHILQQLGFRDAV
FT                   MLDSGASTSLAYKGESLVGYIPRPVPHVVVLLPSVSSLLETTE"
FT   gene            100079..101539
FT                   /locus_tag="cce_0110"
FT   CDS_pept        100079..101539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0110"
FT                   /product="unknown"
FT                   /note="contains a transposase, IS605 OrfB domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49462"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ96"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49462.1"
FT                   /translation="MGKSKAKPKTKKKKDERPRAIESRKGTLEYDSMIRTDVWNLNVTS
FT                   SQKKLLLLTVAEYRKFLKPLVFIVNAEWRTIGNLTDKEKVNYLEKSIHVTNKNPKAKYL
FT                   YYQKVINKYPSFRKFPSYLRRAAIADAIGIVSSFQTRYREWQSGIRKYRKVRPPRLTAM
FT                   CQSYPALYKGQQVKYNNDYQNVDLKVWNGSDWVWLEKVPVKGHGLNRHKVIGNQMKSPA
FT                   LVVNAKTCQLSMPVKVKPIKKEDSDYVCSVDLGINNAATCSIVGRDGTVKARKFINPAR
FT                   DIDRRNKRKMMIAKKSKQTHQKTGKKFVKGFCQGIYRKSSNINLEISRKVARQIIEFAK
FT                   LHNVKVIVMENLAGWKAKGGKKGTLMRQKFHLWCHQKIVEILNNRWAELGGDVQTINPK
FT                   YTSAYAFDGSGKVKRNKKNYSLCTFSSGKQYNADLCASYNIGARYWYSVLIGDKYFSRV
FT                   FVSESPTNTLRTPITLGTLRGLKSSGCK"
FT   gene            101571..102233
FT                   /locus_tag="cce_0111"
FT   CDS_pept        101571..102233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0111"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49463"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ97"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49463.1"
FT                   /translation="MCSIKLNLKTMLPTITPDTIDLPAGTILKFPGTLADYEHLLKQVG
FT                   DRSIPRIRFRDNHILLMSPFPEHANEIDVISNLIKAMLGYQGEDWQSFHPVTLKYGKIP
FT                   GLEPDACFYIENYQAILGKRKLDMSIDPPPDLAIEIYVASLTNIENYISLAIPEVWIYK
FT                   TNELHIYHFTENHYIETNNSFIFPDFPVKEIISYYVDRAWQVGSSVALRDFNQTLSH"
FT   gene            complement(102366..103163)
FT                   /locus_tag="cce_0112"
FT   CDS_pept        complement(102366..103163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0112"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49464"
FT                   /db_xref="GOA:B1WZ98"
FT                   /db_xref="InterPro:IPR021499"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ98"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49464.1"
FT                   /translation="MNYQTKVTKNKNKRGILKQLFLPLIVSILVLLTGCVRYDVGVNFY
FT                   EQHQGEIVQHIRLAQQLTSLSKTEANQWLNSLESRAKALQGKAKKVSDEEIIVRIPFSN
FT                   GQELTDKFNHFFNPNYSKLASGLKVENPELVQLKAEMSIKQSNWIFFERNKLNIDVDLR
FT                   ALGVLSNQGNIIVSPGSLVDLEFVLNAPLRVRNLDKTSNLNSESNPNYTQTSWQLEPGQ
FT                   INHIETSFWVPSYLGIGTVIIILVILLGFYAKHRHFPGVQKTV"
FT   gene            complement(103262..105514)
FT                   /locus_tag="cce_0113"
FT   CDS_pept        complement(103262..105514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0113"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49465"
FT                   /db_xref="GOA:B1WZ99"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZ99"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49465.1"
FT                   /translation="MEFSIATLLSHFSDNKLVAAKLLEKKLGCEDEESVEKLQIILDAL
FT                   ELVGILEKERGKYRRVKEDDLVEAKLRCSSKGFCFAIQDEEDAEDIYVRELHLSNAWNG
FT                   DRVLVKVIKEGTRRRSPEGEVRLILERANPSLLAQVKKEEEKYQAIPLDDRLLFELMLE
FT                   QNGGNLEAAVDHLVHVSVVRYPIGEHPPIGRVTRILGSDAEAAADTDIVCCKHDLSQTF
FT                   SDEVEQAAKELPTTFDPQTLEKRADWREVLTFTFTEDVKRDCLPFIETAFTLEKTEDND
FT                   WQFAVHISDIAHYIQPNSLLDKTAKKRGTTVYLGEKVLPMLPEAVTERYSLKPNQDFLT
FT                   ISVIMTFDKNGQLIEYSIEPTVIRVDHQLTYPEVQSILADLEQVPDHQQPLAEKLKHLF
FT                   FTLSPLVKAQRLQRGGFELQLEPRSPYQDEGRVGTLIASSRTPIRSLLTELVVLANKAV
FT                   ANHIQALGIPGIYCTQPEPDWEELEDLLKLAQNLGLEASLESEEEITPQDYYNLTQMLG
FT                   KSSHVHVLSYLLHETLKSSKYNSHPGSHFGLAYDDCYTHCVSPGKRYVDLLIQRVLKLV
FT                   FSDGRDRRTRQTKTGVNLFSSSCHGNINWNVLPPAMQEELEETFHVLVTYLNDREKTAE
FT                   EAEKDLEGLQKAEKMKERTGKVFKGLITGVQSYGFFVEIEDLLVEGLVHVSSLKDDWYE
FT                   YRSRHGCLVGRKNHIAYRLGDEVEVEVKSVDYYRQQIDLVTVSGGSSSNNGDWNDD"
FT   gene            106164..108458
FT                   /gene="hypF"
FT                   /locus_tag="cce_0114"
FT   CDS_pept        106164..108458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="cce_0114"
FT                   /product="hydrogenase maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49466"
FT                   /db_xref="GOA:B1WZA0"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49466.1"
FT                   /translation="MNQLRRLKIIIQGAVQGVGFRPFIYRLATELNLKGWVNNSASGVF
FT                   IEVEGTKKNLEIFLTRIPQEKPSISSINTVETTWLDPVNYTTFEIRHSSSGEKTAVVLP
FT                   DLSTCSDCLQEIFDPNNRRYLYPFTNCTNCGPRYTIIEELPYDRPHTTMKVFMMCECCQ
FT                   EEYENPLDRRFHAQPNACPVCGPRLQLWNKKGDTLANDNNALNLSINALKDGKILALKG
FT                   LGGFQLVVDGRHTEAVTQLRQRKHRPHKPFALMYASLEAIKNDCEVNGLEETILTSPQA
FT                   PIVLLKRKKSQSLSPEIAPNNPYLGVMLPSTPLHHLLLYKLDFPIVATSGNLASEPICI
FT                   DEQEALQRLENIADLFLVHNRPILRPVDDSVVRVMGEKEMVIRRARGYAPFPIQINDNL
FT                   LRNNKKKDQSIPNILAVGGHLKNTVAIIKNNQVFISQHIGDLSTPEALKSFNQVMESLK
FT                   TLYDFDPEIIVCDAHPDYVSSQYAKAQNLPLITVQHHHAHILSCLGDNNLNLPILGVAW
FT                   DGTGYGNDQTIWGGEFLLVTGNQYERVAYFRPFKLPGGEQAVKDPRRIALSLLSEVSQE
FT                   LYYKELPFLETISTKELNLVKQMLSRNLNTPLTSSVGRLFDGVAAMIGICQNVTFEGQG
FT                   AMALEYAINDLETDASYPYEIEDSLYPLVIDWELMIHSIIEDILGKISHQKIAAKFHNT
FT                   LVDIIINIAQRSQEKNIILTGGCFQNKYLTERAILGLTQEKFTPFWHHNVPPNDGGLAL
FT                   GQIVAGIHRKK"
FT   gene            108513..109490
FT                   /locus_tag="cce_0115"
FT   CDS_pept        108513..109490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0115"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49467"
FT                   /db_xref="GOA:B1WZA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49467.1"
FT                   /translation="MDIFGSSEPAKILVVDDHPFSRVMAVDLLSANGYDVIEHDGVSDV
FT                   FTTVRSVSPDLILMDIKMPNHNGFDVCQKLKQNQDTRSIPIILMSVSDDNQSRLKSQGV
FT                   MADAFMSKPLESIVLLPEVELLVQRKRLYEWLDQIQQVLFLISQAIQQRYSSEGQSRIR
FT                   FDKLAQGFGEYLNLNQVEISDLILASHLHDIGTVAIPDAVMMKQGKLNEEERELIKKHV
FT                   LIGEEICRPMQNRRGIAQIIRHHHERWDGSGYPDGLIGESIPKLAQIFQILDIYEALTS
FT                   QRPYKQAYSPQEAIKIITEEAEKGWRNVKLVQQFVAFMEEKELA"
FT   gene            109591..110076
FT                   /locus_tag="cce_0116"
FT   CDS_pept        109591..110076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0116"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49468"
FT                   /db_xref="GOA:B1WZA2"
FT                   /db_xref="InterPro:IPR025067"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49468.1"
FT                   /translation="MGDKLADILEPLAAWFRSLGVPEPIVHWGHPVMMGIVVLVMGSFT
FT                   AYMGWRSRFVTDPEVVSESRASHRQLAPWVFLFVTLGYTGGVLSLVMQQHPILNSGHFW
FT                   TGTAVIGLMAISAITPLIGFNSDQKEGYRAFHAYLGGVVAIVLIAHGILGLKLGLSL"
FT   gene            110189..111349
FT                   /locus_tag="cce_0117"
FT   CDS_pept        110189..111349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49469"
FT                   /db_xref="GOA:B1WZA3"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49469.1"
FT                   /translation="MMEKTAKNIIELIYQAINNREIDQAMQWVDDDCIYEDVNFSKTFQ
FT                   GKKAVKSLFQESCDNVPDDFRFVVDEITTGDPLKVGVLWHVELDNIPIPNGRGVSFYRI
FT                   SETTGKLIFARDIVEPPLKPGKLSFIIIRLVTPLIRTILKQDSNPPETQLILSKVLWFL
FT                   AGTYIYILLCSSPNFILPGEPVWAVQPETIKEVISESINFFFVLPILNMLGISVMKSPV
FT                   IHPAIEAQFNFAEAWIFMFLPLLLADKRVRDFPKVALWSVAMFLTNVFLLPYMALRFKQ
FT                   PTLEKIEEPNKGLLERIFGWTGLMVGIIAIVWLLIGRSEFGDLSQRIDYFMMQLQSSRV
FT                   VIAFAVDIFLFAIFQIILMGAVIPPKNSQRFLRFIPFFGLAFWLIL"
FT   gene            complement(111370..111732)
FT                   /locus_tag="cce_0118"
FT   CDS_pept        complement(111370..111732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0118"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49470"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49470.1"
FT                   /translation="MIDAKNVLGTDLQLCCGDPMTGYYRDGYCRTGGQDFGVHVVCAQV
FT                   TDEFLTFTKEQGNDLSTPISAYNFPGLKSGDRWCLCVSRWQEAKEAGVAPPVILEATHI
FT                   RALEAVSLDELKQYAV"
FT   gene            complement(111817..112026)
FT                   /locus_tag="cce_0119"
FT   CDS_pept        complement(111817..112026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0119"
FT                   /product="unknown"
FT                   /note="contains UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49471"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49471.1"
FT                   /translation="MRYAVIIEKGRFHYGAYVPDLPECSAVGNTVEEVKKSIYASISAH
FT                   LNSLQAEGNEFPNPKTLCEYVDVS"
FT   gene            complement(112218..112670)
FT                   /locus_tag="cce_0120"
FT   CDS_pept        complement(112218..112670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0120"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49472"
FT                   /db_xref="InterPro:IPR025971"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49472.1"
FT                   /translation="MIPNAPKIDAELPSVDRCKDQLREAKTPQERAIIRAGWELFGPRQ
FT                   TYDETIVITAMSGVDGMCRPLGYQAFVFVGEQFAGTLSPQPMNSRTDGDMARIFLTSPS
FT                   SLFVEYKRYDNDDPLCCPSGMNRVLFTIEPNNAKPLLIPIEIMAEA"
FT   gene            complement(112796..113485)
FT                   /locus_tag="cce_0121"
FT   CDS_pept        complement(112796..113485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0121"
FT                   /product="unknown"
FT                   /note="contains DUF306, Meta and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49473"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR025485"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49473.1"
FT                   /translation="MMNKYGLKKIIQGMILLSVSLVPLHQFNAAIANENPVNPTENQEQ
FT                   NQKRNPLIGTEWQLIDWTENQTLGKENSTIAFEKDTVSGSGSCNRYTAGYAIQDNAIKV
FT                   GLIAATRKACTEEIMNQEMLFLGALEGAKIYSINAKGQLQIAYIKQKEIGILTFKNINN
FT                   NNNKTVEKTVYISPETVDCIGVAPQQCLQIKENLEDNWTFFYSSIEGFDYEPGYFYELR
FT                   ISQKKKN"
FT   gene            complement(113752..115290)
FT                   /locus_tag="cce_0122"
FT   CDS_pept        complement(113752..115290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0122"
FT                   /product="putative quaternary amine uptake ABC transporter
FT                   (QAT) family, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49474"
FT                   /db_xref="GOA:B1WZA8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49474.1"
FT                   /translation="MNLLLSIPPTSVILLRTGEHITLVLIAMIVATGMGIPLGIIMSRY
FT                   PKLANPILLVTNAVQTIPSLALFGFLITVPFLGGIGKRPAIIALILYALLPIIKNTYIG
FT                   ITQIRKGVKEAGKSLGLTPLKILFLIELPLALKVILGGVRIAAVICVGIATIAAAIGGG
FT                   GLGVFIFRGLSTVDNTMILAGAIPSAIIALLVDWGLGWLENNLTQTDTKKKKNKQKVFI
FT                   FLFAFVSLIFIVFSLINKPQKQIVIGSKNFTEQIILGEMIAQQIENNSNLTVDRRFNLG
FT                   GTFICHEAVKAQEIDGYVEYTGTAFTAILERKPVSNPNLVYGEIKEVYNEEFKLEVMPS
FT                   LGFENTYAILIRGEDAKQYNIETISDVAQYTPEWTAGFSYEFLAREDGYSGLSKTYDLQ
FT                   FAQQPKTMELGLMYRALAEKNVDLVAGNSTDGLISVLDLYMLKDNKNYFPPYEAVPVFN
FT                   QETLKEHPNLSPIIQQLSGQISSQEMQQLNYLVDHERQSVNKVVEDFLNEKNLT"
FT   gene            complement(115332..116312)
FT                   /gene="thiL"
FT                   /locus_tag="cce_0123"
FT   CDS_pept        complement(115332..116312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="cce_0123"
FT                   /product="thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49475"
FT                   /db_xref="GOA:B1WZA9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZA9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49475.1"
FT                   /translation="MKVKDIGEQGLLKKLKSFCPHDIIGDDAAVLSINPQQKLVVTTDV
FT                   LVDGIHFSQTTTPPESVGWRAIAANLSDLAAMGASPLGVTVGLAVPGHLSVDWVEHLYQ
FT                   GMSHLLAEYNTPIVGGDICRSEVTSVSITALGEVYPNRIIKRSTAQPGDVIVTTGYHGM
FT                   SRGGLELLLNPSLANNLGQDIRDRLIKAHQYPKPRLDLLPHLWEIMETHTITGMDSSDG
FT                   LGDAIMQICAMSEVGAQIQLSQLPCVSMLSQWFSSAQALNWVLYGGEDFELVLCLAEEM
FT                   GQKLVKTIGQEGKIIGKIIEKKSVILIDGNQEEALSLDKSFQHFS"
FT   gene            complement(116309..117181)
FT                   /locus_tag="cce_0124"
FT   CDS_pept        complement(116309..117181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0124"
FT                   /product="putative ABC transporter, oligopeptides"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49476"
FT                   /db_xref="GOA:B1WZB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49476.1"
FT                   /translation="MVTSKFPLGRFSHLSLAQKLMYLGILITLFWLFIALFAPILQGIG
FT                   FLQDPTDLLSNIPGESPSLRHWFGTNVRGYDVFSRTLLGSQAALKVVFLATFLSMAIGV
FT                   PLGLVSGYLGGKVDKILLFFMDTIYTIPGLLLSVTLAFILGRGILNVAIAVSIAYIPQY
FT                   YRIVRNHTTSVKNELFIEAAKAMGATPTRVLSRYLFLNVIQSVPVVFTLNAADAILVLG
FT                   GLGFLGLGLPEEVPEWGHDLKEALPDLSTGIWWTTLFPGMAMTSMVVGLSFIGEGISEL
FT                   FNPTLRNKR"
FT   gene            117341..117661
FT                   /gene="cutA"
FT                   /locus_tag="cce_0125"
FT   CDS_pept        117341..117661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="cce_0125"
FT                   /product="probable divalent-cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49477"
FT                   /db_xref="GOA:B1WZB1"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49477.1"
FT                   /translation="MSSPFTVVITTTSKKEDANQIAKTLLEKKLAGCIQILGPISSHYY
FT                   WKNELCIDEEWICLIKSSQNNYQTLEKAIQDIHPYDVPEIISLPIVEGSQGYLSWLNQQ
FT                   LK"
FT   gene            117673..118893
FT                   /locus_tag="cce_0126"
FT   CDS_pept        117673..118893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0126"
FT                   /product="putative Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49478"
FT                   /db_xref="GOA:B1WZB2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49478.1"
FT                   /translation="MVISKPNQQLNISLIVSDLSSKGAGRWGGAIRPFLLAQALQKLGH
FT                   TVKIFGIAYEENGLSELPREFPIVSIPCPYYAGFGGTWRSLKQLLPKIDGDILYAVKLK
FT                   PSSYGIALLKKYISHRPLIVDIDDWEMSWFGGDDWRYNFTVKGFIEDLFKGNAPLQHPD
FT                   HPFYLQRIETLVSLADQITLHTQFIQQRFGGTYIPNGKDTDLFDPQKYDPQKSRKKYNL
FT                   DNYKILMFPGAPRPYKGVEDILIALEKLNNPELKLVIVGGSPYDNYDKKLQETWGNWLI
FT                   QLPKSPVEAMPEIVAAAHLVVVPQQDTPATKAQFPLKLTDGMAMAKPILATSVGDIPEI
FT                   LGDTGYLVDPSSPEQLANQIDWIFSHLEEAEAQGQKARERCIKAYSLQSMATILSQILE
FT                   PFCGSGD"
FT   gene            complement(118939..119622)
FT                   /locus_tag="cce_0127"
FT   CDS_pept        complement(118939..119622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0127"
FT                   /product="glucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49479"
FT                   /db_xref="GOA:B1WZB3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49479.1"
FT                   /translation="MTAYSFFNQNPYSLAVTQTTYPFNAFHPSVNSKLKRGMDIIGALV
FT                   GLIITVMIAIPIMVIMSISDPGPLLYSQVRCGLHGRPFRIWKFRSMVVGADKMRHLVKN
FT                   EAQGHIFKNTNDPRITCLGVFLRKTSLDEFPQFWNVLMGDMSLVGTRPPTVDEVQKYDP
FT                   HHWQRLNVKPGITGEWQVNGRSSVKNFEDIVKMDINYQEKWSLWYDLHLIVKTVLVVLN
FT                   KTGAY"
FT   gene            119789..119965
FT                   /locus_tag="cce_0128"
FT   CDS_pept        119789..119965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0128"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49480"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49480.1"
FT                   /translation="MTTHFIEAEIDLQQTPLTTKEAVEATLQAEGEPLRWAITKVDNEK
FT                   QTAQVEAIVTKDN"
FT   gene            119966..121018
FT                   /locus_tag="cce_0129"
FT   CDS_pept        119966..121018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0129"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49481"
FT                   /db_xref="InterPro:IPR021763"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49481.1"
FT                   /translation="MNHRPYTAVLIVPTGIGAAIGGYAGDALPVAKAMAQVCDRLITHP
FT                   NVLNGAQLYWPLDNTFYVEGYGLDRFAQGDWGLNPVHQNRVGLILDRGIEPELRTRHIQ
FT                   AADATRATLGLTLTDYVVTDTPLQVELRTADSGASWGTIGHPDSLLRAAHKLITHSKAE
FT                   AIAVVARFPDDVDSLVLDNYRHGQGVDPLAGAEAVISHLIVREFRIPCAHAPALEPLPV
FT                   DDTISPRAAAEELGYTFLPCVLVGLSRAPQFVTQPHPYSIWADQVDALVIPDTACGGSA
FT                   MLSLSECNTRIITVTDNTTALNVTPQDLGIEAIAVNSYLEALGVLSAHKAGISIDALRP
FT                   VVCSISQACD"
FT   gene            120969..121604
FT                   /locus_tag="cce_0130"
FT   CDS_pept        120969..121604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0130"
FT                   /product="hypothetical protein"
FT                   /note="contains an abortive infection protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49482"
FT                   /db_xref="GOA:B1WZB6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49482.1"
FT                   /translation="MMPYVLLFALFLKPVTNPNSSDMEPLTRTQILVVMGVTAIILLII
FT                   AKVWQYFGSVALIKIQLSPDGLLYGAALAGVIIVASSIIYRVWPAYRQSADAYLELVLK
FT                   PLVWPDLIWLGLLPGLSEELLFRGVMLPALGYDLLAVILSSVVFGILHLSGSQQWPYVV
FT                   WATLVGFALGYSALMTDNLLVPITAHIITNWMSSTLWKFNHRTSDASS"
FT   gene            121609..122100
FT                   /locus_tag="cce_0131"
FT   CDS_pept        121609..122100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0131"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49483"
FT                   /db_xref="InterPro:IPR021920"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49483.1"
FT                   /translation="MFQFNLCCDMEVQFREFNPFDLWIWLEFETVPSPMERQYVEEVFN
FT                   SWFYLGKLGGFNAENLQVQDMGVEISYMDYDTKVSDDMMMAPMHNMAEFEYEGVWGRCW
FT                   FDLGTSDLIALDILINALTQLSRELIVIKRVIIGGENEDWPIANKRQAMFAEEVEETEY
FT                   "
FT   gene            complement(122108..122566)
FT                   /locus_tag="cce_0132"
FT   CDS_pept        complement(122108..122566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49484"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49484.1"
FT                   /translation="MNVNPNYLISFFLLLYIPNLSPVANNFRKWNELAIINLQPRQKSY
FT                   TATAQFWGRLATGVKQPSTVTLYPNQEHRLLVIIILSQKCGRFFEIYDQQIKKVTYSCS
FT                   QEDKDESADYTDWKVEHNSLTKEIKMITPAAKNNPLYIRQEAFWLINY"
FT   gene            complement(122631..123650)
FT                   /locus_tag="cce_0133"
FT   CDS_pept        complement(122631..123650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0133"
FT                   /product="cell wall hydrolase/autolysin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49485"
FT                   /db_xref="GOA:B1WZB9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZB9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49485.1"
FT                   /translation="MKLLKSLLGGLLVSQAVGLAVDANDLEYWDFDVRQNRVEIVTEEG
FT                   VRPKASMIANPTRLIIDLPGVNLGKPSISQDKISGYVKEVRIGQFNPYTTRIVVELGQQ
FT                   YSMRPWEVKVRSLSPNRWYVQLSDFQPHSVYSLPPEEEPVAIIVPLPNPTSPVYRGGGR
FT                   YTVVIDPGHGGRDPGAIGLGGLQEKRVVLSISAEVARILRQRGFNVVMTRSNDSFVSLR
FT                   GRVQRAENSDANVFVSIHANAVGGNQSQVNGMETYYFSSGYRLALTIHRNIIRGVNVAR
FT                   NRGLKKARFYVLRKTSMPAALVEVGFVTGRTDNRNLNSASYRKKMAEAIANGITEYLR"
FT   gene            123730..124566
FT                   /locus_tag="cce_0134"
FT   CDS_pept        123730..124566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0134"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49486"
FT                   /db_xref="GOA:B1WZC0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49486.1"
FT                   /translation="MKVRILLLSILFNGLNMIKDKNLKTYSTSDVVNYYQYLQQLQPAE
FT                   ETVIKLLRSELPNMKMLDLGVGGGRTTQHFFPLVKEYIGVDYSVDMIKACQERFSQSYP
FT                   SIQLRVGDGRDLSQFEDNSFDFILFSFNGLDYISHEDRLKALQEISRVGKSGGYFFFSS
FT                   HHLQAIEKEFNWRHHLSLNPFKTYVNLVMFAFLRGVNTSLTYRSIKHNNYAILRDESHN
FT                   FRLRTYYIRASEQIKQLEPLFKDIKVYSWKTGLELTTNHNMVSCSDMWLYYLCRIK"
FT   gene            124727..125362
FT                   /locus_tag="cce_0135"
FT   CDS_pept        124727..125362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0135"
FT                   /product="putative rehydrin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49487"
FT                   /db_xref="GOA:B1WZC1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49487.1"
FT                   /translation="MALQLGDTVPDFTQETSEGTISFHEWAGDSWVVLFSHPADYTPVC
FT                   TTELGTVASLKPEFDKRNVKILALSVDSVDSHKGWINDINETQNTNVNYPIIADPDRKV
FT                   ADLYGMIHPNSLNNLTVRSVFIIDPNKKLRLTLTYPASTGRNFDEILRVIDSLQLTDYH
FT                   QVATPANWKDGDDCVVVPSISTEEAKQKFPKGVTEVKPYLRMTPQPNK"
FT   gene            125501..125743
FT                   /gene="rpl28"
FT                   /locus_tag="cce_0136"
FT   CDS_pept        125501..125743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl28"
FT                   /locus_tag="cce_0136"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49488"
FT                   /db_xref="GOA:B1WZC2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49488.1"
FT                   /translation="MKMSRKCQLTGKKANNAFAVSHSHRRTKKLQEANLQWKRVWWAEG
FT                   NRWVRLRLSTKAIKTLEKKGLNAMAKEAGINLNKM"
FT   gene            125861..126766
FT                   /locus_tag="cce_0137"
FT   CDS_pept        125861..126766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0137"
FT                   /product="putative sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49489"
FT                   /db_xref="GOA:B1WZC3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49489.1"
FT                   /translation="MNDSDVKLPNFLIVGIQKAGTTSVYNYLKQHPQVYLSPLKETNFL
FT                   EKDWPQLIEQGHQFNPKKIATFEQYKNLFEGVTNEIAIGEISPNYLFHYKTSTELIKRY
FT                   VPHAKLIAILRNPVERAISDYLMHVREAQSNRSLKEQIQYRADKSFVITKGKYYQPVKY
FT                   YFEQFSQEQVSIFLYDDLRKDSQKFIQDIYKTIGVNPDFEPDTSRKSQVAQVPKNKAVN
FT                   NLLVRKNPIRSLSASLLKPLLSEKKRQQVRSFLIGMNSKSKEEIDSFDEEKQLLLNLYR
FT                   DDILKLQDLIDRDLSPWLTI"
FT   gene            126853..127758
FT                   /locus_tag="cce_0138"
FT   CDS_pept        126853..127758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0138"
FT                   /product="unknown"
FT                   /note="contains an alpha/beta hydrolase fold-1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49490"
FT                   /db_xref="GOA:B1WZC4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49490.1"
FT                   /translation="MIMITTATPSTKPLKTYYWYWQGHRIKYTVQGQGEPLLLIHGFGA
FT                   SIGHWRNNIPHLAQGNYRIYALDLLGFGGSDKPQLNYTVELWRDLIKDFWQDHINEPTI
FT                   FVGNSIGGLLTLMIMAEYPQISKGGVLINCAGGLNHRPDELNFPLRLIMGSFTKLVNSS
FT                   VTGTFIFNRIRQKHRIRRTLYQVYCDRKAVTDELVDILYQPSCDPGAQKVFASVLTAPP
FT                   GPHPQTLLPKIDQPLLVLWGTNDPWTPIKGSAMYQERAKNGQNTTFYPIEKAGHCPHDE
FT                   KPQQVNQLILTWLNSLSFNG"
FT   gene            127896..128825
FT                   /locus_tag="cce_0139"
FT   CDS_pept        127896..128825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0139"
FT                   /product="hypothetical protein"
FT                   /note="contains a phospholipid/glycerol acyltransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49491"
FT                   /db_xref="GOA:B1WZC5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49491.1"
FT                   /translation="MSVSLESINTQPSITPETIQRAKEGLSDAQNPVIKRAIQQGLNDL
FT                   ETLAEATFDPPINGQFRRLILRSLIHSLFRVKVEYPERIPRRPVILVGNHLNHIDPFLL
FT                   LSECFTSPYFHILGDARTLYNKWWKRFILGLSGGVIPLERRWGQETAIIEAAEAGHEAL
FT                   KPLAQEIKENVPSGESIKTLRQINKAVQVILEQGRGLMLFPEGRLGTTEGKLSLPLKRG
FT                   TAIYALRSGVPVVPVALVGTKHLYYRKILTLRFGKPLHFPQVKHPKHTEIDTVLNQLEN
FT                   AFLELLPCDYQEPDELKLFSEFLNHFFC"
FT   gene            complement(128864..129433)
FT                   /locus_tag="cce_0140"
FT   CDS_pept        complement(128864..129433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0140"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49492"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49492.1"
FT                   /translation="MQATVIKTSSIEEYLKQEEKAESKSEYIDGQIIPMTGGTINHNQI
FT                   VGNIYAELHFAFKKLDYRVYVENVRLWIPEKRIFTYPDIMVIKEEPIYYENRKDTIVNP
FT                   SLIIEVLSPSTQNYDKEGKFAAYRTIKTLQEYVLISQTQIYGEKFVKIGNKQWLFQEYH
FT                   QEDQQIELELNNMKLNFSDIYHKVEF"
FT   gene            complement(129512..130189)
FT                   /locus_tag="cce_0141"
FT   CDS_pept        complement(129512..130189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0141"
FT                   /product="unknown"
FT                   /note="contains a methyltransferase type 11 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49493"
FT                   /db_xref="GOA:B1WZC7"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49493.1"
FT                   /translation="MNEEKLNKLRQKVQDLALEYQKKDDFTGWFEKVYSDALEHPQEIP
FT                   WAKMQPHTCLENWLKTKNISNKKALVIGCGLGDDSEFLAKKGANVTAFDIAPSSIEWCK
FT                   KRFNDSSVNYLVADLLKLDDSWKNSFDLIFESRTIQALPTSIRREVIEAIATLLKPKGT
FT                   LLVVTRLRDTEDTPDGPPWPVSDGELSQFHEYGYEEITRIPYSDPNNLSIKQALIEYQR
FT                   KRL"
FT   gene            complement(130291..131271)
FT                   /locus_tag="cce_0142"
FT   CDS_pept        complement(130291..131271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0142"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49494"
FT                   /db_xref="InterPro:IPR014940"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49494.1"
FT                   /translation="MEKYTYFISKKTKIEGTLTLPDEVNNPPVCLFIGGSFPQTRDGNL
FT                   DNSKKDWFPVTLPERNLFKDEAKLFEGLGYATFRYDKRGCGESEGNCDTVDLSDLVNDA
FT                   REAIKWLKTLPEVDNNRIGILGQSEGAVIALMLASENLNLAFYIWQGGVYRNLEDILFW
FT                   QRDNFWKLEQGAIENFKNTFPLMYWVYAQTDELWNKIKQGETNFKLGDETWSKDFYLPL
FT                   WKQHYDHPPYEFISEIKCPVLLLHGELDHNTPYTEALLAEEALKQAGNSQVTTHIFPGL
FT                   DHSFRRLGNPDEDFITAMKRPLDVQVTKAIRQWVKSDLEFRRYDL"
FT   gene            complement(131293..131580)
FT                   /locus_tag="cce_0143"
FT   CDS_pept        complement(131293..131580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49495"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZC9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49495.1"
FT                   /translation="METITIPKGFKVTPEQFDQLASAEQLVRMELTKKGELIIMSPTGG
FT                   EAGRKNRRLTQQMETVEIYRLGYELKILNHPQTLSGENILPGFVLDLSEI"
FT   gene            131697..134273
FT                   /gene="pepN"
FT                   /locus_tag="cce_0144"
FT   CDS_pept        131697..134273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="cce_0144"
FT                   /product="aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49496"
FT                   /db_xref="GOA:B1WZD0"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49496.1"
FT                   /translation="MTLKHFDSENNNRKFELPGAKPHYNPDRYGQVNHIFLDLTLDIPH
FT                   QSFTGTCAITLTPVRSGINQLILDAVDLNINSVFINKVSQPFDYDKEKLTINLLQPTQE
FT                   NPITIIINYGVENPQRGLYFIAPNEHYPDKPTQVWTQGEDEDSRFWFPCFDYPGQLATS
FT                   EIKVKVPNNFMAISNGELINQETVGEETIYHWSQKQIHPTYLMTLAVGEFSEIKDQWKG
FT                   IPVNYYVEKGKEEEANLSMGKTPQMIDYFSSKFGYDYPYPKYTQVCVNDFIFGGMENTS
FT                   TTLLTDRCLLDEKALNDRPFTESLVAHELAHQWFGDLVVIKHWSHAWIKEGMASYSEVL
FT                   WTEHEYGKDDAAYYLLNEARSYLEEDSSRYRRPIVTNIYREAIELYDRHLYEKGACVYH
FT                   MIRGILGDELFDKAIHRFVNENAHKTVETIDLLRAIETSTGYNLLFLFDQYVFRGGHPD
FT                   YKINYSWDNDNNLAKLTITQTQVTEEEGNSKDSFDLKIPIGFGYKNSAMKTFTLRIHEK
FT                   QQSFYFPLESKPDYISFDVNNYFLKTVELDYPIAELKAQLSHDPDPISRTYAAIAIGKK
FT                   GNLEAIKSLEEALIKDSFWGVRLEAAKQLGKISLDQAGEALQKGLSDDNAKVRRAVIES
FT                   LGNIKNNYCYETLKTCLETENTSYYCEAAIARSLGSILSGNLKEKTPEVIDLLKNILET
FT                   RSGWNEVVRSGAIGGLSQLKTNPDAVDVIFEYTKLGIPQALRLAAIRALGSISTGQTPN
FT                   KLEEILEILEAISQETFFLTQVAATIALGQMETPKAVTILQGLADRTPDGRVKRKAEEA
FT                   IKKVQKKLGSDKGMQSLRDELEKLKQENQDLQSRIANLEAKNGQAK"
FT   gene            135086..135391
FT                   /gene="kaiB4"
FT                   /locus_tag="cce_0145"
FT   CDS_pept        135086..135391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiB4"
FT                   /locus_tag="cce_0145"
FT                   /product="putative circadian clock protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49497"
FT                   /db_xref="GOA:B1WZD1"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49497.1"
FT                   /translation="MFAMKSTYSLKLYIASNTVNSQLAMNTLTEICHEDLNDDCHIEII
FT                   DILDNFEKAETEKIVAIPTLLLQSAYSSQKRLVGNLSNREQVLQEIKMLQKNAVYN"
FT   gene            135731..135976
FT                   /locus_tag="cce_0146"
FT   CDS_pept        135731..135976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0146"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49498"
FT                   /db_xref="GOA:B1WZD2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49498.1"
FT                   /translation="MSIYVGNLAYEVTDADLNTVFSDYGSVKRIHIPTDRETGRPRGFA
FT                   FVEMDTEEEESKAIDTLDGAEWMGRSMKVNQARPRN"
FT   gene            136287..136580
FT                   /locus_tag="cce_0147"
FT   CDS_pept        136287..136580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0147"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49499"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="InterPro:IPR022516"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49499.1"
FT                   /translation="MAKEKVIEFLGEAAKNQDLKEKLQTVKNPDELTSLAKEKGFEFSS
FT                   ENVDEALEELKQQPGFFGKLAEAIAEAFSPPHDNVPPSIGAQPYSGDSNPNS"
FT   gene            complement(136640..139609)
FT                   /locus_tag="cce_0148"
FT   CDS_pept        complement(136640..139609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0148"
FT                   /product="cation-transporting P-type ATPase, E1-E2 type"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49500"
FT                   /db_xref="GOA:B1WZD4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49500.1"
FT                   /translation="MQRTGMVSPDTSDRPLIYSGLTSEQVQFNRHHYGSNILTPPQKTP
FT                   WWSLYLDKFSDPVIRVLIIAAIIALAIGIIEGEYAEALGILMAIFLATTLAFVNEYRAN
FT                   KAFDLLNHVYNQTPVKVIRDHKFTQISRQDLVVDDLVYIEQGDEVPADGELLEAVSLLV
FT                   DQAKITGESKTVKKLSKSTFLSNYSEQQTYPPFRVYRSTIVAQGHGIFRVTAVGDRSEI
FT                   GQVAQAVISLENYQLTPLNIQLQKLSQLIGIIGLLMAGLTFSGLLIQGIIREKISLNFP
FT                   QTYCLSLVLISSLIIFIPVWFPIVKEGLKAVTLSFDCPQLFPDYSLNLWVVSVSSGLLL
FT                   FLGGISLIYFQGWINHVNDILLSPSVGIIILNYFMVAVTIIVVAVPEGLAMSVTLSLAY
FT                   SMAKMAAMNNLVRRMHACETIGAATVICSDKTGTLTQNKMQVEIANFPCLNCLKPTQKQ
FT                   IYQNLIYEGIAVNSTADLERTSQDNYSSIGNVTEGALLLWLNHQTVDYLTYRHHFNLII
FT                   QLPFSPEQKYMVTAGKSTVISGNILYFKGAPEIILSRCSQQLTSTGIRELDNKDEWLQS
FT                   IYIYQERGMRVLGLAYNYLDSQVTEKEINNVSNDLIWLGFFAITDPLRPDIIEAINRCF
FT                   QAGIEIKIVTGDSQKTAEEIAKKLNLYTTENNHNHPCFHLTGQEFNQLNEEEAKSVIKT
FT                   LKLLSRATPLDKLRLVKLLQKNGEVVAVTGDGTNDAAALKQAQVGLSMGSGTAIAKEAS
FT                   DIILLDDSFNSIVTAVMWGRSLYENIQRFLLFQLTVNIVALGIAFFGLFIGISLPLTVT
FT                   QMLWINLIMDTFAALALATEPPHETVLNKPPRHPQDFIISSKMLNLIMRTGSIFLLFLM
FT                   GFLAYLERDGTVTPYELSIFFAVFVFLQFWNLFNTRSFGLKQWFWQGLGENKAFLAITT
FT                   VIFLGQIFIVQWGGKLFRTVPLSFKDWFWIILGTSFVLWIGELWRFLLRKRTDNTVYIE
FT                   "
FT   gene            139894..141837
FT                   /locus_tag="cce_0149"
FT   CDS_pept        139894..141837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0149"
FT                   /product="probable protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49501"
FT                   /db_xref="GOA:B1WZD5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49501.1"
FT                   /translation="MLVCPQCHSENPNNSQVCQQCQTSLTHQSCPQCGHQTPVSEPHCS
FT                   KCGTFMGKLWQVILAQPMSSDQTEKSLTFDNNYLDLGQRYQIWPSQETETFKVIATTST
FT                   HTLYQGQVLDCQPLEQSTLPTLVNQVSDLLKESEEEDPTLLWEQMGIPAHAFPYLTLKD
FT                   LTPVVPEVYDAWTAWTVNETEVILLPDRTHWQTIPDLVIHQSLLTLQIIYWLNQMVTLW
FT                   NSLSAINYCQSLLVEENLRLDEDQTFGLLKLYPDRPDAPPSLQQLGQLWQTWLTQGGYP
FT                   CESKLASLIQRVAEGKLNQVAELRLELQDLAAEQQMTDDQENLTNTQVSPSSLDFVAEE
FT                   LPEFQEELLSDPLEETPTATDIANESTAVLPMELVNLTALGCTDRGRQRHHNEDYFGMN
FT                   SELNIRQSNQGRIVNGRGLYLVCDGMGGHAAGEVASKMAIETLENFFAQHWQDDFPDQE
FT                   TILQGILLANKKLYDVNQSNASSGSGRMGTTLVLMLVDQTKVAVAHVGDSRVYCISRKK
FT                   GLEQLTIDHEVGQRAIQQGIEPKLAYARPDAYQLTQALGPHDNKYIQPDIRFIDLAEDT
FT                   LFLLCSDGLCDNDLVEDYWETYLLPLLKSTQSLDKTMRKLIEFANSYNGHDNITAVLVK
FT                   LKIRPKVNPKDW"
FT   gene            141878..142975
FT                   /locus_tag="cce_0150"
FT   CDS_pept        141878..142975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0150"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49502"
FT                   /db_xref="GOA:B1WZD6"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49502.1"
FT                   /translation="MTQLTNDKRPILYFAATGHGFGHAVRISSVADAILKLRPDSLLIM
FT                   VTTAPRWLLESYISGDFIYRPLAFDVGVIQSDSFQMDKAATLDKIQEIYEKRQALMAAE
FT                   INFIKTNRVDLILADIPPLMAPIAQLAGVPCYMMSNFGWDFIYDAWGQDWQGIVNWIKD
FT                   CYEQCDRLFRLPMAEPMNAFNSITDVGLTGGNPRYNIDEIKDKFDLTASLEKTVLLTFG
FT                   GLGLQQIPYQNLAQFSDWQFITFDRNAPNLDNIIKITDSFYRPVDFMPLCSRVISKPGF
FT                   STFAETMRLDIPIVSLVRNDFAEAALLLEGIKNYADHQIVETNSFFEGSWDFLKQDPNP
FT                   PQIGKVLPKDGAEVIAKGILDGVNF"
FT   gene            143319..143537
FT                   /locus_tag="cce_0151"
FT   CDS_pept        143319..143537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49503"
FT                   /db_xref="GOA:B1WZD7"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49503.1"
FT                   /translation="MKEFDQKLDKQSEQITTIKATLQAQQPLIQKIPDLAEKVGELKNW
FT                   RQIVIIALIATISASVTWVIRGKNFKP"
FT   gene            complement(143553..144431)
FT                   /locus_tag="cce_0152"
FT   CDS_pept        complement(143553..144431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0152"
FT                   /product="putative dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49504"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49504.1"
FT                   /translation="MKKLLITGASGFLGYNVCQYAQENWQVYGTYYHNRINIDRINCFK
FT                   VDITNIQELHTVFNEIKPDGVIHLAAASKPNYCQNNPEDAYQINVTASLNLAKLCADGN
FT                   IPCVFTSTDLVFDGLNSPYQESDPVSPISYYGEQKVQAEQEMLAIYPKTVICRMPLMFG
FT                   IPSSHAASFIQFFLTTFREGKPLSLFTDEYRTPVSGLTAAKGLLLALEKGEGEIIHLGG
FT                   KERISRYQFGHLMAEVFDFSQELITPCSQQDVPMAAPRSPDTSLDSSKAFQLGYEPLSL
FT                   REELEQLKDKV"
FT   gene            complement(144490..145188)
FT                   /locus_tag="cce_0153"
FT   CDS_pept        complement(144490..145188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0153"
FT                   /product="putative HAD-superfamily subfamily IA hydrolase,
FT                   REG-2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49505"
FT                   /db_xref="GOA:B1WZD9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011949"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZD9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49505.1"
FT                   /translation="MKQPKVIFFDAVGTLFGVKGSVGEVYSYLATQVGVQCDPQKLETA
FT                   FFKQFKKSPPLAFRGVDIMAVSDLEYQWWYQVAYDTYQEAEVMDQFKDFDGFFRQLYDY
FT                   FATPHPWFLYTDVFPALQHWQKQGIPLGIISNFDSRIYEVLDLFGLSNFFQTITISSTT
FT                   GTAKPDVDIFIEALKKHQCQPKDAWHIGDSKKEDYEGAKAAGINAFLLERNGDIDRSDY
FT                   TIVNSMEMLI"
FT   gene            complement(145221..146411)
FT                   /gene="ndbB"
FT                   /locus_tag="cce_0154"
FT   CDS_pept        complement(145221..146411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndbB"
FT                   /locus_tag="cce_0154"
FT                   /product="type 2 NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49506"
FT                   /db_xref="GOA:B1WZE0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49506.1"
FT                   /translation="MSEQPLRICIVGGGFGGLYTALRLTQFPWEEDQTPEIILIDKNDR
FT                   FLFTPLLYELITEEMQTWEIAPPYEELLAGTTVRFHQGCVTDIDIDNQQLQLDNHHSLH
FT                   YDRLVLAMGGKTPLDNFSGVKDYAIPFRTLENAYRIKERLRLLEEKEAEKIRIAIVGGG
FT                   YSGVELACKLADRLGDTGRIRLVERGEKILKDSPEFNRDVAQTALEARRIFVDLETEVT
FT                   QVSSDSISLAYKGKIDTIPVDLVLWTVGTQVTEMIKELPLQKTPKGLLKINSQLQVIDN
FT                   PEIFAIGDLVACYDESQNLIPATAQTAFQQSDYCAWNLWASISHRPLLSFAYQPLGEMM
FT                   ALGIDNATLSGLGINLDGPLGYMARRLIYLYRLPTLKHQINVGINWITKPLTDLFV"
FT   gene            complement(146564..147169)
FT                   /gene="lrtA"
FT                   /locus_tag="cce_0155"
FT   CDS_pept        complement(146564..147169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrtA"
FT                   /locus_tag="cce_0155"
FT                   /product="light repressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49507"
FT                   /db_xref="GOA:B1WZE1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49507.1"
FT                   /translation="MSMKLLIQGNNIDVTESINDYVTQKLEKAVKHYQTLTTKVDVHLS
FT                   VAKNARITNKHKAEVTVYANGTVIRAQEGSENLYASIDLVSDKIARQLRKYKEKINNHK
FT                   PQSSVKNPEVLPEREIEKDLIGDREAALPPEVIRMKYFAMPPMSIEEAKHQLELVDHDF
FT                   YMFRNQDTDEINVIYMRNHGGFGVIQPREPNENDKTSA"
FT   gene            147459..147572
FT                   /locus_tag="cce_0156"
FT   CDS_pept        147459..147572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49508"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49508.1"
FT                   /translation="MIPVPNLYPKGFISWLGEELVRKTCFWWRFFQSFAPR"
FT   gene            147690..148367
FT                   /gene="lipB"
FT                   /locus_tag="cce_0157"
FT   CDS_pept        147690..148367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="cce_0157"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49509"
FT                   /db_xref="GOA:B1WZE3"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49509.1"
FT                   /translation="MVMSTLSLLEPRRCILQNLGIIPYEVAWERQRSLVNQRLQDPSLD
FT                   DTLLLLEHPPVYTLGTGANTKFIKFDPQQSPILVHRVERGGEVTYHCPGQLVGYPILNL
FT                   RYYQQDLHWYLRQLEEVIIQILNDYHLPGKRIPGLTGVWVNNYKVAAIGIKVKRWMTMH
FT                   GFSINVCPDLEGFKQIIPCGIDTKPVGSLQQFLPEITVEEIQQKVAQKFSQVFQVQYIS
FT                   MID"
FT   gene            148411..148905
FT                   /locus_tag="cce_0158"
FT   CDS_pept        148411..148905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0158"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF427"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49510"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49510.1"
FT                   /translation="MRPTPIPPQPGQESVWDYPRPAILQDTDKHLKVICNGIVLAETTK
FT                   GKRVLETSHPPTYYFPAEDVKLEHLIETSKTLMCEWKGRYIYYDINIGDKYIKYGAWRY
FT                   VQPTPNFVSLKTYYAFIPALMDACYVNDELATPQTGDFYGGWITKDIVGPFKGGPGTWG
FT                   W"
FT   gene            complement(148957..150054)
FT                   /gene="tgt"
FT                   /locus_tag="cce_0159"
FT   CDS_pept        complement(148957..150054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="cce_0159"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49511"
FT                   /db_xref="GOA:B1WZE5"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49511.1"
FT                   /translation="MAFSFQLQKKCLHTQARVGTWSTPHGLVETPRFMPVGTLATVKGL
FT                   TPAQLETTGAQMILANTYHLHLQPGETIIEAAGGLHEFMGWNGPILTDSGGFQVFSLSE
FT                   LRKIREIGVTFRSPRDGRIIELTPERSIHIQNALGADVIMAFDECPPGNADYDTVAAAT
FT                   DRTYRWLERCIKAHQRPHDQALFGIVQGGIYPKLRSDAVSALIPLDLPGYAIGGVSVGE
FT                   EPALVRDIVKLTTPLLPVSKPRYLMGVGTYKEMVMAIASGIDLFDCVIPTRFGRHGTAL
FT                   VAGERWNLKNAQFREDFTPLDPECPCYTCQTFSRAYLNHLVRSQEMLGYILLSLHNVTE
FT                   LVRFTQRIREAILKDRFTQEFGHWL"
FT   gene            complement(150080..150880)
FT                   /locus_tag="cce_0160"
FT   CDS_pept        complement(150080..150880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0160"
FT                   /product="unknown"
FT                   /note="contains a MOSC domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49512"
FT                   /db_xref="GOA:B1WZE6"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49512.1"
FT                   /translation="MNINQKPCLSKIIVYPIKSLDGVSISLGTLLKSGALKQDRQWAIF
FT                   DKNQSLINGKRNNKIYQLRATYDDSLSQVTLKYGDNNVSQTFDLTEQKKQIESFLNDYF
FT                   GCFVYLKENRKTGFPDDTDASGPTIISQATLSTIAQWFPHLTVEEIRRRFRANLEINGV
FT                   SAFWEDQLFANKNQWINFRIGDVNFQGINPCQRCIVPTKNSYTGEKTENFQQQFITKRK
FT                   ETLPPWVNRSQFNHFYRVSVNTKVTNLQQETHVKVGDEVKIIDN"
FT   gene            151192..151965
FT                   /locus_tag="cce_0161"
FT   CDS_pept        151192..151965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0161"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49513"
FT                   /db_xref="GOA:B1WZE7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49513.1"
FT                   /translation="MNLIRIWIIASNGFREVIRDRILYVIGFFAVVLALSLRLLPEISV
FT                   GADGKIFLDVGLGLTSFLGAIVAIFVGTALINKEIEKRTVLILIPKPISRAELIVGKHL
FT                   GLCGVLAVVITIMTVLYLGALTWANITFSPVSLIVSQFYLLLELAVLTAVAITFGVFTS
FT                   SILATLLSFGIYIIGHLSNDLLELAKLSKNPSITALTESIYLVVPNLERFNLKNTAVYG
FT                   ILPSSSELLINLVYGIVYIVLLLTVSSFIFSRRQF"
FT   gene            complement(151918..152043)
FT                   /locus_tag="cce_0162"
FT   CDS_pept        complement(151918..152043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49514"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49514.1"
FT                   /translation="MTKTVESREHPMPIVNIIKGCLFTDFLELSAGKNKARNCQQ"
FT   gene            152218..152328
FT                   /locus_tag="cce_0163"
FT   CDS_pept        152218..152328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49515"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZE9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49515.1"
FT                   /translation="MHLEGVFKVLGQKLKRFLPTTFTPSSHAVPTSNLID"
FT   gene            152388..153749
FT                   /locus_tag="cce_0164"
FT   CDS_pept        152388..153749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0164"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49516"
FT                   /db_xref="GOA:B1WZF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49516.1"
FT                   /translation="MKTLTSQYSESFQQETKMAKSIYYQNWSHKLIRHIYCLLNSDVDP
FT                   NEKIAKILALTGEAYHIDNLVLLRIESSLCQIYHTWGVRDKNWLETFIEQHWFPLINCR
FT                   QEHPVYQFCQGTGMSTESWEIASYKKNQHKYQLNCCILSLPLYLSEHFFGYLILQTEQS
FT                   ERSFNPEEIENLELITHQIAIAIKQVQWLERINKIELENKKLKLSSHNKSDYFSHVSHE
FT                   LRTPLAGILGFSKMLREEIYGTLNEKQKQYVNGIRVSGEHLLALVNDFLDLSKIEANKE
FT                   ELFLETVAVEDICLAAISIVQPKANEQNLDLILNLSEQVDFCTVDQRKIKQILINLLSN
FT                   AIKFTEKGSVTLQVKKIESLLTFCVIDTGIGIKEEDQQKLFQPFQQIHSNLNRKHKGTG
FT                   LGLALSRKLAQLHQGNLTLTSEYGKGSCFTLELPLEGVRSCLLSPDTMAQKLNL"
FT   gene            154024..155208
FT                   /locus_tag="cce_0165"
FT   CDS_pept        154024..155208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0165"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49517"
FT                   /db_xref="GOA:B1WZF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49517.1"
FT                   /translation="MQRPFNPFNVIERMSSFNYTGQLIITREDITWTIDLERQNLKYAS
FT                   HSLQSIETLELCLYTLGYGEKTPTILKKINQSGFTEEKGKNFIQRATDWLIQEENLSLS
FT                   QQINFINQLTQDALESFFEITTFSYYECEEKSYFFPSEQGFKVKDILNFWRTKQQTWQS
FT                   FNSVIISPHQCINLTELPNLLHSQSSHLLTKLAHQQGKVSLRQLSILLKLEDWEVAELI
FT                   YPHLQSGILQLDSPLPPFNQLPPFTLSYQSLKVNKPSNQIVKTEGIRHSHECKNIVCID
FT                   NDNSRLNTIRKYFNSENTNLYLVSEPHLALEQLFTIKPDLLLVDTNTSGINGYQFSKII
FT                   KKSSAFQHLPIIMMSAEEEKITAAQIEENVVNDFLSKHCSESELIRVIKKYLEL"
FT   gene            155329..156159
FT                   /locus_tag="cce_0166"
FT   CDS_pept        155329..156159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0166"
FT                   /product="CHP268-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49518"
FT                   /db_xref="GOA:B1WZF2"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49518.1"
FT                   /translation="MLTDKLNQLKTIFVEMERALIAYSGGIDSTLVAKVAYDVLGDRSL
FT                   AVTAVSPSLLPEELEDAKIQAATIGIPHELVNTQEMNNPNYTSNPVNRCYFCKSELHDT
FT                   LKPLALKRGYPYVVDGVNADDLRDYRPGIQAAKERGARSPLAEVGITKLEVRQLSQGLG
FT                   LPWWDKPAQPCLSSRFPYGEEITIEKLQRVGRAEIYLRNLGYHNLRVRSQGETARIELP
FT                   PEKIKEFVATTDLEKLVTKLQELGFIYVTLDLEGYRSGKLNQEILGQGVANTLS"
FT   gene            156192..157094
FT                   /locus_tag="cce_0167"
FT   CDS_pept        156192..157094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0167"
FT                   /product="unknown"
FT                   /note="contains a CHP147 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49519"
FT                   /db_xref="GOA:B1WZF3"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49519.1"
FT                   /translation="MTKRALLLVNRHSRRGQHSFAQAVDILNDLGFELIIVPIQSSEQL
FT                   PQLVRQHGPKVDLVIVGGGDGTLNGVVDSLMDMNLPLGILPLGTANDLARTLKIPFGIP
FT                   QACRVIAEGQLKYIDLGWVNGKHFFNVASLGLSVDITEKLSKGAKRRWGVLAYAMTALQ
FT                   VMSQTRPFHAHIVMNGERIDVKTIQIAVGNGRFYGGGMAVAEDATIDDQRLDLYSLELQ
FT                   YWWQIFPLLWRLPQGQHGYLPWVRTLEGEYIEIYTRKSQDINTDGEIVTATPAVFRVIP
FT                   QSLGVFVPRNSLITLDPNI"
FT   gene            complement(157160..157405)
FT                   /locus_tag="cce_0168"
FT   CDS_pept        complement(157160..157405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0168"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49520"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="InterPro:IPR039314"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49520.1"
FT                   /translation="MNWCEQQKIMTTTNTGLQERIDEAIKEARRLSAEGNTTQAAEAWD
FT                   EVEELFAEASHQKQTTNFQQYCQDNPDAKECRIYDV"
FT   gene            157694..158500
FT                   /locus_tag="cce_0169"
FT   CDS_pept        157694..158500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0169"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49521"
FT                   /db_xref="GOA:B1WZF5"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49521.1"
FT                   /translation="MFQILTGFGFLSGMSYPFRLLGLFKSNPGLLSYIIVPILVNIVIG
FT                   TFLYIGLFLFGWQVTQLLTDSIINRLDLLLADLPTWLNSLDYVVIFLGWLIRIILSLLL
FT                   LILTGFILVQFGVLLAAPWYGNLSEKIEKIRTDKVEIIEVGMVRDIWRAILFELKKIVL
FT                   ILACGVLIFFLSFLPIIGAIISTVGGITVTGTIICLDFFDGALERRRLNFRKKVNLVWK
FT                   CFPASAGFALICLLLIGIPFVNLITIPFCVGSGTLFVCDRILPKYL"
FT   gene            158526..158843
FT                   /locus_tag="cce_0170"
FT   CDS_pept        158526..158843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49522"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49522.1"
FT                   /translation="MIKFNTKIRQKIVPDLVTYLSKFEEITEFLHHKSTKTLMWNPIDK
FT                   DSHHLYDHNNQICIGDHSGEAITLEIVNRIFKQLLSIFREVSEQLKQLQTFKFADYIRV
FT                   T"
FT   gene            158853..160382
FT                   /locus_tag="cce_0171"
FT   CDS_pept        158853..160382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0171"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49523"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1WZF7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49523.1"
FT                   /translation="MDISTLIKQLQNPNSYPHTVQDSIKVLQTHASAIFLTGNYAYKIK
FT                   KPVDFGFLDYSTLEKRQHFLNQELVMNQAIAPDIYLEVLPITIKNDQVKIGEEGKIIDY
FT                   VLKMNQFPQDCLFINLFQAGKLEKKHLENLGKVVAEFHKNTQTNDYIRRFGNIEMIKKS
FT                   IDENYERTEKYIGIVQTEKQYQETKEFTNHYFELKQNYFKQRQQADKIRECHGDLHLKN
FT                   VCLWNGKIELFDRIEFNEEFRYVDVMFDIAFTIMDLDARNRTDFSNIFLNTYLEYTGDW
FT                   QGLQVLPLYLSRQAYVRAKVNSMLLDDSNISEKEHQKAQEDAKNYYHLAWKYTQQHQGK
FT                   IIMMSGLSGSGKTTMAKYLAQDINAILIRSDAVRKHRGNIPLDETGDNELYSAAMNQET
FT                   YKTLIQLGEMMAKEGFNVILDAKFDRHQWRETVIEIAKKYNISLTILYCYAPLKILSDR
FT                   LSKRQGDISDATPNLLKQQQNNAQDFNEKEMSYVKIIDTTNNWKEQIKDLF"
FT   gene            160715..162070
FT                   /gene="hemL"
FT                   /locus_tag="cce_0172"
FT   CDS_pept        160715..162070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="cce_0172"
FT                   /product="glutamate-1-semialdehyde aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49524"
FT                   /db_xref="GOA:B1X023"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X023"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49524.1"
FT                   /translation="MCPRQTSSEVRHEQKEINLVSTTSLKTTKSEDIFAAAQKLMPGGV
FT                   SSPVRAFKSVGGQPIVFDHVKGAYIWDVDGNQYIDYVGTWGPAICGHAHPEVIAALHDA
FT                   LDRGTSFGAPCLLENVLAEMVIDAVPSIEMVRFVNSGTEACMSVLRLMRAFTGRDKIIK
FT                   FQGCYHGHADMFLVQAGSGVATLGLPDSPGVPKTTTANTLTAPYNDLEAVKALFAENPD
FT                   EIAGVILEPVVGNSGFVVPDGGFLQGLRELTNEYGALLVFDEVMTGFRLSYGGAQEKFG
FT                   VTPDLTTLGKVIGGGLPVGAYGGRKDIMSMVAPAGPMYQAGTLSGNPLAMTAGIKTLEL
FT                   LQKPGTYNQLEQITQQLSEGLLKIAKEAGHQVCGGYIGAMFGLFFTEGPVRNYDDAKKS
FT                   DLAKFGRFHRGMLEKGVYLAPSQFEAGFTSLAHTSEDIEKTLAAAKDVLSNL"
FT   gene            complement(162119..162535)
FT                   /locus_tag="cce_0173"
FT   CDS_pept        complement(162119..162535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0173"
FT                   /product="putative methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49525"
FT                   /db_xref="GOA:B1X024"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B1X024"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49525.1"
FT                   /translation="MKTSDKQFEVNKSEQEWKEALTPEQFNVLRKHGTERAGTSPLDKE
FT                   YGEGVYKCAGCGQPLFTSETKYNSGTGWPSFYQPIEGAIETSVDRSLFMTRTEVHCSRC
FT                   GGHLGHVFPDGPKPTGQRYCMNGVSLEFDSETEQ"
FT   gene            complement(162580..163389)
FT                   /gene="gst1"
FT                   /locus_tag="cce_0174"
FT   CDS_pept        complement(162580..163389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst1"
FT                   /locus_tag="cce_0174"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49526"
FT                   /db_xref="GOA:B1X025"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B1X025"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49526.1"
FT                   /translation="MGRGQHMIELYQFEVSQYSEKVRLILDYKGLEYRKIEVTPGVGQV
FT                   DLYKMSGQRQVPVLKDGDTIIADSTDIAFYLDRKYPEKPIIPTDPVKRGQCLLIEEWAD
FT                   ESIGTKGRIALIGALNQNPNFRTSVLPKEVPDFLKTLIGAVPGDILSALGTGVGFGPDA
FT                   VKEATKALKQDLEALSLILEHQPYLVGDEITLADLAVAGLSIILKQPGGDYLDIPDTLK
FT                   GKGIPGLADNTTYDAFFLWRDRLYMDYRKPLSTQPSSGDSPTTIDIE"
FT   gene            163648..165006
FT                   /locus_tag="cce_0175"
FT   CDS_pept        163648..165006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0175"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X026"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49527.1"
FT                   /translation="MKSERSRRDPHCGAQTRIVIMGAAGRDFHNFNQVYRHNSNVEVVA
FT                   FTAAQISGIANRFYPPSLAGPLYPEGIPIVDETELDTLCQEKDIDQVIFAYSDVTHRQV
FT                   MHLASRVLAGGADFLLLGPQQTMLTATVPVIAVSAVRTGCGKSQTSRWLSKLLQKKSFT
FT                   VAVIRHPMPYGDLEKQAVQRFATLDDLTQANCTVEEREEYEPHINVGNIVYAGVDYEKI
FT                   VQQAQQEADIILWDGGNNDFPFIRPDLHLVLVDPLRPGDETTHHPGEVVLRMADIVIIA
FT                   KVDAAEDANIQKVKETAQQVNPQALIIQGKSPIVLDQPELIRDRRVLVVEDGPTTTHGG
FT                   MAYGAGYIAATRAQAKEIVDPRPYAVPEIAKIYENYPHIGSVLPAMGYFPEQLKALETT
FT                   INQAEVDVVVAATPSNLGELIEVNKPIIRASYEFAEAQSPGLTEQIEAFLEKV"
FT   gene            complement(165063..165470)
FT                   /locus_tag="cce_0176"
FT   CDS_pept        complement(165063..165470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0176"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49528"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B1X027"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49528.1"
FT                   /translation="MKIQSMLSKINRVLAVLLLVSGLFLGTLTCNVPSSYAISQNNSSV
FT                   MIAMDSDVVDDALGSGTTDKIEGKVQKDVGTVEKKFGDDLEDNIEGTTKQVKGRAKQDI
FT                   GRTKNAIEEAGSKVEETSDNVVDAVKDFFGS"
FT   gene            complement(165592..165774)
FT                   /locus_tag="cce_0177"
FT   CDS_pept        complement(165592..165774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0177"
FT                   /product="putative CsbD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49529"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B1X028"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49529.1"
FT                   /translation="MSTEDRVDATMKNLEGKAQEMVGEVTGDPEDKAEGKMKQAKAEAQ
FT                   HSVEDAKDKVKKAID"
FT   gene            166258..166419
FT                   /locus_tag="cce_0178"
FT   CDS_pept        166258..166419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49530"
FT                   /db_xref="UniProtKB/TrEMBL:B1X029"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49530.1"
FT                   /translation="MNHFIVFIDSREETTYDIKTIISFDKYCSVFIDSKWSKSPESSRN
FT                   TRDITISK"
FT   gene            166448..167116
FT                   /locus_tag="cce_0179"
FT   CDS_pept        166448..167116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49531"
FT                   /db_xref="UniProtKB/TrEMBL:B1X030"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49531.1"
FT                   /translation="MVNVKNAPTGLIVGRLESADRVYIIDEVEDGWVQISYPIAGYVYA
FT                   DNLTYCTGNSSSEQPSNYDNPTAANPTTVPGSNCRQVSRDQLLVRQKPNGEIVGQLTDE
FT                   QRVMIANEGFNGWVPIEYPINGYVASQYLTDCETTANLPTSVNEENITTLADSNCRQIM
FT                   SPDVPVRAKPMGNIIGKLDQNNQVSIANEGYDGWVPIERPYSGYVTAANLGNCTASNNQ
FT                   "
FT   gene            167188..168453
FT                   /locus_tag="cce_0180"
FT   CDS_pept        167188..168453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0180"
FT                   /product="cardiolipin synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49532"
FT                   /db_xref="GOA:B1X031"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B1X031"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49532.1"
FT                   /translation="MIINILLFLIIIILVSLYLQGYFQPDKNYRFKNFPTSDLECFGLT
FT                   VANFSDSFIVSGKIINFWVGANEIFSARLNAIEKAKNFIQLETYIMTPGNRADQFAEAI
FT                   IKKARTGVKVQLVVDNYGVKSMPDSYWKNFKKEDIEVRKFNQFQWRNPLKNLRRNHRKL
FT                   LIIDNEIALIGGAGISDRWDGWSEIGDQEPWLDYEIAIEGNILTRLSGFFWQHWLDSRG
FT                   VIDFLNIPSQQKQDNLPKILVTANDYPSYKDSSIRGLFQTLILGSTQRLWIASPYFLPN
FT                   SNSCRMLRDAKARGVDVKILTMGEHCDKGFVRKVTRERYDKLFKGEIPIHEYQPSMIHA
FT                   KIILVDEDWICLGSANFDPRSFFQNDELNLSIKNRDFADRVEQFFIKAFEKSHLITIED
FT                   WHKRPFGDRLIGSFWSLFYWQL"
FT   gene            168416..168523
FT                   /locus_tag="cce_0181"
FT   CDS_pept        168416..168523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49533"
FT                   /db_xref="UniProtKB/TrEMBL:B1X032"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49533.1"
FT                   /translation="MVLSGHYFIGSYNYELASKYSLFDFSNHYPWLWGV"
FT   gene            168516..168893
FT                   /locus_tag="cce_0182"
FT   CDS_pept        168516..168893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49534"
FT                   /db_xref="GOA:B1X033"
FT                   /db_xref="UniProtKB/TrEMBL:B1X033"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49534.1"
FT                   /translation="MYNYQFLNNSLPIQGKVIDVDRSLTRNHDGSSSQNSYPIIEYISP
FT                   HTHEKQTLKASVAALNVETGTKVWLAYHQKKQAPKLISFGEIFLPFTLFGLFGVTLLLI
FT                   LVPLSTSSKMLYTLLKGLHIF"
FT   gene            168972..170135
FT                   /gene="spoIID"
FT                   /locus_tag="cce_0183"
FT   CDS_pept        168972..170135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIID"
FT                   /locus_tag="cce_0183"
FT                   /product="sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49535"
FT                   /db_xref="GOA:B1X034"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:B1X034"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49535.1"
FT                   /translation="MRKIVMTAKNKVNTQRKIVQTVWLTLGRYGGFIALIWLILCLPVQ
FT                   AAKELRIAVKKGVSAVQVGSSTPAIVRDAGGRPIGNLAALDGFTVKPRGSGVNLNQWNS
FT                   SYLIIEPKDDGVVWIGDRWYRGKVRVIRQGSGVTALNLVDIEEYLYSVVGAEAYPTWPQ
FT                   EALKSQAVVARTYALYKASTASNRYYDLDTTTNTQVYKGLETEFVTTHDAVKATLGQVL
FT                   TYNGKVILSAFHSSSGGHTENVEDVWSSPLPYLRGVVDYDQTAPVFQWSRSFSAWEMGR
FT                   LIGGVGSVRSLVPEKTTPHGRIITLKVVGSAGSRRITDDQLRKALKLKSTLFTVSNNNG
FT                   TFTIEGRGYGHGIGLSQWGTHYLAEQGIPYHQILSHYYKNARLTSLN"
FT   gene            complement(170231..171457)
FT                   /locus_tag="cce_0184"
FT   CDS_pept        complement(170231..171457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0184"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49536"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ63"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49536.1"
FT                   /translation="MPSNSQLNLMTNILQLEGFTVMDYQLIKGMGIVLSLEKVDKKTTC
FT                   IYCGSVTRKLHQNNELTIRDLSWGEQDVYLKINRRQMRCEKCQKKFTEELKDIKKKRTY
FT                   TERLKKKIVAEVLNGDIKNVAQRNGVSEQEIETMLKDIGQELGKKKPQKLRRLGIDEIA
FT                   VVKGQGKYYVVLVDLDKGVIIGLIEKRTEEEVSKYLEAWGEEVLRQIVEVSIDFWQPYK
FT                   KVAKKLMPQAEIVADRFHVMKQVTDELDAQRKKSKREAIALKDSPEKKQLLSGLNKSKY
FT                   ALLKNEEDLSDQQKEKLEEIYKTVPILSKMHLLKEKFRKVFDENIDWISGLFELADWCA
FT                   EAHTVYPKSFGTIRRWMGEIIAYFDERTNSGVVEGINNKLKLIKRRGYGFRNFDNFKLR
FT                   SFLTWHFSG"
FT   gene            complement(171844..172083)
FT                   /locus_tag="cce_0185"
FT   CDS_pept        complement(171844..172083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49537"
FT                   /db_xref="UniProtKB/TrEMBL:B1X036"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49537.1"
FT                   /translation="MVKKTDRLQEIKNSILETQQKLQGFEEKYKISTEKFLNRFETDQL
FT                   EHQLNMDFDEWMGEAWMLDKLQNKYKELQEIELC"
FT   gene            complement(172425..173780)
FT                   /locus_tag="cce_0186"
FT   CDS_pept        complement(172425..173780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0186"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF1704"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49538"
FT                   /db_xref="InterPro:IPR012548"
FT                   /db_xref="UniProtKB/TrEMBL:B1X037"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49538.1"
FT                   /translation="MGRNQGKSLSSPHHIQRETEMDSQVSDGEKDRIRQIASLLYEASR
FT                   PIRILKTIAWSAEVKEEFFANKAQELPKVTYTPIDPTITLEAVREARRSIVPISPIDLW
FT                   LERQANSLELAARMLSPSVVGDNAFFEYSRQLYGEPTTPLRYCPITPLELSQSICDTID
FT                   QLAHIEMDIATPEYHTAEEVAGDIERAVQKHFGEDAPKVELVDKLSANALATASTIKIR
FT                   REACFTDRDASQLLNHEAYIHVTTSLNGKAQTDLPILAAGHPGTTRTQEGLAVYAEIVS
FT                   GSMELDRLRRLADRVFAIQMAVEGADFLEVYRYFLERVGNPDQAFENARRVFRGGDIKG
FT                   GAPFTKDVVYLFGLLGVSSAIRTFFAAGRSDCLALLFCGKLDFMDIPALCELYEIGLCQ
FT                   APRHLPPWVRDPRYLLSLLTYSIFMNKIEMEPLVAVANKLLESAPVVKLFRD"
FT   gene            complement(173961..174500)
FT                   /locus_tag="cce_0187"
FT   CDS_pept        complement(173961..174500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0187"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49539"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNX7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49539.1"
FT                   /translation="MYIVDECHLHWEDICGYLWNLIKEPLKIPLLNPKERQTYYGALNL
FT                   LTQEFILLPYQKGNGKNTVDFVQQLQKKNPEAKTLWIWDGASYHRGKEMQKFLARENQD
FT                   LSPEEWRVTCCLFAPYSPQENPVEAIWLQLKTLLRRFYRFGKNFKIVKRLFQLFVELKL
FT                   FNLPNFKNYEAFSRFS"
FT   gene            complement(174551..174676)
FT                   /locus_tag="cce_0188"
FT   CDS_pept        complement(174551..174676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0188"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49540"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNX6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49540.1"
FT                   /translation="MVYQSLQSYYKILKEAKISWQKGQQINPRYHEEVTQKKTKK"
FT   gene            complement(174800..175012)
FT                   /locus_tag="cce_0189"
FT   CDS_pept        complement(174800..175012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0189"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49541"
FT                   /db_xref="GOA:B1WSK9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B1WSK9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49541.1"
FT                   /translation="MIIDNKEKIELIKEFLENSSNGRETQRALAVKLVLEGYRYERVSE
FT                   ILSVSLGFISKWVNAFNFGGINGLK"
FT   gene            175208..175981
FT                   /locus_tag="cce_0190"
FT   CDS_pept        175208..175981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49542"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B1X041"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49542.1"
FT                   /translation="MNNIDRLLTFLIGLGLSLPTVLPVLAQTSPPAPENLKTTEALLSQ
FT                   VCDFLKAQPAFTVETDVTYDNVLESGEKVQYSGYQELWVSKPDRMRSDYTGDERITRFY
FT                   YDGQSFSLFTPPLDVYATKEAPANLDDVVEQIAQRYGITIPMSNLLLSNPCGAIATEIE
FT                   NAVFVGNNLVNRQETYHILLKGEERDIQLWISKTEPPLILKGIINYKTLPSSPQYTALF
FT                   SNWNFNPSLTDDIFRFVPPQDAVGIEILPSQSNEE"
FT   gene            175905..176813
FT                   /locus_tag="cce_0191"
FT   CDS_pept        175905..176813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49543"
FT                   /db_xref="UniProtKB/TrEMBL:B1X042"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49543.1"
FT                   /translation="MTFFGLSPLKMLSVSRFYPHSPMKNNSSGVSMMKLISSRFSLFFL
FT                   TLLLCISLLPLESAFAQRGRGRGGFRGSGGGGASPRINRSTSLQNRGSFNSSGRTRQGN
FT                   RDQFQQDRQANRDQFQQNRQGNQQERQGNRDQFQQNRQGNQQERQSNRQENQQNRQNTI
FT                   QENQQNRQNFIDDNYNGDRWYGGGWYGRGYYAPPGWGAWTAAVGLAAGVAIGATVDSPP
FT                   PYYSTVYVDNTPYIYSDGVYLQPQGNSYVVVAPPVDAVVSYLPDGCTSTQMNGTQYFDC
FT                   SGIYYQMVYQNGTTVYQVVEF"
FT   gene            complement(176873..177187)
FT                   /locus_tag="cce_0192"
FT   CDS_pept        complement(176873..177187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49544"
FT                   /db_xref="GOA:B1X043"
FT                   /db_xref="UniProtKB/TrEMBL:B1X043"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49544.1"
FT                   /translation="MEFWIFVVIALIISALGICIGGSMVVYKKRQLPTQKPQRTAPSSH
FT                   LQKPSRKSLILPMGGLLGVSMFLLIIGYGTMNIVAAAVGFLLLFLAFGLVGSFIFNQIF
FT                   "
FT   gene            177404..179071
FT                   /locus_tag="cce_0193"
FT   CDS_pept        177404..179071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0193"
FT                   /product="unknown"
FT                   /note="contains DUF1400"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49545"
FT                   /db_xref="GOA:B1X044"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:B1X044"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49545.1"
FT                   /translation="MQLSRLRVSLRSLTLSILGILATSLPVTAAEKLYLSYGPLMLSLR
FT                   VESLELFAKDGTINQDLGFYLDRATPAQQDQFRQALTKRVDLSPVMLSRFFNSKLGEDI
FT                   LYRFGKGITILGGRNGKYALRGAIVQAAFDLEEGLTLLNVLRKFSTDVQFQGELLLGLV
FT                   QEVDKVVKGTEAFTEAMATLSKAEAALETPVDFAQLPNIQKAGNLGFTKQILNLTDSQR
FT                   NRSFYVIVYKPQQWREGKTPVVIISHGLASNPESFEDLAQYLASYGFVVAMPQHPGSDT
FT                   QQAKALLEGYSREVFDLQEFINRPQDISYVIDELERRNQVEFGGRLDLENVGVGGHSFG
FT                   GYTALAVAGATIDFDYLQKICDRLYGGLNTSLLLQCRALDLPRENYNFRDPRVKAVIGA
FT                   NPVNSGIFGQKGLSEIQIPILLISGNYDPATPAVFEQLRSFIWLTTPDKSLVLAEGQAH
FT                   VDFSELDGGISKVLDSVPDLTLPEPSLLKGYLQPTVLSFFEVHIANNEEYKPYLSSAYF
FT                   AYLSANEDFQVYRISPASEPDLMKKILDFREQYGVVAP"
FT   gene            complement(179083..179334)
FT                   /locus_tag="cce_0194"
FT   CDS_pept        complement(179083..179334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49546"
FT                   /db_xref="GOA:B1X045"
FT                   /db_xref="UniProtKB/TrEMBL:B1X045"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49546.1"
FT                   /translation="MNGKRILFAGIMTALIGFVIGLGVAKVGHPDEVRLRYETESARRL
FT                   FRRYGLLGGGIGFVVGAGQEYLRQAKIQRDQDEKSRNK"
FT   gene            179388..181167
FT                   /pseudo
FT                   /locus_tag="cce_0195"
FT                   /note="RND family multidrug efflux transporter;
FT                   nonfunctional due to frameshift"
FT   gene            181269..182927
FT                   /locus_tag="cce_0196"
FT   CDS_pept        181269..182927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0196"
FT                   /product="unknown"
FT                   /note="contains DUF1400"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49547"
FT                   /db_xref="GOA:B1X046"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1X046"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49547.1"
FT                   /translation="MTQPKMKQRFNTLVSLGSWLIGTTMVSPAIAAEEIKFYYNNLSQT
FT                   VKVESLEAFAADGTVKPDLRTIFNLVKPDEAEKAKFQAILLKPFQLNPVLLSRLLNTDE
FT                   GDRLLTRLGDLIEIQGGTNGKSVLRGSMIQAAAKPKGLTILNFLQTLPTNMQINVRRTL
FT                   QQAKNADFLVKTTGELVDTTERLSQEESKADPLSVDFSQLPNPGDKGSVSFTRERWDLR
FT                   DENRERAFYVEVYRPKLPPSAKMPVIVLSHGLGERPETYYETGELLASHGFLVAMPQHP
FT                   GSDTKHKQALLEGLARDIFSLNEFIDRPLDISYTLDELERRNQQEFGGQLNLTKVGAFG
FT                   HSFGGYTALAVAGATIDTKHLDKDCASDIGGFNQALLLQCRALKLTQPLPMVKDERIGA
FT                   VLVYNPVNASIFGPQGLAQVEVPVFVGAGSYDLSTPFIFEQARSFPWLVNAHQSYLLLQ
FT                   QGDSHVNIIKLGAGSYAIATSLLKLTLPDENLRQYYARPSIVAFAQVYVANNQEYLSYL
FT                   HPSYDAYLSEGQEFKAFLITGKSAPILNQSFPGTK"
FT   gene            complement(182959..183342)
FT                   /locus_tag="cce_0197"
FT   CDS_pept        complement(182959..183342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0197"
FT                   /product="putative camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49548"
FT                   /db_xref="GOA:B1X047"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B1X047"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49548.1"
FT                   /translation="MGMEFLSWLIVFLGGGLGSCGRYLISLLINEQIDTMFPWGTLTVN
FT                   LIGCLVIGIIIGLIERYPIHPYWGLLLVTGFCGGFTTFSSFSLENNLLLRNQEYFLLFV
FT                   YTLMSLLWGFAGTFIGLIVVKRI"
FT   gene            183447..184406
FT                   /gene="ntcB"
FT                   /locus_tag="cce_0198"
FT   CDS_pept        183447..184406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcB"
FT                   /locus_tag="cce_0198"
FT                   /product="LysR family transcriptional regulatory protein,
FT                   nitrogen assimilation transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49549"
FT                   /db_xref="GOA:B1X048"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1X048"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49549.1"
FT                   /translation="MRIEQLQAFLAIADTGSFGQAASQCGITQSTISRQIQALEGNLGA
FT                   LLFHRSTQAKLTVAGEKLLPRAKKICQEWATVGQEIKDLQAGKQPELCVAAIHSVCSHF
FT                   LPPILQQFCLDYPQVQLRVTALGSDRALKVLRDGLVDIAIVMNNRFLTTSPEMTVDLLY
FT                   EEKIDVLMAVNHPLTRYDQVPHTELSNYPHVVFKDGYGMQRLLQEWCSIHNLSINAVME
FT                   LNTLDAFRGVVRQGEIIALLPETALLETRQDNRLAVRSLAPICDKSNQKSPTLLTRQVV
FT                   LVSTSDRITIPPIAHFCHLVRQGVTRFNEQTISKSLSA"
FT   gene            184508..185584
FT                   /gene="chlI"
FT                   /locus_tag="cce_0199"
FT   CDS_pept        184508..185584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlI"
FT                   /locus_tag="cce_0199"
FT                   /product="magnesium chelatase, ATPase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49550"
FT                   /db_xref="GOA:B1X049"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011775"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B1X049"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49550.1"
FT                   /translation="MTATLQAPPKTHRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMI
FT                   MGDRGTGKSTTIRALADLLPEIEVVDNDPFNSHPSDPDLMSDNVRQALEEQGSLPVAHK
FT                   KVIMVDLPLGATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLV
FT                   DVLLDSAASGWNTVEREGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKE
FT                   PNLRVQIVEQRSEFDRDPQKFCETYQSQQEELQNSLVKAQNLLPSVNIDYDLRVKISEV
FT                   CSELDVDGLRGDIVTNRASKALAAFEGRTEVTVDDIRRTMVLCLRHRLRKDPLETIDSG
FT                   YKVEKAFNRVFGLETEEN"
FT   gene            complement(185656..186729)
FT                   /locus_tag="cce_0200"
FT   CDS_pept        complement(185656..186729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0200"
FT                   /product="hypothetical protein"
FT                   /note="contains UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49551"
FT                   /db_xref="GOA:B1X050"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B1X050"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49551.1"
FT                   /translation="MIPKRKIALSLSNLFLIGGAAFLLLLLWQLKGLIIILMIAIVIAS
FT                   TLSPLVGSVERMGLPRWFSVIFVYLLLVLLLTGIGLLLGPTIIAQLQRLLEKLPGYIEI
FT                   LGKQIQFFMTEKGFTEPEILEFLNRQFNLQSIVSWTFRSSQQLLIGVSGLTRGIVGGVL
FT                   NVFLAILLSGYMLSGSQKLIDGIVSLFPTPWDQKLKDQVIPVSQRMGGYIQGRLLVSFI
FT                   LGLAVSLGLKFLGIGEFALGLGTIAGMTNLIPFFGPVLGSIPALIVAVAQGGWLFLWVL
FT                   LLFVIIQNLETYVLDPLLVGSSVNVPPLYQLLAVLSGVQLLGIIGALILPPWVAGAGVL
FT                   LQNLYLTPKLEAEKENS"
FT   gene            complement(186719..188656)
FT                   /locus_tag="cce_0201"
FT   CDS_pept        complement(186719..188656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0201"
FT                   /product="peptidase, S9C"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49552"
FT                   /db_xref="GOA:B1X051"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1X051"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49552.1"
FT                   /translation="MLSPIIAPFGSWKSPITSDLIVAQSIKLGTVVFDNDNIYWLEGRP
FT                   QEKGRNVLVKYSPDGQMTEITPQPFNVRSRVHEYGGGSFLVKNGVVYFINYQDQRLYQQ
FT                   LPNEAPKPLTSENQCRYADFVLDPNYNRLISVCEDHSQTDRECENKIVAIDIKTGDITT
FT                   LIEGDDFYSSPRLSPDGTQLAWISWNHPNMPWDGTKLWLGNIESDGSLKEIKWIAGDID
FT                   ESISEPKWAPDGQLYYVSDQSGWSNLYCYKANVNNVPIFPFTAEFSYPHWVFGLSTYTF
FT                   VSKQKIICGFTQDGRWYLGSLNIPNRQFSILELPYSNVASLDSHGKEVVFLGSSTIEPT
FT                   EVIHLDLNLSQTKVLKTACQIDVDSGYFSQPELIEFPTENGLTAYGWYYPPQNKDYTFP
FT                   DEELPPLLVKSHGGPTAAATPSFSLKIQYWTSRGFGYLDVNYGGSTGFGKTYRQRLEKN
FT                   WGLVDVNDCINGANYLVKQGKVDGDRLAISGGSAGGYTTLAALTFHDTFKAGASYYGVS
FT                   DLESLAKDTHKFESRYLDKLIGQYPEEKEIYEERSPINFTDQLNCPVIFFQGLEDKVVP
FT                   PSQAEMMVESLKNKEIPVAYIAFEGEQHGFRQADNIKYALDSEFYFYSRIFHFTPADNL
FT                   EPINILNYDS"
FT   gene            complement(188903..190081)
FT                   /locus_tag="cce_0202"
FT   CDS_pept        complement(188903..190081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0202"
FT                   /product="NifS-like class-V aminotransferase, probable
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49553"
FT                   /db_xref="GOA:B1X052"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B1X052"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49553.1"
FT                   /translation="MQIYLDHSATTPPRSEVVAYVSQLLTEEWGNPSSLHQWGQRAAMV
FT                   IETARVQVASLVNAREPESIIFTSGGTEADNLAILGIARQYSTPQHLIISSIEHPAISE
FT                   PVACLEAQGWEVTRLAVNGQGRINPWDLKAAIQSNTVLISIIYGQSEIGTVQPIEELSN
FT                   IAHDHAILFHTDAVQSAGRLSIDVQRLPIDLLSISSHKIYGIQGAGALYVRPGVDIDPL
FT                   LLGGGQEGKKRSGTQSVGIIGGFGLAAELAVREMATESSRLIGLRDRLFDLMADCPYVI
FT                   PTGDRLYRLPHHVSFVINDPFQTSETEKITGKMIVRQMNLAGIAISAGSACHSGKLSPS
FT                   PILLAMGYSEKEAIKGIRLTLGQNTTREDIDWTAMVLKQVLNRLMPQLVIAK"
FT   gene            complement(190171..190551)
FT                   /locus_tag="cce_0203"
FT   CDS_pept        complement(190171..190551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49554"
FT                   /db_xref="UniProtKB/TrEMBL:B1X053"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49554.1"
FT                   /translation="MSRRKKSFPCGHKGYGKICHRCAQEQTAWERKQQQKNAWEETFNK
FT                   DPIDLRPFPKNVVLKAREILKGLANQQDYRSFYGKRLRHDRFIISIPVTRHYRLICRDH
FT                   GSFLTPEAVVSHEDYNVCKPGQ"
FT   gene            190964..192904
FT                   /locus_tag="cce_0204"
FT   CDS_pept        190964..192904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0204"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49555"
FT                   /db_xref="GOA:B1X054"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B1X054"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49555.1"
FT                   /translation="MVRISNYITMFTQLRKNTNYSINYSKNDTLKSVPINPDFNLVNLL
FT                   RKRAINQPQQTAYTFLENGETELINLTYQDLDLEAKNLAAKLQALKFRGERALLLYPPG
FT                   VEFISAFFGCLYAGVIPVPLYPPKRNQNLSRLQSVIANAEAKLALTTELVLENIEKHFN
FT                   STPDLAALTWLTTDNDQENLVHQWHLPEISADAIAFLQYTSGSTGNPKGVMVSHGNLIH
FT                   NERMVQQAFGHTEQTIFVGWLPLFHDMGLIGNVLQPLYLGIPCILMSPVDFLQKPYRWL
FT                   KAISDYRATTSGGPNFAYDLCVNKITDEQIQTLDLSSWEVAFNGAEPIRAETLEKFAQK
FT                   FSPCGFRKEAFYPCYGMAEATLFITGGVSSEPPMVKTVDEKALAENRVVEVVKEQNQAQ
FT                   SITLVGCGRQWLGQIVKIVDPQTLTECNNNQVGEIWVSGDSVAKGYWRELQKTKATFEA
FT                   YLSDTHKGPFLRTGDLGFFSTEGELFVTGRLKDVIIIRGRNHYPQDIEITVEECHEAIV
FT                   NHRSAAFTVQVEGKEQLVITAELERRYHKRRQQPSQVPPHPERRKGDRRQESEDPGFEV
FT                   TPTPSQPPIFDEIISSIKRAVCHHHGLQVHRIILLRVGTIPKTSSGKIQRYACREGLFD
FT                   HSLNVVYDSKP"
FT   gene            193323..193826
FT                   /locus_tag="cce_0205"
FT   CDS_pept        193323..193826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49556"
FT                   /db_xref="UniProtKB/TrEMBL:B1X055"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49556.1"
FT                   /translation="MLFNKSFLPLVTPLSLLSLSLISSLGILHSRPTLATEKGIERNQG
FT                   ELLAQTVSRNRLPNGSYLYGSSPQPDEIGQEYMVFQVHQGEVKGAVYMPHSEFSCFTGT
FT                   FEGNQMRMSVIDPYDGTRYDYSVALQAPSTVASNGQWSDIGLEGYYRLDDMSRNDQKIL
FT                   DTCS"
FT   gene            complement(193833..194789)
FT                   /locus_tag="cce_0206"
FT   CDS_pept        complement(193833..194789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0206"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49557"
FT                   /db_xref="GOA:B1X056"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1X056"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49557.1"
FT                   /translation="MKGLWLENQQLQLKADLPIPEPKKDEALVKVLQAGICNTDLELLR
FT                   GYYPYQGVLGHEFVGVVEQGPQHLINQRVVGEINAVCGHCRFCRGGSPTHCENRSVLGI
FT                   VNRNGAFADYLTLPVDNLHRVPDNVSNDVATFTEPLAAALEIQQQISINATQRVLVVGD
FT                   GKLGQLVAQTLALTGCDLWVIGRHQEKLANLAARGIKTGLETEVTERSFDIAVECTGNP
FT                   QGFDLARRSLYPRGILVLKSTYVGKLTLDASTLVVDEITVIGSRCGPFAPALKLLEQEQ
FT                   VDVKPLIHGRYPLEEGLEAFEIAQKQGILKVLVEINH"
FT   gene            194895..195356
FT                   /locus_tag="cce_0207"
FT   CDS_pept        194895..195356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49558"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1X057"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49558.1"
FT                   /translation="MTSPQIFEQTILIKASATIVERCFTDLELMHRWLNPALKCEPIRE
FT                   WNTDIGGRSRFIIKIPPINPTLISHVVEREPGLIVWQFTGFFKGRDRWECQPISKGTKL
FT                   INRFEFDVPNPLINWGFNQFAASWTKKDMKAQLRRLKRVAEEIYQLECS"
FT   gene            complement(195417..196457)
FT                   /locus_tag="cce_0208"
FT   CDS_pept        complement(195417..196457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0208"
FT                   /product="probable peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49559"
FT                   /db_xref="GOA:B1X058"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X058"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49559.1"
FT                   /translation="MTTVLGIETSCDETAVAIVNNRRICSSVVASQIDLHKRYGGVVPE
FT                   EASRQHLLTINPCIEQALQTAKLTWNDIDGIAATVAPGLIGALMVGETAAKTLAMIHHK
FT                   PFLGIHHLEGHIYATYLSEPDWKPPFLCLLVSGGHTSLIHVKDCGVYEQLGTTRDDAAG
FT                   EAFDKVARLLNLGYPGGPIIDQLATQGNPKRFNLPEGKVSLPQGGYHPYDSSFSGLKTA
FT                   VLRLVEKLKQEKTEPLPIADLAASFQETVARSLTKKTITCALDHHISHIAVGGGVAANS
FT                   GLRNHLQEAAKKRNLTVHFPPLKLCTDNAAMIACAACDHLKKGHISSWNLGVQSRLPIT
FT                   EVMTLY"
FT   gene            complement(196465..198189)
FT                   /locus_tag="cce_0209"
FT   CDS_pept        complement(196465..198189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0209"
FT                   /product="unknown"
FT                   /note="contains a Mechanosensitive ion channel, MscS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49560"
FT                   /db_xref="GOA:B1X059"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B1X059"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49560.1"
FT                   /translation="MSYWSKNRNFIISFISWILTIFIAFSSVSWMTPILGQERPTAPIM
FT                   LEGKTLFYVSESGQYTAQQRAREANNHLEKIVAESESPISVEIDTDQEVPVITINDRYF
FT                   LSVTYNDAPIGKSLQGQALAWKNALEIAIRKSEYERTPQYYIKAIVIAIAIIFLAVILS
FT                   WKLGKIWQRWLKPLSTTKTDPNPLTSTTSNQPLTANTGESSFNFQLVGLLVLLTIIRGL
FT                   IWIVALGYISRLFPQTRQWSDFLLEILQVSLITDVFPLGNQKYSVLDFFILVGLLAAVV
FT                   TLTRMVSRVLKSKLLSATGLNRAVQDTTALIVNYALIFLGTIVVLQVWGLDLSSLTVFA
FT                   SVLGVGIGLGLQGIAKEFVSGLVLIFERPIQVGDFVEVDQLMGTVERISVRSTEIRTLD
FT                   QISVILPNSRFLESEVINWSHSSPISRLKIPVGVAYGSNLEAVRRVLIDTAKNHRDILS
FT                   MPSPQVFFSEFGDSSLNFNLLVWISKPYKQFQIKSDLYFKIDTQFRQEGIEIPFPQRDV
FT                   HFRSSDLPSQSLSPELINSLTTLSNRLAMWLETNSNHHTVQDKNNEIQSKKTTKKES"
FT   gene            198421..199395
FT                   /locus_tag="cce_0210"
FT   CDS_pept        198421..199395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0210"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49561"
FT                   /db_xref="GOA:B1X060"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1X060"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49561.1"
FT                   /translation="MDIKEGFVGTVGNTPLIRLKSFSEETGCNILGKAEFLNPGGSVKD
FT                   RAALYIIKDAEEKGLLKPGGTVVEGTAGNTGIGLAHICNAKGYKCLIIIPETQSQEKID
FT                   LLRTLGAEVRTVPAVPYKDPNNYVKVSGRVAEELDNAIWANQFDNLANRQAHYETTGPE
FT                   IWQQTDGKVDAWVSATGTGGTYAGGALFFKEKNPNIKCIVADPMGSGLYSYVKTGEINP
FT                   KGSSITEGIGNSRITANMEGVPIDDAIQIDDHEALRVIYQLLYQDGLFMGGSVGINVGA
FT                   AVTLAKEMGPGHTIVTVLCDGGARYQSRIYDKEWLASKGLSVP"
FT   gene            199910..200632
FT                   /locus_tag="cce_0211"
FT   CDS_pept        199910..200632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49562"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1X061"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49562.1"
FT                   /translation="MTENQQQKNLSYYCESFTNLNVRTKYQHFEFKPGVKKELITINES
FT                   IAKLKQAVEYVLLDQELFQFLKDPESRKELIDTLINVWFSSAQKELQEILDINQSFEEA
FT                   GNEEVEETETTKKFYMRKSLLRDSFFRKAVIHAYDYRCSLCQLRVIKSLSQSIVDGAHI
FT                   KPFAQFYDNKIDNGISLCKNHHWAFDKGIFSIDDNYQVLISDNFSEDSSNMKPIRDFQG
FT                   ETILLPNSQTYFPSLEAI"
FT   gene            200695..202275
FT                   /locus_tag="cce_0212"
FT   CDS_pept        200695..202275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0212"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49563"
FT                   /db_xref="GOA:B1X062"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017598"
FT                   /db_xref="UniProtKB/TrEMBL:B1X062"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49563.1"
FT                   /translation="MTNIQTTLFPPRTVPELIKDIKRLTEEIQELYCADNIPLVIGYSG
FT                   GKDSSAIVQLIWNAISELPLEKRHKKIYVITTDTLVENPFVSAWVNKSIERMKKQAKEE
FT                   QLPIEPHLLTPEVSQTYWTGLIGKGYPAPRHTFRWCTPRLKIDPSNRFIRNVVRANNEA
FT                   IVVLGTRKTESQNREAIMTKREQGRVRDRLCKHPHLPSSLLYTPIEDWRTDEVWLYLMQ
FT                   WENPWGHSNKDLFAMYRGATADNECPLVIDTSTPSCGSSRFGCWVCTLVDSDKSLAAMI
FT                   QNDEEKEWLQPLIDVRKELDIQNDREKRDFRRIWGTVHLFERNIDGQTSIEPVPGPYTK
FT                   YWREHWLRLVLEAQVKVKKNAPDDMKDITLITQEELSEIRRIWLEEKHEFDDSLPRIYE
FT                   EVTGEPFIDSRPGVGHSLLGSDEWDILSEVCGEDTMHLELMARLLDTERQFYTKSRRVG
FT                   IYGDLEKCFETSSRSQNDAIDNAHQKRNLKNAIAKEDINQVKRELKKTLNPEDRQPQQQ
FT                   LSWGKIKFG"
FT   gene            202432..204435
FT                   /locus_tag="cce_0213"
FT   CDS_pept        202432..204435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0213"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49564"
FT                   /db_xref="InterPro:IPR017599"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B1X063"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49564.1"
FT                   /translation="MLFTELVLQNFGPYAGKNIINLHTEKNKETRPIILIGGMNGGGKT
FT                   TLMDAIRLALYGQRAQCSTRNNLSYSDFLIQAINNQTPLGDETRIELAFEHFIDDQWKQ
FT                   LRIVRRWNKQLKDGKDSLGILETGGPNNYDWPDKALTDTWDEFIETVLPLGISNLFLFD
FT                   GEQVKELAEQDIPPTSVIEAIQSLLGLELVERLAVDLDVLVNRKQKKLASQSQLKTIED
FT                   IEDKLNHYKQEKENAVEDFTSISNQLKCANKKVQEASERFRIEGGKIASESSTLKKNIN
FT                   ELKEKLQQQRNELVNLAATSLPLALITPLLTEAKKQGEIEIKQQQAILTKTVLQQRDQK
FT                   LLDYLESLELTQEKLHKIETFLSREYESIDQDSKMNLNYTIGITEEDLNQLNTLLDYKL
FT                   PSQLNTAKQQLDTLQKLEVDLDNNERKLQVAASPEDYQKLSDALTNAQKEAAKYQSEYN
FT                   LAEKRIREAEKAVQMTIKDLKSYTDEALEKQNNEHIIKSAAKVQTTLKLFKERLTLKKL
FT                   NKLEGEVTECFRYLLHKSDLVHRVAIDTYNFSLSLYDPQGETVPKHRLSAGEKQLLSIA
FT                   FLWGLARVSGRNLPIAIDTPLGRLDSSHRNNLVERYFPTASHQVILLSTDTEIRQEEFQ
FT                   QLTEQDAIAHTYLLEYDTSDRQTTVHCDRYFW"
FT   gene            204766..205155
FT                   /locus_tag="cce_0214"
FT   CDS_pept        204766..205155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49565"
FT                   /db_xref="InterPro:IPR014969"
FT                   /db_xref="InterPro:IPR038472"
FT                   /db_xref="UniProtKB/TrEMBL:B1X064"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49565.1"
FT                   /translation="MIMESPIKQIRLSQTAKDQLIKLKRYTKIEQWNILCRWGFCRSLA
FT                   EPSIPSPVPIILDSNVEMTWRVFGGNMADLLLIALKQRCYKDGLGTDKETLITQFRLHL
FT                   HRGIGYLAGDMNIKKIEHLIELTTK"
FT   gene            205169..205273
FT                   /locus_tag="cce_0215"
FT   CDS_pept        205169..205273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0215"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49566"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B1X065"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49566.1"
FT                   /translation="MHDLYEEDYNLWTDQQIEALKNRDIKALEWDNLA"
FT   gene            205285..205389
FT                   /locus_tag="cce_0216"
FT   CDS_pept        205285..205389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49567"
FT                   /db_xref="UniProtKB/TrEMBL:B1X066"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49567.1"
FT                   /translation="MILRHGKAKKAEVKFPDTCPFTFEQIIKEGWYPN"
FT   gene            205472..206080
FT                   /gene="rps4"
FT                   /locus_tag="cce_0217"
FT   CDS_pept        205472..206080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps4"
FT                   /locus_tag="cce_0217"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49568"
FT                   /db_xref="GOA:B1X067"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X067"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49568.1"
FT                   /translation="MSRYRGPRLRVVRRLGELPGLSRKTPRRAYPPGQHGQGRRKRSEY
FT                   AIRLEEKQKLLYNYGVTEKQLVRYMKKARRSTDSTGQKLLELLEMRLDNTVFRLGMAGT
FT                   IPGARQLVNHGHVIVNGRVVNIASYQCRPGDVISVRNKDNSRRMVETNMQYPGLANLPD
FT                   HLEFDKNTLTGKVNDVIKREWVALQINELLVVEYYSRKV"
FT   gene            206055..206162
FT                   /locus_tag="cce_0218"
FT   CDS_pept        206055..206162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49569"
FT                   /db_xref="UniProtKB/TrEMBL:B1X068"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49569.1"
FT                   /translation="MNIILGKCSQYWTTITVVLSLNLVVDIRIQPLEKA"
FT   gene            206603..207682
FT                   /gene="rps1-1"
FT                   /locus_tag="cce_0219"
FT   CDS_pept        206603..207682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps1-1"
FT                   /locus_tag="cce_0219"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49570"
FT                   /db_xref="GOA:B1X069"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1X069"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49570.1"
FT                   /translation="METVHKQEAPPTIGDSDIGKQKYMVTQKTTTKDIGFTHEDFAALL
FT                   DKYDYHFSPGDIVPGTVFSMEPRGALIDIGAKTAAYIPIQEMSINRVDDPDEVLQSNET
FT                   REFFILTDENEDGQLTLSIRRIEYMRAWERVRQLQAEDATVRSNVFATNRGGALVRIEG
FT                   LRGFIPGSHISTREAKEDLVGEELPLKFLEVDEERNRLVLSHRRALVERKMNGLEVGQV
FT                   VIGSVRGIKPYGAFIDIGGVSGLLHISEISHDHIDTPHSVFGVNDELKVMIIDLDAERG
FT                   RISLSTKQLEPEAGDMLKNRDLVFEKAEEMAEKYRQKLLAEAQGQEMPTEENLEEIPTA
FT                   SDNDESQEELAATASTTEE"
FT   gene            208137..210644
FT                   /locus_tag="cce_0220"
FT   CDS_pept        208137..210644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0220"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49571"
FT                   /db_xref="GOA:B1X070"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1X070"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49571.1"
FT                   /translation="MLTLKQFLYSVPICTPPITYQKLRNLFQLSQQGHDRVVVVNAQGI
FT                   PLGIIFSHDFLLTLLDEAVVTSSSSKTEMSRWRHSLGSGVQWNWETCVTPLTLIPSHLR
FT                   VSDFAHFLNTNPQLAKPPTYGLVNECGQFLGLLDSWQILRAVLVENGSPQQELASAKNL
FT                   IKELLEELPLPVMLQTHQGEIIQQNRTWREQIGELLPPDNATACPLPHETMNRLENKKM
FT                   SSEHNDDLNHKMASITDMACDQWLNPPTDNWDFPLSSLPNDSPESFVDEDSLDIQPSPI
FT                   PDQDKVWQFIKCPLTTDKLPIPISIFVATDVTQQQQLCQELAAKNADLVQLNRLKDEFL
FT                   ACISHELKSPLTAVVGLSSLLQEEKIGDLNPRQVHYAQLIYRSGRQLMTLVNDLLDLTR
FT                   LETGQLKLSFSPVNIQEICHRAYHSIAEKYKGKSDKPLDFSLDIEVGLHQLLADELRLH
FT                   QMLVHLLDNAMKFTQTGGKFGLKVSRWEDWLAFTVWDTGIGIPEESQHLIFQKFQQLEN
FT                   PLTRQFEGTGLGLVLTQRLARAHGGDISFVSKAGQGSQFTLLLPPSPNREQRSLPLQSS
FT                   NPVILIVEAIPQSIEALMDKLTQLGYRVVIARTGTEAVEKARQLRPYAIFLNPLLPLLS
FT                   GWDVLTLLKSDLQTRNIRVFVTQTQGNQLLGEHRCADGFIKVPSDLETLKQCLKPVQAL
FT                   VNPETRSLTILSLIPNVSQGDTETIPLTSRVERTLIAQLSQFNHRILEADDLEQACLLV
FT                   SVWDIDVIVLDGQFLDHPQDYLRSLAQNPDISTLPLVILDVPSAQAANTIEGLSVFPCL
FT                   ISDSKQQISQLWQVIAIAADHHN"
FT   gene            210915..211310
FT                   /locus_tag="cce_0221"
FT   CDS_pept        210915..211310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0221"
FT                   /product="hypothetical protein"
FT                   /note="contains a Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49572"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B1X071"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49572.1"
FT                   /translation="MSPEAKPPTVNQTSLEQTLPIPPEQQMPVSSPQALKQRLEWGEPA
FT                   LTILDARDNESFLEEHITGAMLLEFVEDSLSSMSDDRDIYVYADGEENAKQAAEKLRNK
FT                   GFNRVSRIEGGLANWKSIAGPTEGRAA"
FT   gene            211458..212255
FT                   /locus_tag="cce_0222"
FT   CDS_pept        211458..212255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0222"
FT                   /product="putative glucose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49573"
FT                   /db_xref="GOA:B1X072"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1X072"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49573.1"
FT                   /translation="MEELTGKNILVTGATSGIGQAIAARLVAEGSNVALNYRNDINKLD
FT                   DTKKMIEKMTSKMDNKGGQYLPVEGDVSEEKDILRMYDEVIKKWGSLDILVNNAGIQIY
FT                   DPSEQVETDDFDKVINVNLRGAYLCAREAIQHFLNTEKKGIILNVSSVHEIIPRPQYVS
FT                   YAISKGGIKSMTQTLALEYAPYGIRVNAIAPGATDTSINDDWLDDPQKKQAMKRRIPLG
FT                   RVGTPEEMAAAAAFLMSDEAQYITGQTLFIDGGMTLYPNFLNS"
FT   gene            complement(212347..212748)
FT                   /gene="rpl7"
FT                   /gene_synonym="rpl12"
FT                   /locus_tag="cce_0223"
FT   CDS_pept        complement(212347..212748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl7"
FT                   /gene_synonym="rpl12"
FT                   /locus_tag="cce_0223"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49574"
FT                   /db_xref="GOA:B1X073"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X073"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49574.1"
FT                   /translation="MSAATDEILEKLKSLTLLEASELVKQIEEAFGVSAAAPSGGMMMM
FT                   APGAAAPGAAAAEPEEEKTEFDVILEEVPGDKKIAILKVVRGITGLGLKEAKDMVESTP
FT                   KPIKEGTGKEDAEDIKKKLEEAGAKVSVK"
FT   gene            complement(212823..213389)
FT                   /gene="rpl10"
FT                   /locus_tag="cce_0224"
FT   CDS_pept        complement(212823..213389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10"
FT                   /locus_tag="cce_0224"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49575"
FT                   /db_xref="GOA:B1X074"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X074"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49575.1"
FT                   /translation="MGRTRENKATVIADLKELLSEAQLGMVIDYQGLSVAEITELRNRL
FT                   RPSGAICKVTKNTLMEQAITGDEAWEPMTNFLKGSSAFVLVKDDVGSAVRAYQSFKKDT
FT                   KKTEFRGGVMQGQALNEDQVKAIADLPSKEELIGQVAGAINSIATKLAVGVNEVPTSIG
FT                   RGINDIPNSLGRVMAAMAAKEEGNG"
FT   misc_feature    complement(213457..213584)
FT                   /note="ribosomal protein L10 leader; Rfam score 62.65"
FT                   /inference="nucleotide motif:Rfam:RF00557"
FT   gene            complement(213594..214310)
FT                   /gene="rpl1"
FT                   /locus_tag="cce_0225"
FT   CDS_pept        complement(213594..214310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl1"
FT                   /locus_tag="cce_0225"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49576"
FT                   /db_xref="GOA:B1X075"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:B1X075"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49576.1"
FT                   /translation="MPKLSKRIKAALEKVDQDRAYEPLEALTLLKETATAKFNESAEAH
FT                   IRLGIDPKYTDQQLRTTVSLPKGTGQEIRVAVIARGEKVQEASNAGADIVGSEELIDEI
FT                   QKGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTADLETAINEFKAGKLEF
FT                   RADRTGIVHVMFGKASFSPEDLLANLKALQETIDRQRPSGAKGRYWRSVFVSASMGPSI
FT                   QIDISALRDLKLEGQV"
FT   gene            complement(214373..214798)
FT                   /gene="rpl11"
FT                   /locus_tag="cce_0226"
FT   CDS_pept        complement(214373..214798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl11"
FT                   /locus_tag="cce_0226"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49577"
FT                   /db_xref="GOA:B1X076"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X076"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49577.1"
FT                   /translation="MAKKVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAK
FT                   TSDQAGMVIPVEISVFEDRSFTFVLKTPPASVLIRKAAGIEKGSAQPNNQKVGSISRDQ
FT                   LKEIAQTKMPDLNANDIDAAMNIVEGTARNMGVTIND"
FT   gene            complement(214801..215445)
FT                   /gene="nusG"
FT                   /locus_tag="cce_0227"
FT   CDS_pept        complement(214801..215445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="cce_0227"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49578"
FT                   /db_xref="GOA:B1X077"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B1X077"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49578.1"
FT                   /translation="MGIREGILMSFAHDHTSEPEQQQEKPKRAARWYAVQVASGCEKRV
FT                   KNNLEQRIQTLDVADRILQIQIPKTPTVKVRKDGSRQQGEEKVFPGYVLVKMIMDDDAW
FT                   LVVKNTPNVINFVGSEQRRAYGRGRGHVKPLPLSPSEVERIFRQAEQPEPVVKIDMEIG
FT                   DKILVLSGPFKDFEGEVVEVSSERNKLRALLSIFGRDTPVELEFNQVEKQN"
FT   gene            complement(215421..215648)
FT                   /gene="secE"
FT                   /locus_tag="cce_0228"
FT   CDS_pept        complement(215421..215648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="cce_0228"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49579"
FT                   /db_xref="GOA:B1X078"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B1X078"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49579.1"
FT                   /translation="MVRQEGSKKDTKQAKGETKASNFVVETKEELAKVVWPSRQQLLSE
FT                   SAAVILMVSLVATVIYLVDNLFSWGSGKVF"
FT   gene            complement(215830..215903)
FT                   /locus_tag="cce_RNA003"
FT   tRNA            complement(215830..215903)
FT                   /locus_tag="cce_RNA003"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCC; tRNA-Pro1"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            complement(215951..216319)
FT                   /locus_tag="cce_0229"
FT   CDS_pept        complement(215951..216319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49580"
FT                   /db_xref="GOA:B1X079"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="InterPro:IPR014947"
FT                   /db_xref="UniProtKB/TrEMBL:B1X079"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49580.1"
FT                   /translation="MSDRIIKKGQGWRLGWKNEKTAYPGLIGGEDWAIELTETEFIDFC
FT                   RLFDQLATTMTSMSQELMDEERIACEAESELLWLEVEGFPHAYSLRVILNQGRRCEGNW
FT                   SAKVVRELSQEIQKLNIF"
FT   gene            complement(216332..216985)
FT                   /locus_tag="cce_0230"
FT   CDS_pept        complement(216332..216985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0230"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49581"
FT                   /db_xref="UniProtKB/TrEMBL:B1X080"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49581.1"
FT                   /translation="MTYSIDSRIKMLRKTIELSKHQQKWLGVFLLSLTLSWGVTQLDIN
FT                   SLTDWGLKAINAQILRPEQAAEIIYNKLPYLPRENEYRSAETGEIDPEHTLMSRFIRYH
FT                   KDFQRRSPQYRLDWKVTLADYLGVNRSIRESNYPGSTLASNPLPQDIEVIRQLSRRQRQ
FT                   QLVDLLVAIYNPQSQPTTNQSVPNENETEETSSEGSTPSNPSLSQPGDAQLLAP"
FT   gene            complement(216975..217208)
FT                   /locus_tag="cce_0231"
FT   CDS_pept        complement(216975..217208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0231"
FT                   /product="putative RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49582"
FT                   /db_xref="GOA:B1X081"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:B1X081"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49582.1"
FT                   /translation="MIQKKHTFDSSQVMYRAQELLDKASNRYRITVQVANRAKRRRYEE
FT                   FDSIDDPNMKPAVRAIIEMSDELTQPEIISDV"
FT   gene            complement(217343..218737)
FT                   /gene="argH"
FT                   /locus_tag="cce_0232"
FT   CDS_pept        complement(217343..218737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="cce_0232"
FT                   /product="L-argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49583"
FT                   /db_xref="GOA:B1X082"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X082"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49583.1"
FT                   /translation="MTVRQKKTWSDRFEGSLHPAIVEFNASITFDIELIEYDLTGSIAH
FT                   AKMLAKTGIISEAEAQKLVNGLEQIRQEYRDGNFTPGIDQEDVHFAVERRLTELVGDVG
FT                   KKLHTARSRNDQVGTDIRLYLRDQIQQIRSQIQAFQQVLLTHAQENVETLIPGYTHLQR
FT                   AQPISLAHHLLAYFQMAQRDWERLGEIYQRTNVSPLGCGALAGTTFPIDRHYSAELLGF
FT                   EEVYGNSLDGVSDRDFAIEFLNAASLIMVHLSRLSEEMILWASQEFGFISLTDSCATGS
FT                   SIMPQKKNPDVPELVRGKAGRVFGHLQGMLVLMKGLPLAYNKDLQEDKEAIFDGVKTVK
FT                   GCLEAMTVLLGEGITFRKERLSEAVAEDFSNATDVADYLAAKGVPFREAYNLVGKVVKT
FT                   SLASGKLLKDLTLEEWQALHPNFEADIYDAIAPKQVVAARNSYGGTGFEQIYQAVERAK
FT                   QQLELS"
FT   gene            complement(218779..219057)
FT                   /locus_tag="cce_0233"
FT   CDS_pept        complement(218779..219057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49584"
FT                   /db_xref="GOA:B1X083"
FT                   /db_xref="UniProtKB/TrEMBL:B1X083"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49584.1"
FT                   /translation="MCPKQLNIQGRYMLLFEPTIHLDLIDISRWSDLSSFFYHPWMEVS
FT                   HLFAQQIEDPQIIEKMQKSWRNFIESGQVWALGIGFVLGYIFRTFTS"
FT   gene            complement(219090..220526)
FT                   /locus_tag="cce_0234"
FT   CDS_pept        complement(219090..220526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0234"
FT                   /product="unknown"
FT                   /note="contains a stage II sporulation E domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49585"
FT                   /db_xref="GOA:B1X084"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1X084"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49585.1"
FT                   /translation="MSSSPDIMTAVSMKQQPPSKMRRPIGEPSTESTPVFALKELVASL
FT                   YREQNKIQNLLSSLGFALRSFNNLNQFLELTPLMAARVTDADGSALMLSKRPNDISLEQ
FT                   LHCQDHQMAQEIRGVINSIIDQTNNQQATPELSLCLDEKIRQALGKRIRLYSTPILVKN
FT                   IERGRIYVFSSDPEYVWTQTRRKLLQLVADQTSVAIANNELTVELRSKERQDRELEIAS
FT                   EIQLRLLPRQCPVIEGIELAARCQTANRVGGDYYDFIPTNYDQLRQDQEIKRGDQATSV
FT                   PWSIVIGDVMGKGVPAGLIMTMTRGMLRAEVLNRHSPARILQHLNRVMYADLDNSHRFV
FT                   TLFYSEYDPQTKILSYSNAAHNPPLLWQTASQTIEKLDTDGMLIGLDPNSQYEDGQTQL
FT                   APGDTILYYTDGFTDAVNQKGQRFDEENLIKVFEEGCQRYDSPQDILDYLFKQIKAFIG
FT                   SGHNNSDDMTLIVVRVKSTQ"
FT   gene            complement(220810..222906)
FT                   /locus_tag="cce_0235"
FT   CDS_pept        complement(220810..222906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0235"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49586"
FT                   /db_xref="GOA:B1X085"
FT                   /db_xref="UniProtKB/TrEMBL:B1X085"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49586.1"
FT                   /translation="MIDSILILTNCLVLLRVLLPNPFMLLHDSEKISNKTKTVLDKFAM
FT                   IEVVNKPSVGIAGNKEEPKLESLVNYHGNSGNINHNQTQTLEINFMEIGIAIVISLLVG
FT                   AIATYFLSSSGAKRKLQSTESKLERTENALRQAENQLQELQDAPAQLQEVEQMYQSKLQ
FT                   AMEEKNLAQQEQLTQAHTKIAELQSLSSRVQELEQLETKIQETEQSYQGQIQALEQSYQ
FT                   AKIQALEANIAHYQNVQETQQPIQEIEQTHQTQIQELQQQIQALQQDHQQVIADLENTH
FT                   QHQQQQIEQTHQTQIQEIESTYQAQIQELQQSHEQEIHALQQQVIVPPSSEIETDETVN
FT                   VEVAELNGMAEGVAAFEELANEEELHIEQENTQQLFSEEEVIENKLDVDEISLDTEDSI
FT                   EELNEFENDTDNFLNELNEVSNEASVEELDEFEDDTDNFLNELNEVSNEASVEELDEFE
FT                   DDTDNFLNELNEVSNEASVEELDEFEDDTDNFLNELNEVSNEDSVEELDEFEDDTDNFL
FT                   DEFSSSKETVAQDPNFNPSMENNSIWEEENSDSYASNDNNSNDTEVLRDLLTEETVSDD
FT                   QDFLEMMPTSEETSHHLQETLANDDNDPFADIFESDSDNPKIDPNDPFAELLGEENETP
FT                   DEEFLNLLQTDENIQSESSDSFNSENDGEWDDIFEDTSAKNGDGDNPFLMEEMVEASKT
FT                   QTYS"
FT   gene            222927..223934
FT                   /locus_tag="cce_0236"
FT   CDS_pept        222927..223934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0236"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49587"
FT                   /db_xref="GOA:B1X086"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1X086"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49587.1"
FT                   /translation="MNLTLNRSSSLKSSLLLISPFFLWGTAMVAMKGVLSQTTPFFMAG
FT                   IRLVPAGILVLLVAWWLKRPQPQGVKAWLWISLFALLDGAMFQGFLAAGLTETGAGLGS
FT                   VIIDSQPLAVALLSSWLFGEIIGFWGSVGLGFGILGISLIGLPKEWFDALFYDQTLAIT
FT                   FNGSDLLNSGELLMLLASLSMAVGTICIRYVSRYADPIVATGWHMILGGIPLFFISGMW
FT                   ESNQWTAINLQGWLSLGYSTIFGSAIAYGIFFYLASKGNLTSLSSLTFLTPVFALSFGT
FT                   LFLNEVLTSWQWMGVSLTLISIYLINQRETIGKQLRYLRVKGLLFSKRTLGKLS"
FT   gene            223981..224235
FT                   /locus_tag="cce_0237"
FT   CDS_pept        223981..224235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0237"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49588"
FT                   /db_xref="InterPro:IPR019882"
FT                   /db_xref="UniProtKB/TrEMBL:B1X087"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49588.1"
FT                   /translation="MGKRPELEPETISRIIEMAWEDKTPFAAIEIQYNLSEKEVIALMR
FT                   REMKASSFKMWRKRVSGRKTKHIHQRDFLVGRFKSSNQK"
FT   gene            224261..224734
FT                   /locus_tag="cce_0238"
FT   CDS_pept        224261..224734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0238"
FT                   /product="hypothetical protein"
FT                   /note="contains a putative thiol-disulphide oxidoreductase
FT                   DCC domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49589"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:B1X088"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49589.1"
FT                   /translation="MIMTNSMANKSQNSVESSWKVKLLYDGDCPLCMREVRFLQKKDQG
FT                   KGLVKLVNIAEDNYDANKHCSVDYKSAMGRIHAILPDGTILRDVEAFRYVYEVLGMGWV
FT                   YAITKLPIVGKIANWVYGIWAKLRLPLTGRPNLETIIAEREAKEKCHSNVCKP"
FT   gene            complement(224879..228847)
FT                   /locus_tag="cce_0239"
FT   CDS_pept        complement(224879..228847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0239"
FT                   /product="hypothetical protein"
FT                   /note="contains a Na-Ca exchanger/integrin-beta4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49590"
FT                   /db_xref="GOA:B1X089"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:B1X089"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49590.1"
FT                   /translation="MNHNQSSIQFSSAKYLGIEKNQPFPNQIEITVTRSGNLDNFNTVE
FT                   VHLGNRTAQEGFDFSGIFPQWIDFEPGQTEQKIYIDINDDYELEGTEEIELKLITNPGD
FT                   PSLILGDQNTTTVSILDNETTYLEFESAKYVTFEQDDPYFNQLEVTITRSGNIDTYTTA
FT                   YFDIIEGNADFSDFYLPNFMVDFDYGQTSQTLYIEVPNDWTLEGTETFQLQLVDDPYNP
FT                   AIELGENATTTVEILDKQTTYLEFESAKYVTFEQDDPYFNQLEVTITRSGNIDTYTTAY
FT                   FDIIEGSADFSDFYLPNFMVDFDYGQTSQTLYIEVPNDWTLEGTETFQLQLVDDPYNPA
FT                   IELGENATTTVEILDKQTTYLEFESAKYVTFEQDDPYFNQLEVTITRSGNIDTYTTAYF
FT                   DIIEGSADFSDFYLPNFMVDFDYGQTSQTLYIEVPNDWTLEGTETFQLQLVDDPYNPAI
FT                   ELGENATTTVEILDKQTTYLEFESAKYVTFEQDDPYFNQLEVTITRSGNIDTYTTAYFD
FT                   IIEGSADFSDFYLPNFMVDFDYGQTSQTLYIEVPNDWTLEGTETFQLQLVDDPYNPAIE
FT                   LGENATTTVEILDKQTTYLEFESAKYVTFEQDDPYFNQLEVTITRSGNIDTYTTAYFDI
FT                   IEGSADFSDFYLPNFMVDFDYGQTSQTLYIEVPNDWTLEGTETFQLQLVDDPYNPAIEL
FT                   GENATTTVEILDKQTTYLEFESAKYVTFEQDDPYFNQLEVTITRSGNIDTYTTAYFDII
FT                   EGSADFSDFYLPNFMVDFDYGQTSQTLYIEVPNDWTLEGTETFQLQLVDDPYNPAIELG
FT                   ENATTTVEILDNSPTVEFGSVSYTLNEDQGYTMVVEVIRSGDLSFESIVNLNVLGGTAT
FT                   AGDDYDYLYGKIYFNYGQTRQFVEIGLNNDSLIEGIETLELEIIAADEPYDNYVIGTQN
FT                   TTTVEIIDNDAIIAEIGEVTNLNHESQTIFLDHNFINPVIFAQPLSRNGADPSTIRITD
FT                   IQSNSFSVQLQETTLINGNSHSGHHTTETFSFLVIEQGIWELSDGSILEVGNVTTDRTT
FT                   TSSWETINFNHNFTNTPVILTQVQTDNDATFVRTRQNNATNNGFEVALEEEEAFKNSGH
FT                   GSETIAWLAISSGQGNWDGNGFIAGNTGNQVTHNWHTIDFGNNFINAPKFLGNIATYDG
FT                   PDSSGLRYQNLTNGNVQIMVEEDTSNDSETNHTTEDINFFAIEGSGNLTGSFDSLTGLV
FT                   DTKTGTINGDVFVLGNEVESFYDNYGQQDYTEISDFDLDQDIIQLHGLADDYYIASSPS
FT                   GTNDQGIFLKVAGMEDELVGIVKNTNTLNINSNNFAFV"
FT   gene            complement(229219..230589)
FT                   /gene="murD"
FT                   /locus_tag="cce_0240"
FT   CDS_pept        complement(229219..230589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="cce_0240"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49591"
FT                   /db_xref="GOA:B1X090"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X090"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49591.1"
FT                   /translation="MATAYIIGLGRSGIAAAKCLKQDGWEVIISDCATSPNLIPLQQQL
FT                   HAEGITVKLGHTPNLNASDLPELIVVSPGVPWDTPFLIEARERQIDTIGELELAWRYLQ
FT                   SSPWVGITGTNGKTTTTALVAAIFQGAKLNAPSCGNIGYAACELALSKLKKDNTSNYDW
FT                   IIAEISSYQCESSQELSPKIGLWTTFTADHLSRHKTLDNYYAIKASLLYRSEYQIFNGD
FT                   DPYLHQTGLHQWADAYWTTVKGKDNLLCDPSQGVYIQDNWVVAFGELILPLNLFKMPGF
FT                   HNQQNLLMAIAAARLAGIEKGAIASAIATFTGVPHRLEYIRTVDGIDFINDSKATNYDA
FT                   AEVGLLSVQSPTILIAGGEEKEGDDKKWIAQIKSKVIKVLLIGEAAENFAKRLHDCDYH
FT                   DYEIVETMDKAIERSLILGQELKAKVILLSPACASFDQYQSFEHRGEHFRELCQKLI"
FT   gene            complement(230720..231667)
FT                   /locus_tag="cce_0241"
FT   CDS_pept        complement(230720..231667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0241"
FT                   /product="hypothetical protein"
FT                   /note="contains a UbiA prenyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49592"
FT                   /db_xref="GOA:B1X091"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:B1X091"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49592.1"
FT                   /translation="MSQPSINSPKVFWKNPLAWLISFWEFSRPHTIVGTSLSVLALYLI
FT                   ALATVENSITFNNIEDLLIALIACLCGNVYIVGLNQLEDQEIDKINKPYLPLASGDFSL
FT                   IQGRYIVSITGILALITSCLGSWWLGLTVAISLIIGTAYSLPPIRLKRFPLLAAFCIFT
FT                   VRGIIVNLGLFLHFAYNFIGRSFWVPEVWILTGFVVIFTIAIAIFKDVPDLEGDKEYNI
FT                   TTFTILLGKKAIFKISCAIIIFCYLTMIAVGFLSIFSLNQGFLIISHAGLLTLLLWRSQ
FT                   KVNLDEKISIAQFYQFIWRLFFLEYLLFPIACLL"
FT   gene            complement(231748..232908)
FT                   /locus_tag="cce_0242"
FT   CDS_pept        complement(231748..232908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0242"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49593"
FT                   /db_xref="GOA:B1X092"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1X092"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49593.1"
FT                   /translation="MNVVFFTHYSDLYGANLGLINLIDGLKKYQINCHVIIPKKGKIGR
FT                   ELRSRNVPFAIIPIECWIDMPRRSNNPSKKFYWKLQRLLKNIQLIPQLTKIINSWEADI
FT                   IYTNSAVINIGLVVAKLLKLPHVWHIKEFVDLDYDFQFDWGKKFFQYSVKKSEAVITMS
FT                   QALTAYHFKNISIPSIQVIYDGIAFESNFDHWYQLSHPYPFDKNEFYTFALVGKIYPQK
FT                   GHEIAIKAMAIITKKYKNVRLIIVGSGEQSYENYLQKLTHELEIANKVEFWGYLNDPFK
FT                   AYFSSDAVLMCSTSEGMGRVTIEAMATCRPVIGYDNAGTSELIEHESTGLLYQNNEPKT
FT                   LAACMERFVENVSWSQALGKNAWKIAKQKYSIENFAQEVYQVLSSL"
FT   gene            complement(232928..234181)
FT                   /locus_tag="cce_0243"
FT   CDS_pept        complement(232928..234181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0243"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49594"
FT                   /db_xref="GOA:B1X093"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1X093"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49594.1"
FT                   /translation="MKIAFILGQFPALSETFILNQITGLIDRGYDLDIYAIQPGDVTKI
FT                   HPDIEDYKLLEKTYYDQRPENKYIAYLNALKLFLLSFFIQPWKRLPVLLRIISSARPGQ
FT                   LSKSLDLFYAAISCLKHHQNYDIIHCHFGMLGVKTLKLQKVGAIQGKKLITSYYDVDVT
FT                   KYPKIAGKDVYIELFEKGDLFLGLTHSMNKQIIELGCPPEKLQKLPTISVDLSRYQFRP
FT                   CVLKPDEPIKLLTVARLVETKGIEYSIKAVSKVIEKNPELNIMYRIVGTGKLEKKLNKL
FT                   INNLGVSQQIQLVGGMTQTEVREIYADSHIFILASTTAANGDQEGLPTVLQEAQGIGLP
FT                   IVSTFHSGIPEGVVNEESGFLVPERDVDALGEKIEYLVKNPQIWEKMSLTGRQFVEANY
FT                   DMNKVMDQLVEIYQTLLS"
FT   gene            complement(234352..237102)
FT                   /locus_tag="cce_0244"
FT   CDS_pept        complement(234352..237102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0244"
FT                   /product="unknown"
FT                   /note="contains DUF187"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49595"
FT                   /db_xref="GOA:B1X094"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1X094"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49595.1"
FT                   /translation="MCVVLRKIQWNKTKASGKKALIFSSKPLLKLLLSLIASGFLITPS
FT                   HALLGKVGVVKSPENENQWTSIRNRLLATNIQFCLIEAENWKTAEDLRNVRTLFLPNVA
FT                   TITGQQAQALETWVTGGGNLIVSGPTGNLSESAVKDQLRALFGAYWGFSNSNPSTIKVE
FT                   QTSQLPLVNPDSLSDTLIGGVVIPSAITAQPLAVWLTENKPPAVIVHDRTIFLGWRWGV
FT                   SGVTSAAFDVTWLKTVLNRYGINEGNQLVAENSVDIPPCNLVDVNPPQQPFPILPPIYI
FT                   PQSQEPQIETGPDPSIEIELSPDSYVPSSSPTLVSALQSGSLRDRRSQGFNYGLDRNSV
FT                   AVISPQQAQTMTEELSKLIVRFESTLLAAQAYNQGISDNPYVTLHQSQEAVNQAKLSLQ
FT                   NFQRLLNQRQYDQARQLWLKARRNLWDHYPTNTSLAQAEVRAMWLDRGTIVKTRSEAEL
FT                   AVLFDRMAEAGINTVFMETINASYPIYPSRVAPEQNPLTKGWDPLKAAVKLAHERNMEL
FT                   HAWVWLFAAANQGHNEVLEQPKDYLGPVLSRHPDWGITDQDGNYFDKGPQFKKAFLDPA
FT                   NPRVQKYLLSLLDEIARNYDVDGIQFDYIRYPFQQPQNNQTFGYSKSSRYLFKEMTGVD
FT                   PVEITPGHPLWNQWTGFRIRQIDSFVATASTHLKQINPELIISASVFPIERRDRLFRLQ
FT                   QNWEEWMEQEWVDMIVLMTYALDTGNLEERIKFAFDDSLPGSALVIPGLRLLKVPDPVT
FT                   IDQLQFVRNMPISGFSLFAAENLTPSLQRLLSRIQTPNNPQPLPYRQPFQTALARYQAL
FT                   QQEWDFLANKEQLKIDKNSLKKIDNQGKQLEKALEQLAAGPSTNNLRIAQQSLRQFQRQ
FT                   FPNWMSNHKQVYSYQVQVWENRLVTLDKLLVYGESKIVNNPRIRP"
FT   gene            complement(237245..238174)
FT                   /locus_tag="cce_0245"
FT   CDS_pept        complement(237245..238174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0245"
FT                   /product="putative inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49596"
FT                   /db_xref="GOA:B1X095"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B1X095"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49596.1"
FT                   /translation="MNETQISFFSDYLTAAIRLSIPLGFAALGGMWSERSGVLNIALEG
FT                   MLLTGAFVSASVAFISNNAWLGLIIGTITGGLVGLLHAYFSVTLKINQIVSALGINLSV
FT                   TGLTAFLSRIIFSRGNINTLPNFSFFEVLNRSKLQWFLFPENLFILLLILLIIASSYLL
FT                   FYTNFGLSVRAVGQYPLAAETAGISVDWIRYGCVLLSGILCGLGGAYLALVHIQYFAEG
FT                   IVAGKGYIALAAVIFGRWHPLGIMGACFLFGATEALQLRIQTFNLNIPYQFLNMLPYLV
FT                   ALLALLGLGGKASPPTALGVAYNKESRD"
FT   gene            238423..238965
FT                   /locus_tag="cce_0246"
FT   CDS_pept        238423..238965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0246"
FT                   /product="putative DNA-binding protein,
FT                   starvation-inducible"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49597"
FT                   /db_xref="GOA:B1X096"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:B1X096"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49597.1"
FT                   /translation="MATAQVTNSPNASSKARFYPTRIDLSADIRQQVVSILSPTLATTL
FT                   DLKTQAKQAHWNVKGLNFYQLHELFDILAGELEGYVDMVAERITALGGTAMGTARIAAN
FT                   ESIIPEYSFDAVEGIEHIRALAERYAAYGTHLREAIDKTEELGDADTADLYTEISREVD
FT                   KRLWFLEAHLIKKSELH"
FT   gene            complement(239050..239931)
FT                   /locus_tag="cce_0247"
FT   CDS_pept        complement(239050..239931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0247"
FT                   /product="unknown"
FT                   /note="contains a Mechanosensitive ion channel, MscS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49598"
FT                   /db_xref="GOA:B1X097"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B1X097"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49598.1"
FT                   /translation="MYLLQAPVELPVEIPIDEVQVEQVNVFVQTLKEQITNFGLKFLGA
FT                   IALWIVGQWLINKGVRIMSRVLKRQSIEPTLIAYLANFLGVSLKIVLIVAILGYFGIET
FT                   TSFAALLAAAGIAIGAAWGGLLANFAAGVFLVIFRPFGVGDFICAGGITGTVEEIGLFV
FT                   CTINTLDNVRTIVGNNKIFSDNIQNFSANPYRRVDLVAQLNHGVNHAEAINLLQQRLNQ
FT                   IPNVIAEPSPDVEILEFNLAGPVLAVRPYCSNEHYWQVYFDTNKVIRETLADAGYAVPE
FT                   QHYAIRNTSVVS"
FT   gene            complement(240156..241787)
FT                   /locus_tag="cce_0248"
FT   CDS_pept        complement(240156..241787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0248"
FT                   /product="putative 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49599"
FT                   /db_xref="GOA:B1X098"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:B1X098"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49599.1"
FT                   /translation="MGTANQIWLYDTTLRDGAQREGISLSLEDKLKIARQLDKMGIPFI
FT                   EGGWPGANPKDVQFFWKLQEEPLTQAEVVAFCSTRRPHKRAAEDPLLKAILAAGTRWVT
FT                   IFGKSWDLHVTEGLKTTLDENLEMIADTIEYLRTQGRRVIYDAEHWFDGYVNNPDYALE
FT                   TLKTAKAAGAEWLVLCDTNGGTLPHDVSRIVRDVITALEIKPDEDSPQLGIHTHNDSGT
FT                   AVANGLAGVVEGVRMVQGTINGYGERCGNANLCTLIPNLQLKMGYRCLEDTQLTELTKT
FT                   SRLISEMVNLAPDDHAPFVGRSAFAHKGGIHVSAVQKNPLTYEHIKPENIGNQRRIVIS
FT                   EMAGLSNVLSKAKSFGIELNKEDAACRQILARIKELEHEGYQFEAAEASFELLMRQALG
FT                   QTKSFFQLQGFQVHCDMLYGEGMPYSNALATIKVTVNGEDRLEVAEGNGPVSALDSALR
FT                   KALVNFYPEIAQFHLTDYKVRILDGGAGTSANTRVLIESSNGQTRWTTVGVSPNILEAS
FT                   YQAVVEGIEYGLLLKSTMKKPVKSMS"
FT   gene            complement(241929..242060)
FT                   /locus_tag="cce_0249"
FT   CDS_pept        complement(241929..242060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49600"
FT                   /db_xref="GOA:B1X099"
FT                   /db_xref="UniProtKB/TrEMBL:B1X099"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49600.1"
FT                   /translation="MTPKSKLNDLLLIDLYLNTDGKILIFLGNLPISILSFLFLCQN"
FT   gene            242068..242373
FT                   /locus_tag="cce_0250"
FT   CDS_pept        242068..242373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49601"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49601.1"
FT                   /translation="MSVLGTETLAYPNRVRFNPNAGVHRTIIAPNTNLGNSYPRGNDYH
FT                   RGGRNYTFRERITIQRDRRGTCYNCGYSNGYNSYRNYRNYGRNYRFVPNNSSSDYH"
FT   gene            complement(242383..244182)
FT                   /locus_tag="cce_0251"
FT   CDS_pept        complement(242383..244182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0251"
FT                   /product="putative sodium/sulfate transporter, DASS family"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49602"
FT                   /db_xref="GOA:B1X0A1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49602.1"
FT                   /translation="MFISPIILTLIILLLALISFICEFFPVDTTAIGITVLLILCQLVT
FT                   PEEGISGFSNSATITVMAMFILSAGITRTGGLQIVRDLLFQLGGKSLRKQIASLGIIVG
FT                   FISAFINNTAVVAVFLPIIESWGKKRKISLSKLLIPLSYTAILGGVITIIGTSTNILAS
FT                   GLSKKLGYGEFSIFLITPIGIPIFFIGLIYLTFIAPRILPERKSVSNDGLDVDYGMKDY
FT                   VSEIIITPRSNLIGQTLRQSGIQRKFDIDVLEIIHNDIHFPQPLADKILSLGDILLVRG
FT                   SKEDLLQIRDERGVDILADVKFDEEKVEDELSFGEDKVAEVLILSNSRLIGSTLKDLRF
FT                   RQRYNATVIAIRRGEELLRERLGKVRLRFGDLLLVQGPKESFIGLQTTRELLVLEERDI
FT                   ETLRQNKAYIAIAIVFGVVILAAFNILPILVSSLVGVMLMIFTGCLKPGEIYGAVRWDI
FT                   IFLLAGLIPLGIAMDKSGTNELIANYIVMLGGYLPNYFVLVLFYFFTALLTEILSNNAA
FT                   VLLMLPVAAEVAENLDLNPIAFMLAVMFAASNSYITPIGYQTNTMVYGPGGYRFLDFTR
FT                   VGLPLTLMFTFLVPFFIIIVYGL"
FT   gene            244375..246120
FT                   /locus_tag="cce_0252"
FT   CDS_pept        244375..246120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0252"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49603"
FT                   /db_xref="GOA:B1X0A2"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49603.1"
FT                   /translation="MRLSQGKRKSRKKHKETLSVNIKDKLAQKRKARENRRKLMGLIGF
FT                   SLFFAILVGVPLSFTISPKIGVSVGLLIPSLIICYNYPRTALWAFLIYMPFSGTVTYWI
FT                   GGGNALFQLSKDGFYIPALLGLMQDCRKKRKPIVVSKPLLTTLILLLVCALLTLLFVNG
FT                   FKQFLPTCDSLSEYDKFLRDANGQLILDQNGVVITTPCKESIPFAQGLLGLKILLGYVP
FT                   LIFCAYYLIQDKKRLLFLGRLLVVLAIICCALAFIQYWMLKTGRCAGTDHLVGEDLFKP
FT                   KLDAKCFVGGSLLYAPSQGQIRLPGTFVSPWHWAWFLVANAAICFSVAFSDTAFFWRNC
FT                   GLVGMAMVFVNSIICGQRLALAAVPAILIAMLFLTGKFADIKRFIPVGIGLSVVLFVGF
FT                   SFFNPDFIQERIDSFVDRWNASPPYLFIQQQFDYAIRNQKGLLGRGLGAATNSTRIFGE
FT                   VALVETYHPKLLFEMGYLGLGAFMIFVTHLCVLTFKAYRPLKDESLRSFASGFWVFILI
FT                   ISYFPYWYPLDTDPVAIYYWFFAGVILRMPLIDKEEQAKLKAQQAAEDASKKRVKTKRK
FT                   TPSVI"
FT   gene            246138..247172
FT                   /locus_tag="cce_0253"
FT   CDS_pept        246138..247172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0253"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49604"
FT                   /db_xref="GOA:B1X0A3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49604.1"
FT                   /translation="MSYPSISIIIPSYRREQILKDTLEDVLKQDYPHFEILVVDQTASH
FT                   DPTIQSYLENLANTNKIKWFRVSWASLPAARNYGVRRSQGDIIIFIDDDVQLPANYLYS
FT                   HTKIYQEKSEIGAVAGRVLDRMKLADAEKINDSEDPYTIEMLPPEAMDPGIAWYYIDLV
FT                   HTTKPQEVISTRGCNMSFRREVFTKYNVWFDERFRGNAVREESDFCLRLRQTGYKIWYE
FT                   PDAYLVHLGEETGGCHDMSTRSFSYQMTFYHNHFLMALKNLTFLEQLRLYTKLFDCHVL
FT                   GNPPCNKGGSPIKILVRLLFYTLGFIDAIRTIIISQWNDGQIYSKNDINYHQLQSNKSL
FT                   ESVS"
FT   gene            247205..248377
FT                   /locus_tag="cce_0254"
FT   CDS_pept        247205..248377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0254"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49605"
FT                   /db_xref="GOA:B1X0A4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49605.1"
FT                   /translation="MKILVASHTYIVDLNCEKFKTLAQLDPNLEVTIIVPQKWKPGGVQ
FT                   NKIIEKQPRFEGNFKVIPIYNFSQNNQGLLTFGTDIIKLLNEFKPQIIQVEQGVKSFAY
FT                   AQLITLNKWLNLKAKNVFFTWWNLPYESKFPVSYLEQYNLKNTDGLVAGNQDAADILRD
FT                   HGYNKAVAVMPQLGVDEVLFSPQKQPELAQKLGIKKQDFVIGFVGRFVEEKGILTLLKA
FT                   VQALPEKNWKLLLLGRGELQAKIIQESKDVKIEDKLIMLESVAHDQVPQYINLMNVLVL
FT                   PSETTYQFKTLTAVGWKEQFGHVLIEAMACKVPVIGSDSGEIPNVISDAGLIFPEGDST
FT                   ELKNCLSQLMLDPALADKLAEKGYRRVLENYTNKALAEKTLTFYQSLSDK"
FT   gene            248487..248657
FT                   /locus_tag="cce_0255"
FT   CDS_pept        248487..248657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0255"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49606"
FT                   /db_xref="GOA:B1X0A5"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49606.1"
FT                   /translation="MLILPGSTVRVTNPNDTYYRFEGLVQRVSDGKAAVLFEGGNWDKL
FT                   VTFQLSEIEVV"
FT   gene            248733..249401
FT                   /locus_tag="cce_0256"
FT   CDS_pept        248733..249401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49607"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49607.1"
FT                   /translation="MRLPLPQFSTDSRHPDHIAEVIETSTTQFLAQCLEPEDLSFPVMP
FT                   AFGSWVKSLDEESGNKIVAVVTYATTTPIDSVHRARALGLSLEELRQQQPQIFAMLKTE
FT                   FKATIVGFESSQNAENGNGHNLGKVYQYLPPRPPQIHQGVHRCEAVEIINFSEEVEFLR
FT                   ILLQVRDAPVDALIAAAIRDIYLLRKADKNWLVKVGRTLSILLRDDYDRLQYILSQVTL
FT                   "
FT   gene            249519..250979
FT                   /locus_tag="cce_0257"
FT   CDS_pept        249519..250979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0257"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49608"
FT                   /db_xref="GOA:B1X0A7"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49608.1"
FT                   /translation="MMISEALLEKLSDIINRDPGVNIVPSLGEPTAIEIEEQRLKAQGQ
FT                   WVSAIASLEILLLSYLDTNTSDNKNPQGLILSAPTPILCHPNLTNLIQTGIFTLQPSQH
FT                   SWKQFQLPGFADAENRNQRPNIREFPLFPQDPLATEQFCLVLTSQFSLLMVLGEDSLGL
FT                   PAFQFSFDPDVISQAWLRLRSRLSLVNHPQLCDLDELVKQLIPSTPSYQVVTEFSRLLL
FT                   HYFPKISPIINSKNCYSQDLENGKDQAYSSKKNSFTTSTVEEATDVALLQALSHEIRTP
FT                   LTSIRTMTRLLLRNKELDPKMIRLLENIDQECSEQINRMELIFRATELKSKGSQDPSVE
FT                   LVRTSLDTLFHQSIPRWKRQAQRRNVDLEIGLPKKLPQVVSDPGMLDQVLTGLMEKCTR
FT                   SLSGGGQIKVQVSTAGHQLKLQFHTESYRQYNPFKALGQLLLLQPETGSVSLNLDVTKN
FT                   LFNRLGGKLIVRQRSQQGEIFTIFLPLT"
FT   gene            251234..252064
FT                   /gene="cysH"
FT                   /locus_tag="cce_0258"
FT   CDS_pept        251234..252064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="cce_0258"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49609"
FT                   /db_xref="GOA:B1X0A8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49609.1"
FT                   /translation="MPQSNLHLVNSHVDNHQVSEPYSHSQTHQRSKPELSLEVVNQTLE
FT                   NANAQQVIEWARDTFGDGLVMSTSFGIQAAVMLHLVTEVVPDIPIIWVDTGYLPPETYR
FT                   FAEELTDRLKLNLKVYQSTLTPARMEALYGKLWSQHDVESLNRYDLIRKVEPMQRALKE
FT                   LQATAWLAGLRRQQTEHRKSLERVELQGDQYKVYPILTWNSRDIYHYLTAHDLPYHPYF
FT                   DKGYVSVGDWHSSRPVTTADENERDSRFHGVKQECGLHLPLSPEAAESLDSSTL"
FT   gene            complement(252456..252653)
FT                   /locus_tag="cce_0259"
FT   CDS_pept        complement(252456..252653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0259"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49610"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0A9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49610.1"
FT                   /translation="MSTQQQARALMMRHHQMVKNRQQSMLGRAASEIGVDVEKDYWTTI
FT                   QGKPCADFRSSYDRSNAAMS"
FT   gene            252947..254305
FT                   /gene="engA"
FT                   /locus_tag="cce_0260"
FT   CDS_pept        252947..254305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="cce_0260"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49611"
FT                   /db_xref="GOA:B1X0B0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X0B0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49611.1"
FT                   /translation="MALPIVAIIGRPNVGKSTLVNRLAKDRQAIVHDQPGITRDRTYRP
FT                   AFWCDRDFQVVDTGGLVFDDDTEFLPLIREQAMAALTEASAAIFVVDGQLGPTAGDREI
FT                   SDWLRRQKVPVLLAVNKCESPEMGLIQAAEFWELGLGEPYPISGIHGSGTGELLDQLIT
FT                   YLPSPDELPDREEINVSIIGRPNVGKSSLLNAFLGEQRAIVSPISGTTRDAIDTVVERG
FT                   DNTYRLIDTAGIRRKKNVNYGAEFFSINRAFKAIRRADVVLLVIDAIDGVTDQDIKLAD
FT                   RIIDEGRAAIIVVNKWDAVEKDSYTIYDYKQKVMDRLYFMEWADIIFVSAMSGKRVENI
FT                   FELVDVAVEEHRRRVNTSVVNEVLEEAVKWHSPPTTKQGKQGRIYYGTQVSSQPPTIAL
FT                   FVNDPKRFNDNYRRYIERQFREQIGFPGTPIRLLWRGKKTRDVEPSLNRATKV"
FT   gene            complement(254580..255563)
FT                   /locus_tag="cce_0261"
FT   CDS_pept        complement(254580..255563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0261"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49612"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49612.1"
FT                   /translation="MFSIDALSWCACWFRGNLGTVRSAFCHVDDFCQTFEPLWHKQLIS
FT                   HGFQTRQRRKCLCLSEIMTILIVFHANHYRNFKHYYLEEVCCHFRAEFPHLPSYQRFIE
FT                   WMPSTLIPLCVYLKHCFGQCSGISFLDSTSIKVRNALPLSTWILNPGGSGVCHNRRISR
FT                   HKVFDGLAARGKTSVDWFFGFKLHLVVNEQGELLNVSITAGNVDDRNPVLELVEGLFGK
FT                   IFADRGYVSQKLASELLDNLGIEFFAKPRRNMKNKLMGLHDKLLSRKRSIIETIIDQLK
FT                   NISQIEHSRHRSPVNFCVNLLCGLIAYCHQPKKPSLEMDWVLPESA"
FT   gene            255892..256089
FT                   /locus_tag="cce_0262"
FT   CDS_pept        255892..256089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49613"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49613.1"
FT                   /translation="MLGKQLKGSNYITGAVCLMDYLEKVLEKLRELAQKLIETLLGPQA
FT                   EPEPELIPIPVNDPKRRSHR"
FT   gene            256101..256565
FT                   /gene="aroQ"
FT                   /locus_tag="cce_0263"
FT   CDS_pept        256101..256565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="cce_0263"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49614"
FT                   /db_xref="GOA:B1X0B3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49614.1"
FT                   /translation="MFTESSQKLSILVIHGPNLNMLGIREPGIYGSVTLEGINRLLSEK
FT                   ADSLGCTLSITQSNDEGVLVESIQDALGNHQGILINAAAYTHTSIAIRDALSAVKIPTV
FT                   EVHLSNIYQRESFRHHSYIAPIAVGQISGFGANSYRLGLEALHHYLNQQE"
FT   gene            256633..257343
FT                   /locus_tag="cce_0264"
FT   CDS_pept        256633..257343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0264"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49615"
FT                   /db_xref="GOA:B1X0B4"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49615.1"
FT                   /translation="MSMRLTILALMVISAGIMLLQNQQSITLYFLGTDAETALFSLGLP
FT                   LGLWILIFTIAGIISSLFIQLFTRSSRLLSFKKPINPSPRLPDPPETPYQRPEPKQSDW
FT                   ERSSPPEWEKSPQDKEDDDEWEIEEPPIEKTIPRRPPQGENTRSEFEIQQPPKTASQEG
FT                   TVYSYTYRELSDRVSSDPSQSPPKLEKKPQSSSSQTRGDVYDAQYRIITPPYQPSQESN
FT                   DEDGENEEDEENWI"
FT   gene            complement(257340..257561)
FT                   /locus_tag="cce_0265"
FT   CDS_pept        complement(257340..257561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0265"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49616"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49616.1"
FT                   /translation="MKPINYTKMSDQQLKQYLIEHKNDKEAFYAYLDRKQQQPKQVIIG
FT                   IDELDSLTSEQQIELITQRIQEKFNVSS"
FT   gene            complement(257561..257743)
FT                   /locus_tag="cce_0266"
FT   CDS_pept        complement(257561..257743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49617"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49617.1"
FT                   /translation="MNEPTLAQLKRLYLLSYTLTNVMFQPIHIIRLDERNQNLFILAGH
FT                   QENIEIVITPDGEAF"
FT   gene            complement(257836..258897)
FT                   /gene="psbA3"
FT                   /locus_tag="cce_0267"
FT   CDS_pept        complement(257836..258897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA3"
FT                   /locus_tag="cce_0267"
FT                   /product="photosystem II D1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49618"
FT                   /db_xref="GOA:B1X0B7"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49618.1"
FT                   /translation="MTTTIQSQNLSLWERFCQWITSTNNRLYVGWFGVILIPTLLTATI
FT                   CFIIAFIAAPPVDIDGIREPVAGSLLYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEW
FT                   LYNGGPYQLVIFHFLIAIFCWMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPIG
FT                   QGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGALFSAMHGSLVTSSL
FT                   VRETTETESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVIG
FT                   IWFTAMGVSTMAFNLNGFNFNQSVLDSQGRVIGTWADVLNRAGIGMEVMHERNAHNFPL
FT                   DLASGEQTLIALK"
FT   gene            259278..259826
FT                   /locus_tag="cce_0268"
FT   CDS_pept        259278..259826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0268"
FT                   /product="putative HAD-superfamily phosphatase subfamily
FT                   IIIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49619"
FT                   /db_xref="GOA:B1X0B8"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49619.1"
FT                   /translation="MSKAKLLQPDLILGDTILGLSQEVLDHYRIKGLILDVDETLVPLK
FT                   KAHVSEDLRQWVDQIRQKTPIWLVSNNLSESRIGRIANSLELPYLLGAVKPSRRKLKKA
FT                   IRAMELPIPQVAMVGDRLFTDVLAGNRMGMFTILVKPMVDPAIAARSYPIHNFEVWISE
FT                   KLGISLLSSQQKFTKRHKR"
FT   gene            complement(259873..260154)
FT                   /locus_tag="cce_0269"
FT   CDS_pept        complement(259873..260154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49620"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0B9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49620.1"
FT                   /translation="MAHTQEKITYPHLPLAVYRELAAHLRQIEGVTIALIPQQSQQFNY
FT                   DQSQIDHLEIGYPSSLSSLEKQRLLDILDYYAQIHSPYTREVQESVPS"
FT   gene            complement(260181..261314)
FT                   /locus_tag="cce_0270"
FT   CDS_pept        complement(260181..261314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0270"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49621"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49621.1"
FT                   /translation="MVMIKKVPSMLLLSYIALTLGGCGLFQGSQEPSEESPVAESPQPP
FT                   ETSEEKPGEVFEETTPTPTPPQVSATEGLIPSTTPSERRKNIQTGRDNPFSVIPIQPVV
FT                   RQTTGSNGSTQNVAQNGVSQPEKLCTLEQRPIATVAQAPGTGTPVSDIGPAPLLAPVLP
FT                   IPNEARGVVVSGVMQLNGTPVAIVKAPNENVARQVRVGGSLSNGQVKVKAINASSQRPY
FT                   IVLEQYGLEIPRGVGEPAEEPVDPPTPGPSQAVASSGSAVQAPGPDGFGIIRDLMLQQV
FT                   QLTGEDTANPLINGTLCNDGNETLKVSTLTLQIAEKGTNKIINSMKVELAATYTLSPGT
FT                   QAEFDGRVGANDQSQKSELGLRGRNKEDVRITLTDWS"
FT   gene            complement(261469..262842)
FT                   /locus_tag="cce_0271"
FT   CDS_pept        complement(261469..262842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0271"
FT                   /product="probable alpha amylase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49622"
FT                   /db_xref="GOA:B1X0C1"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49622.1"
FT                   /translation="MRDRSVGMFVKEENVMRDVVLHVFNWQYQEIINRLGEIRDAGYGA
FT                   LLIPPPIYSDVKGHDWWQCYQPKDYRVVLSHLGGKQELKELIEQCHTIEPKLKVYADII
FT                   INHMANETRPDRLNFPGEAELANYRKNQALFEANRLYGDLSVGLFSPFDFNRGGNIERD
FT                   QWCDRDRVIYGDYNNLPDLMDSPWVLSQQRTMLIALAAMGFDGFRIDAIKHLSERMIDN
FT                   FADSESLAGSYFFGEVLTGSDCEENIFLDPFLRETWISAYDFPLFQTIREAFGFGGSLR
FT                   KLAHPEAENNALPWDRAVTFVVNHDIPHNKDFRGWLLDPTDEHLAYVYILGRDGGLPLI
FT                   YSDHNESAHTYSKDRDRWFDAFQREDIKAMIKFHNAVHGNPMTILYDSDLLLVFRRGEN
FT                   GIVAINKAGYDTSVEFNTWGLKSSSYEDLISHRQMRLGGDRCTLSMNPRTAQMWLCHQ"
FT   gene            complement(262891..263406)
FT                   /locus_tag="cce_0272"
FT   CDS_pept        complement(262891..263406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49623"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49623.1"
FT                   /translation="MPLIESRIYPYSPSLADKLAMRITELVVEQLKESFAEQLGFLGTK
FT                   NEAIAKEVIGRFAPGWVWVYSEEFKAIVAGKQPKNSEIFGRFDIFLLENALAEKHQDAL
FT                   VNTVAKAARQVLGETQDKPLNLAVANITGNVRMSVPGNPDSLLTAEGVHTFLTDAINQE
FT                   LKSLALAQ"
FT   gene            complement(263448..264071)
FT                   /locus_tag="cce_0273"
FT   CDS_pept        complement(263448..264071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49624"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49624.1"
FT                   /translation="MEYPTFKLLYQRRVMSMQVLVNKKNYYAELSADYSQPGLVPQKKR
FT                   ANLIELAQYYISLQQGELPSITPQYTEKQIEEENKQWWPTHCEALRQGRGDLLSGEYRD
FT                   ELVYFCQDGPFYGKNAGTEREQHWWAIIAQPGVTMTWPIVMFKGDVVYFEWQCLDDITH
FT                   ETIAKGNVTFLRRGHQGGVYLKTEQLTFYRDVFASEDLLNLVNT"
FT   gene            complement(264007..266718)
FT                   /locus_tag="cce_0274"
FT   CDS_pept        complement(264007..266718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0274"
FT                   /product="hypothetical protein"
FT                   /note="contains a N-acylglucosamine 2-epimerase-type domain
FT                   and a ThiJ/PfpI domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49625"
FT                   /db_xref="GOA:B1X0C4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49625.1"
FT                   /translation="MRGFCNQVTLMGRVIERLEDVTHQSNLNGKGIDFKIRCRSGDEFY
FT                   IYVTSTTNFQSLSNLDNINRNRYGNLEEFGTRSDPDLNPIEKTSKYLNVGRLVVVEGVL
FT                   LQNGLSKRIDAKTIHLLYDQNGQTIDYQGHFLFESTHWWVTQMSRLADVWLDTLYDGHG
FT                   RYNFSKYRTNLNITFGPTQDNIQEMATLSRLIYGLSSAYLLTGSQRFLDAATAGVNYQR
FT                   EYFRSLTHDGRYCFWAYGKRDNQLIIPSESDEPLGRGTIPLYEQIYALAGLIQYYRVTL
FT                   EWETLDDIRRTVNTFIKYFHDSSEFGGFFSHLDPATLKPKTWPVNDPILLKEVKVYQNN
FT                   PQQPRKNWNSIGDHIPAYLVNLILALEPLPLNKHTEQIREFLNSCKEILKETATLIAEK
FT                   FPEKNNDFVQERFYPRWEPDTHWDWQQDRGIVGHNLKIAWNLTRVSNYYSSQPKEQSFS
FT                   YALLQLAERIAQNMVKVGAIDTFRGGCFDALERHPKNGMIREYPWLNTKDFWQQEQGIL
FT                   AYLILYGKTRNQLYLELAQEMMAFWNIFFLDRDRGGVYFRVNDNGSPVITGRYGKKADP
FT                   SISGYHVFELCFLTHLYLMTYVRNKSFCLFFKPDSQLTQTTLNVLPDFFPPNAVQIQRI
FT                   TINGVERSTVDPDNFQIELGPDDFGSEIVVEFQPLTMDNRQEFVEKTEKKGKIGVLVES
FT                   HFDETEIQAFSQFFPKHGYEIVYISRLWNNPVLEFTGNEHLDPLRVRCDVDQVNPSDFK
FT                   GFILVGGYAMDRLRYEDNPQSHQDNQAPALNLIRKISQIKGLKLGTICHSLWLLTPDKT
FT                   LLRGKKVTCAHNIIDDVKNSGAEVIYQNSGGTVNTYVDGDLITAKHPGVVEEFMKVYLR
FT                   ELEKIATDDSPYGISHFQTTLPKESDEYASLS"
FT   gene            complement(266910..267023)
FT                   /locus_tag="cce_0275"
FT   CDS_pept        complement(266910..267023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49626"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49626.1"
FT                   /translation="MDKKMLYQFSKIARDLINILFPLSPPASPAFSAYLNS"
FT   gene            complement(267054..268226)
FT                   /locus_tag="cce_0276"
FT   CDS_pept        complement(267054..268226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0276"
FT                   /product="ATP-binding protein of sugar ABC transportor"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49627"
FT                   /db_xref="GOA:B1X0C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49627.1"
FT                   /translation="MAKLRLENLTKQYQIDQGKTLDVVKGISNVEVEDGEFLTLLGPSG
FT                   CGKSTLLRLIAGLEPPTKGDIFIGEKKVTNIAPGDRNIAMVFQSYALYPHMTAKENIAT
FT                   ALKIRNLSEEEIDQRIQTAAKQLKLQEGKDCLPEKPGKLSGGQRQRVALARALVRNPEV
FT                   FLLDEPLSNLDALLREQVRAELKQIFTEQNKPVVYVTHDQTEAMTLSDKVAVLFAGEIQ
FT                   QLASPREIYQYPANQFVAGFVGSPQMNLLELECQNNKAILGQFGIPLTSIAPENIPEVE
FT                   GESPGLKHIVLGIRPEDIHEATEGDALVIHGQIKLVEELGKESLISVQIDQSDLVIRAL
FT                   LKDDGNKKNGNDISLALPEQNIHWFYWDGSGYDPDGKPLLSYHQRYRLNQ"
FT   gene            complement(268283..270298)
FT                   /gene="rne"
FT                   /locus_tag="cce_0277"
FT   CDS_pept        complement(268283..270298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="cce_0277"
FT                   /product="ribonuclease E"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49628"
FT                   /db_xref="GOA:B1X0C7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49628.1"
FT                   /translation="MPKQIIIAEQHHIAAVFWEDQIQELVVATGNQQVSDIFLGVVENV
FT                   IPGIDAAFVNIGDAERNGFIHVTDLGPLRLKRSAGAITELLTPQQKVLVQVMKEPTGNK
FT                   GPRLTGNISLPGRYLVLMPNGKGVNLSRRIRNDDERSRLRALAILIKPAGMGLLVRTEA
FT                   EGKAEEAIMEDLEFLQRQWESIQVQATSTRAPSLLNRDDDFIQRVLRDMYSADVNRIVV
FT                   DNPSGVKRVKHHLMNWSGGRPPEGVLIDHHRESMSILDYFRVNAAVREALKPRVDLPSG
FT                   GYIIIEPTEALTVIDVNSGSFTRSATSRETVLWTNSEAATEIARQLRLRNIGGVIIVDF
FT                   IDMDSRRDQLKLLEHFNKALKVDKARPQIAQLSELGLVELTRKRQGKNIYELFGQPCPQ
FT                   CGGLGHLAHLPGESQLVALESAATTPLPVPAPTPVTPKPIEKPLEVNDSGWDSPFEDED
FT                   SDNSDQLELLHHPSYQEQNSNANNRRRRRRQTPNLVIKEDSTKSSSNVGIKETDDNNNE
FT                   SGNDNRRERLPRHLRREEGPVERVSVEMTPLEQDVYALMGISPLVRVDKEFKDPKSVVV
FT                   SVKSPEGIERKTIEKTSATTPETQTPTSEEQQMVIDLTDMDPTATESQAIEEGIETDND
FT                   NDDENESDFTSASQDEGTKPVIRRRRRRSSAKDSDE"
FT   gene            270987..271622
FT                   /locus_tag="cce_0278"
FT   CDS_pept        270987..271622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0278"
FT                   /product="rfrA family pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49629"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0C8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49629.1"
FT                   /translation="MTKALFHWYPHKKYIIMLKVIKDARMIKLRLYELQQRYALGNREF
FT                   TNVDLSGLDLSGLNLKNINFQGAILQGTNLQGTNLERANFKGTNLTNCNLYRANLYGAN
FT                   LNYTNLVYSNLKEANFHRSIIENSCLDYVCLERTDFSEAHLRTLSVEGTQLTKTDLTDA
FT                   TLIDVNLSQAYLSEIYYSQLTKLCNCFQVEAISDQFFDDINKEMEFAV"
FT   gene            complement(271651..272817)
FT                   /locus_tag="cce_0279"
FT   CDS_pept        complement(271651..272817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0279"
FT                   /product="NifS-like class-V aminotransferase, probable
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49630"
FT                   /db_xref="GOA:B1X0Y9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Y9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49630.1"
FT                   /translation="MSQRPIYLDCHATTPMDKRVLEVMLPYFTEHFGNPSSVNHLYGWE
FT                   AEASVKKARTTIANAINCSPEEIIFTSGATEANNLAIKGIAEAYFNQGQHIITVQTEHR
FT                   AVLDPCQYLEQLGFEITYLPVKKDGLIDLELLEKSFRPETILVSVMAANNEIGVLQPLK
FT                   EIGEICQKNQVLFHSDAAQAIGKIPLDVQEMNIHLLSLTGHKVYGPKGIGALYIRRRNP
FT                   RVNIAPQLHGGGQEKSIRSGTLYTPQIVGFAKAIELALAEIETENKRQSELRNQLQEQL
FT                   LNLEGVHLNGHLTQRLAGNLNVSIEAVDGAALLLGLQGIVALSSGSACTSTTTKPSHVL
FT                   KALGHSDKLAYASLRFGLGRFTTSQEIDKVGQRVLDTIKSLRQATIRN"
FT   gene            complement(272929..273756)
FT                   /locus_tag="cce_0280"
FT   CDS_pept        complement(272929..273756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0280"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49631"
FT                   /db_xref="GOA:B1X0Z0"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49631.1"
FT                   /translation="MNRNKRMKVFDCLKETKALRVRDGKIVPFWPNSQSYSRLLIMIFS
FT                   QLGDFDTLEYAWWLNQKSSELMANNILVQAIGIGNRESGLKFCDYTSFPQENLFVDPDA
FT                   NIHKTLGLYEGLSWNIPGLNEGQNAWVNLMLMCAGIASKGTLKEVLRGYTGDKKAPQLI
FT                   TDQEVVDTKLLPPLKGSFFNLAGGKGFQRPFELATLRLRNMTEVLSNWKTYVPNGAYLT
FT                   QRGATFLFDQKGNLLYEHRDQGILGFAENMSNPLGFLSLNSEPVLNSVNIDQE"
FT   gene            273909..274400
FT                   /locus_tag="cce_0281"
FT   CDS_pept        273909..274400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0281"
FT                   /product="unknown"
FT                   /note="contains DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49632"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49632.1"
FT                   /translation="MEHKRRKEEQKPSLIIGWREWLDLPELGIAEIKAKIDTGARTSAL
FT                   HAFHVKEFQKNGQKMVHFQVHPYQKDTHNTVTCEAEILEWRHVTNSGGHQQYRPVILTP
FT                   IEIAGQVWKIELTLTNRDVMGFRMLLGREAVRQRFLVDPGASFLLSDSKIKRHKKTAHS
FT                   "
FT   gene            274498..275292
FT                   /gene="hisF"
FT                   /locus_tag="cce_0282"
FT   CDS_pept        274498..275292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="cce_0282"
FT                   /product="imidazole glycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49633"
FT                   /db_xref="GOA:B1X0Z2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49633.1"
FT                   /translation="MLAKRILPCLDVNAGRVVKGVNFVDLQDAGDPVELAKVYNDAGAD
FT                   ELVFLDITATHEQRDTIIDVVYRTAEVVFIPLTVGGGISTLEQIKLLLRAGADKVSVNS
FT                   SAVKNPSFINQASDRFGKQCIVVAIDAKRRNDPNRPGWDVYIRGGRENTGLDAVKWAVE
FT                   MEKRGAGELLITSMDADGTQAGYDLDLTRTIAEQVEIPVIASGGAGNCQHIYEALTEGK
FT                   AEAALLASLLHYGQLTIAEVKNYLSHRKIPVRSSLEHTFRKP"
FT   gene            275365..275556
FT                   /locus_tag="cce_0283"
FT   CDS_pept        275365..275556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49634"
FT                   /db_xref="GOA:B1X0Z3"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49634.1"
FT                   /translation="MLIPILIFDVALVAWSLHLMQEAIEQQEFSLMLAGTLVALAAAAM
FT                   LVVYFLMGHCLTYLTTVA"
FT   gene            complement(275613..275710)
FT                   /gene="ffs"
FT                   /locus_tag="cce_RNA004"
FT   ncRNA           complement(275613..275710)
FT                   /gene="ffs"
FT                   /locus_tag="cce_RNA004"
FT                   /product="signal recognition particle RNA"
FT                   /note="Rfam score 62.81"
FT                   /inference="nucleotide motif:Rfam:RF00169"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(275747..276043)
FT                   /gene="gatC"
FT                   /locus_tag="cce_0284"
FT   CDS_pept        complement(275747..276043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="cce_0284"
FT                   /product="glutamyl-tRNA (Gln) amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49635"
FT                   /db_xref="GOA:B1X0Z4"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X0Z4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49635.1"
FT                   /translation="MLDRQQVQKIAHLARLDITSEEEEKFADQLSDILDYFEQLSELDT
FT                   ENVPPTTRAIELSNITRQDSFELYHDRDALLNEAPNPEGDFFRVPQILNTDEE"
FT   gene            complement(276217..276738)
FT                   /gene="ycf3"
FT                   /locus_tag="cce_0285"
FT   CDS_pept        complement(276217..276738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf3"
FT                   /locus_tag="cce_0285"
FT                   /product="photosystem I assembly related protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49636"
FT                   /db_xref="GOA:B1X0Z5"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022818"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X0Z5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49636.1"
FT                   /translation="MPRTQRNDNFIDKSFTVMADIILKMLPANKKAKEAFVYYRDGMSA
FT                   QADGEYAEALDNYYEALKLEEDANDRSYILYNIGIIHASNGEHAKALDYYEQAVDLNPQ
FT                   MPSALNNIAVIYHYQGEKAKSEGNTNEAEALFDKAAEYWKQAIRLAPNNYIEAQNWLKI
FT                   TGRSEMDVFF"
FT   gene            complement(276901..277725)
FT                   /locus_tag="cce_0286"
FT   CDS_pept        complement(276901..277725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0286"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49637"
FT                   /db_xref="GOA:B1X0Z6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49637.1"
FT                   /translation="MMNQKSLIQRFGLYLLLTVIAVAMLFPLLWLLSTAFKSPNEDIFT
FT                   TWLPTQPTWENFRIVWQTYPFGRYLGNSTLIAVLTVGLNLLFCSLAAYPLARLNFWGRD
FT                   SIFAAVIATIMIPFQIVMIPLYILTVQLGLRNTYLGVIFPSLASAFGIFLLRQAFQGVP
FT                   KELEEAARIDGCSELGIWWHIMIPSIRPALVTLAIFVFIGSWSDFLWPLIVLDRPEYYT
FT                   LPLGVAKLASALDLDWRLIAAGSIISIVPVILLFVFLQRYIIPTETGSGVKG"
FT   gene            complement(277792..279153)
FT                   /locus_tag="cce_0287"
FT   CDS_pept        complement(277792..279153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0287"
FT                   /product="CemA family protein, probable integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49638"
FT                   /db_xref="GOA:B1X0Z7"
FT                   /db_xref="InterPro:IPR004282"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X0Z7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49638.1"
FT                   /translation="MKFRSLIKKTSNWLTATPERSLDNAYKAALKIKEIEDNHFGGKKV
FT                   SKENADYGDSVISYFKTEVNGYLQKINMGLGVFKTSRLFLNISNIQELPQERPTERELQ
FT                   KNATTAAIIFEKLEFIDQVASKYQSRDTQEVYNGSLVLAKESSQDKETQTLDNKSTNQT
FT                   NSKLSNNNKISSGQNDSRLESASQKTGVLPRSFINTLNKIKQEIDPKSGESEEQVLNKY
FT                   RKSRLRTALSIKFILLLIIVPLLTHQLTKTFLLTPIIHQYFQNHEQVVFINKDLEEEAF
FT                   EELSHYEEILRFQGLIGLREPLTDEEVEEKVQEKAREITEEYRAQGIDSIGNVFADLFS
FT                   VTAFAIVIVSSRKEIEVLKSFLDEILYGLSDPAKAFLIILFTDMFVGFHSPHGWEVILE
FT                   GVARHFGLPENQEFNFLFIATFPVILDTVLKYWIFRYLNRISPSAVATYKNMNE"
FT   gene            279256..281424
FT                   /locus_tag="cce_0288"
FT   CDS_pept        279256..281424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49639"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49639.1"
FT                   /translation="MSVKRTSLWIEGTSRTGKTTELVREFCDWVENKRQEKTTSSVQSV
FT                   TQNLASSLLVFSANDDNRRDLADQLSFAVRGNYPIHCKTLMGWMRDEIKLFWPLLFEEL
FT                   SLKAQFPLLLRPETEQFLATQLWRYICTSNRGAYFDQYPAALTQNNEFRFVRQTLDLLQ
FT                   LAGASGIMVEHIPYILEHGLEGGDQFLEELNNSEEGTSFGQLRGHFILEWQKWCLKRGF
FT                   LTYGLIYTLYWRYLLPNPQYQHHLISRYQGIFADDVDDYPGIAKDLFQFLLDHNAFGIF
FT                   TYNPDGQVRLGLNADPQYLSQLSSFCEVKLLANYPRIQSNYGETIVRLATNPLSVENLP
FT                   DCFTSVQAISRAELLRNTANFIVDAIKNKQINPEDVAIIAPGLDEIARYTFIEILSAAN
FT                   IPLKPLNEQRSLISFPLVRALLTLLGLVYPGLGKLFRGDDIAQMLTTLSYDTDQKTAII
FT                   DPVRAGLIADSCYEIKFKTSQLLPIETYPRWDRIGHQATEAYNYLVHWIKETQAQIKQD
FT                   QLSSPMMVLDKAIKELIEVKYQLSYQQLSALRELTETTQHFWEIDRRLRQYDPDPKSPQ
FT                   ETLIEFIQLLQRGTITANPRPMYYLGKQPSYVTLATIFQYRSLRPCHRWQFWLDVSSNL
FT                   WEKGGASVLFCALLFLREWSGRTLTPEDEFEADQARLQRILRDLLGRVEEKIILCHSDL
FT                   SVKGTEQTGPLLTLVNGSQEIELITNNK"
FT   gene            complement(281433..281801)
FT                   /locus_tag="cce_0289"
FT   CDS_pept        complement(281433..281801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0289"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49640"
FT                   /db_xref="GOA:B1X0Z9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1X0Z9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49640.1"
FT                   /translation="MPTILLADDSTAQRELIAGLLTDNGFSVTTAMDGAEALEKLKSLA
FT                   PDLIILDVVMPKLNGYQTCRSIKSDPKTEHIPVILCSTKNTQVDSYWGLKQGADAYIIK
FT                   PFPHEELLGTVKQLLRNS"
FT   gene            complement(282035..282217)
FT                   /gene="rps21-2"
FT                   /locus_tag="cce_0290"
FT   CDS_pept        complement(282035..282217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps21-2"
FT                   /locus_tag="cce_0290"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49641"
FT                   /db_xref="GOA:B1X100"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B1X100"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49641.1"
FT                   /translation="MTQVVVGQNEPIESALRRFKRQVAKAGIYTDYKKHQFFETPQEKR
FT                   KRKEATRRRQRSRRH"
FT   gene            complement(282358..284520)
FT                   /locus_tag="cce_0291"
FT   CDS_pept        complement(282358..284520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0291"
FT                   /product="unknown"
FT                   /note="contains a heat shock protein DnaJ, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49642"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR025344"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B1X101"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49642.1"
FT                   /translation="MRIPLDYYRILGIFPQVTDEQLRQAYRDRSIQLPRREYSNQAIQS
FT                   RRQLLEQAYGVLSNPAQKAKYEAQFWQDQASYQEAGESPSPRSATEAVSESSPLTTAEI
FT                   DIEPEQLTGSLLILHELGEYELVIKYGESYLQTLPTSSLSLDIDDTATKHRTDTILSIA
FT                   LAYLEISREQWHQQAYEPAALAGTQGLTLLEKNNLFPSIQTEIRAELHKLRPYRILELL
FT                   AAPLKNTVPRQTGIKLLQSMLEERQGIDGKGDDHSGLGIDDFLRFIQQIRTYLTAEEQK
FT                   DIFIEEAQRPSSVAAYLGVYALIAQGFAQKQPSLILEAKTVLEGLEPRQDVSIEQSIVA
FT                   LLLGQTQAAAQALERCQDQQALKFIRENSQGAPDLLPGLCRYGEHWLQTEVFAHFRDLK
FT                   EKTASLKEYFADQDVQTYLNQLLTPSPPKPQGVMNPEKNPPSRSRLHNNRRYPRYQPLE
FT                   QGNAALDPVSLPVRSLSPIDIRDVRRRKRKQYAPKPDPQPIRETVLEQSPNRKPASTQT
FT                   VPLAKTLPTRPPRRSPKVGLTAVAIVGGVGLIGLGITWMSKANSPLSALEKGQYSVSLH
FT                   QPLIDIPSADAQMVTATGMLTLEGAQQVVETWLSSKSQAFGQSHDIESLKTILANPLLS
FT                   RWQRQAQQLQQNQNYWTYKHQVQVNSFKPSTNNPNQAVVDANVQESAQYYQGGRVSRSY
FT                   NDNLRVRYDLIRQGDRWLIQGINVIN"
FT   gene            284872..285903
FT                   /gene="pdhA"
FT                   /locus_tag="cce_0292"
FT   CDS_pept        284872..285903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="cce_0292"
FT                   /product="pyruvate dehydrogenase E1 component alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49643"
FT                   /db_xref="GOA:B1X102"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1X102"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49643.1"
FT                   /translation="MVSERTLPEFNTTSIQLTQEEGLMLYEDMTLGRLFEDKCAEMYYR
FT                   GRMFGFVHLYNGQEAVSTGIIKALRPDEDYVSSTYRDHVHALSCGVPPREVMAELFGKE
FT                   TGCSKGRGGSMHLFSEKHRLLGGYAFVAEGIPVATGAAFQSKYRREMMGDETADQVTVC
FT                   FFGDGASNNGQFFECLNMAALWKLPIIYVVENNKWAIGMAHNRATSQPEIYKKASVFDM
FT                   VGVEVDGMDVLAVRKVAQEAIARARAGEGPTLIEALTYRFRGHSLADPDELRSPDEKQF
FT                   WGSKDPIQRLEAYLIEHNLANQSELDEIKQKVQASVDDAVKFAEESPEPDPKELYRYVF
FT                   AED"
FT   gene            286126..287169
FT                   /gene="asd"
FT                   /locus_tag="cce_0293"
FT   CDS_pept        286126..287169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="cce_0293"
FT                   /product="aspartate-semialdehyde dehydrogenase, USG-1
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49644"
FT                   /db_xref="GOA:B1X103"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1X103"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49644.1"
FT                   /translation="MFKPVNVAILGATGAVGTELLELLESRNFPLNNLKLLASSRSAGT
FT                   HLKFKGESIKVEAVDEKAFDDVDLVLASAGGSTSKAWAQTIVDSGAVMVDNSSAFRMNP
FT                   DVPLIVPEINPEAAANHQGIIANPNCTTILMAVAIYPLHQVQPIERIVVSTYQSASGAG
FT                   ARAMEEVKIQSQAILKGEDPKAEILPYPLAFNLFPHNSPLTETGYCEEEMKMVNETRKI
FT                   FNTPHLKITATCVRVPVLRAHSEAINLEFKAPFSVAQAREIIAQSPGVQLLEDWQKNYF
FT                   PMPIDASGKDDVLVGRIRQDISDPNGLELWICGDQIRKGAALNAVQIAELLMEKSLLNI
FT                   AKSSLKV"
FT   gene            287227..288123
FT                   /gene="dapA"
FT                   /locus_tag="cce_0294"
FT   CDS_pept        287227..288123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="cce_0294"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49645"
FT                   /db_xref="GOA:B1X104"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:B1X104"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49645.1"
FT                   /translation="MSEQSFGKVITAMVTPFDNEGNVNYEMAEKLAVHLVDNGSDSLLL
FT                   CGTTGESPTLSWSEKSQLFQVVKKAVGSKGKVLAGTGANSTQHAVEMTEKVAKMGLDGS
FT                   LQVVPYYNKPPQDGLYEHFKKIAESVGNFPIMLYNIPGRTGQNMSPETIAKLAEINNII
FT                   AIKEASGNLEQACKIRRMTAPSFIIYAGDDFLTLPLLTVGGIGVVSVASHLVGTQIQQM
FT                   IAAFDNNQGSKATEINVKLFPLFKVLFCTTNPIPIKAALNLQGWQVGSVRLPLVELSET
FT                   LKEEVKVVLKELSLIEK"
FT   gene            288235..290004
FT                   /locus_tag="cce_0295"
FT   CDS_pept        288235..290004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0295"
FT                   /product="CHP_MG423-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49646"
FT                   /db_xref="GOA:B1X105"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:B1X105"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49646.1"
FT                   /translation="MSQTKKQSNLKIIPLGGLHEIGKNTCVLEYNDEIILIDAGIAFPT
FT                   EEMHGVNIVLPDMTYLRENRHKIKGMIATHGHEDHIGGIPYHLKQFDIPKIYGPKLAMS
FT                   LLKDKLEEAGVSDRTKLQTVSPREMVRVSPSFLVEFIRNTHSIADSFTIAIHTPLGVVI
FT                   HTGDFKVDHTPVDGEFFDFQKLAEHGEKGVLCLLSDSTNAEVPGSTPSESSVYPNLDRI
FT                   IAQAEARLMITTFASSVHRVNIILQLAQKHKRKVAVVGRSMLNVIAHARELGYIKCPDD
FT                   LFVSLKAANNLPDEQVLILTTGSQGETLAALTRISRGSHRHIKVRPGDTIVFSANPIPG
FT                   NTIAVVNTIDRLMMQGAKVIYGRHHGIHVSGHGCQEDHKLMLALTRPKFFVPVHGEHRM
FT                   LVKHAETAYKMGIPADNIVIINNGDIVEVSEDSIGVAGKVPSGIELVDQAGVVHEHVME
FT                   DRQQLAQDGVVTVAAAISWEGNLLTSPEVDLRGVVSKVEYSLIKQLIIRAIENILENRW
FT                   NEFASGDGKTEVDWDYLQEEIENTLQRLVKRELRSYPLVIFLLQTPEQPSRPEPTANRK
FT                   VYRRRRPTASTAS"
FT   gene            290155..290595
FT                   /locus_tag="cce_0296"
FT   CDS_pept        290155..290595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0296"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49647"
FT                   /db_xref="UniProtKB/TrEMBL:B1X106"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49647.1"
FT                   /translation="MKSVSLILLLTLGVFNVTVTQAQDPPAETYQPGYWQPVARFDTKR
FT                   IVEVNIINQTDIPIEFDLTDIEAMNPQALQPEETGNLKGFGNSANIVIYPLVNDATEFN
FT                   LRYKVNVDEDKNIVNVSVVKDKPSFLGHRSINLQKTGAIYLY"
FT   gene            complement(290608..290688)
FT                   /locus_tag="cce_RNA005"
FT   tRNA            complement(290608..290688)
FT                   /locus_tag="cce_RNA005"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA; tRNA-Leu2"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            complement(290770..292842)
FT                   /locus_tag="cce_0297"
FT   CDS_pept        complement(290770..292842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0297"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49648"
FT                   /db_xref="GOA:B1X107"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR019278"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR033415"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1X107"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49648.1"
FT                   /translation="MMSRSKSVLTQLLQIFPQWRPQMYFKASLTALSHAMEDQVLAGSE
FT                   QPLVIASFQRERFYRQEAQRYRRIAQKSNQVYVLAAPETDFKHRSQDYETVAFDTDDPL
FT                   AQEWHLIVLGTNYASCLICQEKSTAQNKEMTADMDNHRRFEGIWTFDRQVTQQAANILL
FT                   NTIVDYRPELENKVQQAYDQYIPLDILRGGSTKTEDVDNTTWDVTKNNPDPFVQRLVTY
FT                   LQAGQYKLIKANRSLATKEHKERLINSVTTAIRLSLDPDEILQIAVQKLGEGLGVCRCL
FT                   VYRCKETDATATIEHEFLNQGIPSIKGQTWPLRHNPLFQEVVELRDALTIDNATSDPRL
FT                   ANGKGETTSLGQSLQTLVSSCSILSWMLVPIFYRGRLLGMLELHHCGPKPITWKEEDVA
FT                   LVNAIATQIGVALIQAEAYANLQDLNEQLEALDRTRSNLVAITGHELRTPLSTIQVCLE
FT                   SLASEPDMSPELRQVMLNTALQDAERMRKLVQDFLTLSQLESGRVEWNIEALDLHECVE
FT                   LSLSNVRARHKETKLPNIENLVMEELPLVKADGEWLVEVLAKLLDNACKFTSEEGKITI
FT                   EVSCNSPHHLEVTVADTGRGIEPKRLETVFDRFYQEEGALRRSTGGTGLGLAICRQIVR
FT                   GWGGKIWAESQGKDHGSKFHFTIPIYIDQVQNQRSNQNIVSSSQTKEKARGKRKK"
FT   gene            293222..293962
FT                   /gene="rpaA"
FT                   /locus_tag="cce_0298"
FT   CDS_pept        293222..293962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpaA"
FT                   /locus_tag="cce_0298"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49649"
FT                   /db_xref="GOA:B1X108"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1X108"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49649.1"
FT                   /translation="MPRILVIEDDDAIRDLIATNLEMAGYDIKQAPDGIKGQALAVQLQ
FT                   PDLIMLDLMLPKVDGFTVCQRLRRDDRTADIPVLMLSALGQTQDKVEGFNAGADDYLTK
FT                   PFELAEMLARVRALLRRTDRIPQAAKHSEILNYGPLTLIPERFEAIWFEDTVKLTHLEF
FT                   ELLHCLLQRHGQTVSPSEILKEVWGYDPDDDIETIRVHIRHLRTKLEPDPRHPCYIKTV
FT                   YGAGYCLELPSSEQLPLSTDAAVV"
FT   gene            294119..295783
FT                   /gene="mutL"
FT                   /locus_tag="cce_0299"
FT   CDS_pept        294119..295783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="cce_0299"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49650"
FT                   /db_xref="GOA:B1X109"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X109"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49650.1"
FT                   /translation="MSPPIQLLSPEIVNLIAAGEVIDSLAAVVRELVENAIDAEATRLT
FT                   ISIVPELWQVTVADNGRGMSLENLRHCAKAHHTSKICDLDDLWKITSLGFRGEALFSIT
FT                   QVGQLTIKSRDATGYQVGWCVDYNQQGEIIKEQTSPMASGTIVTASNLFGTIPVRRQGL
FT                   PTIKQQLKAIQGMIDNMSLCHPQITWQVYHNHQSWLTISPGKTPQQILPQLLKSVHFHD
FT                   LQFLCETIITPSQEQAKLEMVLGLPDRTSRGRLDWLKIAVNGRVVRSPRLEQTILAGLS
FT                   RTLPKGRFPVSFLHFKIPPSEIDWNRHPAKTEIYLQSLEFWQEKVTEIIEKALKLSPLT
FT                   ITTVGQNQRVKKLLKASENKGVYNVGTSHVNELDLIKLRAVGQVNKTYIVAEHSQGLWL
FT                   VEQHIAHERVLYEQLQDQWQLIPVEQAIILTQLSTKQVEQLERIGIDIEPFGENTWAVR
FT                   NVPKLLENREDCPDALIELSLGGDLETAQVAVACRSAIRNGVLLDLAQMQDLLDSWKKT
FT                   RNPRTCPHGRPIYLSLEESSLSRFFRRHWVIGKSHGI"
FT   gene            295879..296229
FT                   /locus_tag="cce_0300"
FT   CDS_pept        295879..296229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49651"
FT                   /db_xref="UniProtKB/TrEMBL:B1X110"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49651.1"
FT                   /translation="MKIIFVYNANSGLMNTVLDIGHKIISPETYNCNLCNITYGILKEK
FT                   EEWKAFREASEHELEFLHKDEFEQKYKQARDYPIILMSNKKNELYELINKHELNKMEDV
FT                   QELIQNLKNSIK"
FT   gene            296345..297544
FT                   /locus_tag="cce_0301"
FT   CDS_pept        296345..297544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0301"
FT                   /product="unknown"
FT                   /note="contains glutathione S-transferase, C-terminal-like
FT                   and Thioredoxin fold domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49652"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B1X111"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49652.1"
FT                   /translation="MTTAPLSWTELETLTNWTIDNINGPTNSQAILRLFGHQESDIRVT
FT                   LYRDNHAWCPYCQKVWLWLEEKQIPYRIKKVTMFCYGQKERWYKKIVPSGMLPAVELDG
FT                   RLITESDDILLALETAFGPLTHSMKDANVIPLRQLERLLFRAWCTWLCYPTWSQTQEQQ
FT                   NREQFVKVVSMVEQALRNTPSPYFLEAFGTVDVIFTPYVERMNASLYYYKGYSLREENN
FT                   RLGQWFDGMETRSTYRGTQSDFHTHVHDLPPQMGGCYSNGEEQTKINQDRVDNGPWFGL
FT                   PDVMYAEPETSCQEALQRVIKHRHNIIRVNPGEDRMFDEALRCALTTMMTQESCQPPRG
FT                   SDVALRYLRDRINVPRDMSIYAGKRLREALETTASLVGDRQGIPIPIKHRRDQDPTNFI
FT                   "
FT   gene            complement(297616..298575)
FT                   /gene="cmpD"
FT                   /locus_tag="cce_0302"
FT   CDS_pept        complement(297616..298575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmpD"
FT                   /locus_tag="cce_0302"
FT                   /product="bicarbontate transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49653"
FT                   /db_xref="GOA:B1X112"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X112"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49653.1"
FT                   /translation="MGLKCLFLLLLDPFCIPLIRGTCHYSPYINTEKIMHTIKSKNPKV
FT                   LNLKPQPAMNHDFSVVIENVSKVYPTPKGPYTVLQDVNLTVKEGEFICVIGHSGCGKST
FT                   LLNMVSGFATPTHGSVLVNGKPVKKPGPDRMVVFQNYALLPWLTVFENVYLAVDAVHPN
FT                   KREAEKRSIVRDHLAMVGLTEAENKKPTQISGGMKQRVSIARALAIRPEVLILDEPFGA
FT                   LDAITKEELQEELLKIWNDHRCTVLMITHDIDEALFLADRLVMMTNGPAANIGEIMNIP
FT                   FPRPRDRDRIMEDPQYYDLRNYALDFLYNRFAHDDDAA"
FT   gene            complement(298541..300550)
FT                   /gene="cmpC"
FT                   /locus_tag="cce_0303"
FT   CDS_pept        complement(298541..300550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmpC"
FT                   /locus_tag="cce_0303"
FT                   /product="bicarbontate transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49654"
FT                   /db_xref="GOA:B1X113"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X113"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49654.1"
FT                   /translation="MGVFVAVDDIDKVFPLNDGGEYIALKGINLEIKKGEFISLIGHSG
FT                   CGKSTLLNMIAGLDLPTEGIVTLEGQKVKKPGPDKMVIFQNYSLLPWLTVYQNIALAVD
FT                   EVMAGYPAKERKEIIEKHIDLVGLRHAVDKLPKQLSGGMKQRVAIARALSIRPKLLLLD
FT                   EPFGALDALTRGNLQEQLMRICEQYQITSVMVTHDVDEAVLLSDRIVMLTNGPGSNIGG
FT                   ILDVDIPRPRKRMEVVNHPSYYSLRSEIIYFLNQQKRIKKLRAKKTDAIARHGLEKVNL
FT                   EIGFVPLTACAPLIVAQERGFFAKHGLDEVNLVRESSWRGVVDGIAGGYLDGAQMPAGM
FT                   PTWLTAGGHQETPLPIVTALTMTRNGNGITLAQSFYEQGVSNVNELRRMLLESTEKRHI
FT                   FGMVHPSSMHNLLLRYWFAAGGIDPDQDVQLETIPPAQMVADLKAGTIDGYCVGEPWNI
FT                   RAATEGVGFTVATDLEIWQGHPGKVLGVRENWANTHPNSHIALVKAILEGCQYCADPAN
FT                   HEEIRQLLASRKYLSTNPEYIQLGDPKNYTCNIEKPVEYAHHMFFGEGMNRPSRTEHLW
FT                   MMTQMARWGHIPFPRNWVEILERVCRVSVFSTAARELGMIDIKYRREPIKLFDGITFDA
FT                   EDPVNYLNELAIKQNFTMAEVHLDGVKMPVPIAA"
FT   gene            complement(300633..301475)
FT                   /gene="cmpB"
FT                   /locus_tag="cce_0304"
FT   CDS_pept        complement(300633..301475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmpB"
FT                   /locus_tag="cce_0304"
FT                   /product="bicarbontate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49655"
FT                   /db_xref="GOA:B1X114"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1X114"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49655.1"
FT                   /translation="MTATTRMRPNRVKNQNPLLTFWDKNKGEILPPIVGVLGFLAVWQL
FT                   ISMTGLIKLPPPSSLWTDERTRILLMYPFYDRGGLDKGLFWQTLASLGRVAQGYSLAAL
FT                   IGISVGILVGTQPLINKALDPLFQFLRMVAPLAWVPIALVALQQNQPAAIFVIFITAVW
FT                   PILINTTEGVKQIPQDYINVQQVLQLSNKKFFFKILLPSALPYIFTGLRIAIGLAWLAI
FT                   IAAEIVMSGIVGIGFFIWDAYQQNYISEIILAVVYIGAVGLLLDRGIAYLQKVIAPGE"
FT   gene            complement(301515..302876)
FT                   /gene="cmpA"
FT                   /locus_tag="cce_0305"
FT   CDS_pept        complement(301515..302876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmpA"
FT                   /locus_tag="cce_0305"
FT                   /product="bicarbontate transport system substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49656"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B1X115"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49656.1"
FT                   /translation="MMSNFSPVTRRKFLRTSALSAAGAILLKGCAGNPPEPGGTNASTT
FT                   QGVADISPEMQPETTAIKLGYIPIVEAAALVVAKEQGFFAKYGMTDVELSKQANWASAR
FT                   DNVTIGSQGGGIDGGQWQMPMPHLITEGIITNGRKVPMYVLAQLNTQGNGIAVAPMHEG
FT                   KGVSLDISQAADYIKNFASTNGRKFKAAHTFPNVNQDFWIRYWFAAGGVDPDVDIDLLA
FT                   VPPAETVQGMRNGTMDAFSTGDPWPYRIIAEDIGYMAGLTSQIWQFHPEEYLAIRADWV
FT                   DKNPKATKALLKGLMEAQQWIDQNNNRAATVKILAGRNYFNVPVDILDAPYKGNYKMGD
FT                   GKAEVKDINMGPLYWKDGKGNVSYPYKSHDLWFLTETLRWGFHKDQISDLDTAQKIIDK
FT                   VNREDIWREAATEAGFTADIPASTSRGVETFFDGVTFDPENPQAYLNSLTIKRV"
FT   gene            complement(303504..304001)
FT                   /locus_tag="cce_0306"
FT   CDS_pept        complement(303504..304001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0306"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49657"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:B1X116"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49657.1"
FT                   /translation="MGANLEAIAGFNLEILIKISGYSYILNQIYMKSSYWQIEQLPGLS
FT                   QTHQEQLKSLGINNSQDLLKITKTKTNQQNLANRLKCQLQLISKWVALADLARVPSVGC
FT                   DYCGLILHSGIISVKQLAETSVSSLHRQILKLQVATLQRNDLCPSPDLVQTWINEAKII
FT                   SN"
FT   gene            304045..306009
FT                   /gene="thiOG"
FT                   /locus_tag="cce_0307"
FT   CDS_pept        304045..306009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiOG"
FT                   /locus_tag="cce_0307"
FT                   /product="bifunctional glycine oxidase/thiamine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49658"
FT                   /db_xref="GOA:B1X117"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1X117"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49658.1"
FT                   /translation="MNATNDIIIIGGGIIGMAIAVDLKLRGVSVTVCNRSFPQTASMAA
FT                   AGMLAPHAEALPPGPLLDLCLKSRWLYPEWIRKLQDITGLNLGYNPCGILAPVYDLPTA
FT                   DVRHNNKDQWLDKTAIRLYQPGLGDDVVGGWWYPEDGQVDNRQVMQALRQAAQQLGVTV
FT                   RDGVTVKTLQQKQGKVTSILTNQGELEGNTYIIANGSWASQILPLPVRPMKGQMLAVKM
FT                   PHPPDEPYPLQRVLYGPQTYLVPRQNGRLIIGATSEDVGWTPHNTPQGIEMLIKRATRL
FT                   YPDVANWEIEEFWWGYRPGTPDELPLLGHYGCNNLILATGHYRNGILLAPVTAFLIADL
FT                   VINQKSDPILDHFQGDRFHTQPSPPSASMTPFNHYPVPKTTNGHNGTSSLSPTDELVIA
FT                   GRKFHSRLMTGTGKYPSIPIMQQSVAASECQIVTVAVRRVQTNAPGHEGLAEALDWGKI
FT                   WMLPNTAGCKTAEEAIRVARLGREMAKLLGQEDNNFVKLEVIPDTKYLLPDPIGTLTAA
FT                   ETLVKEGFAVLPYINADPMLAKRLEEVGCATVMPLGSPIGSGQGIRTQANIEIIIEEAH
FT                   IPVVVDAGIGTPSEASQAMEMGADAVLINSAIALAKNPVLMAKAMGMATVAGRLAYLSG
FT                   RIPIKDYAIASSPLTGTVV"
FT   gene            complement(306083..306313)
FT                   /locus_tag="cce_0308"
FT   CDS_pept        complement(306083..306313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0308"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49659"
FT                   /db_xref="InterPro:IPR025477"
FT                   /db_xref="UniProtKB/TrEMBL:B1X118"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49659.1"
FT                   /translation="MLKVIQSPTQYTIDVIKGEAARLVRERRLHRRQPIYTLCKYIPAR
FT                   EWPNVECELERHDFLLRDSIIDLLSKEEWRD"
FT   gene            complement(306441..307076)
FT                   /gene="hisH"
FT                   /locus_tag="cce_0309"
FT   CDS_pept        complement(306441..307076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="cce_0309"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49660"
FT                   /db_xref="GOA:B1X119"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1X119"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49660.1"
FT                   /translation="MFMGFLAVIDYDMGNLHSACKGLEKAGIQPKITDSPQDIAEAEAI
FT                   VLPGVGSFDPAVQHLRSRHLEEPIKQAIAAGKPFLGICLGLQILFEGSEEGKEPGLGII
FT                   KGKVRRFQSEPNLTIPHMGWNQLQFTQSNLSLWQGLTPDPYVYFVHSYYVDPVDPNVNA
FT                   AVVTHGSQTVTAAIARDNLMAVQFHPEKSSDNGLQILSNFVTMVKQNS"
FT   gene            complement(307134..308321)
FT                   /gene="aslB"
FT                   /locus_tag="cce_0310"
FT   CDS_pept        complement(307134..308321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aslB"
FT                   /locus_tag="cce_0310"
FT                   /product="putative arylsulfatase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49661"
FT                   /db_xref="GOA:B1X120"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026357"
FT                   /db_xref="UniProtKB/TrEMBL:B1X120"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49661.1"
FT                   /translation="MTTHLSINSNENGSIDVSSFGPINLVVIQPTPFCNLDCDYCYLPN
FT                   RNLKEKLSLDLIEPIFKAIFTSPFVGEFIDICWHAGEPLAVPISYYQEVFKRIDIANQK
FT                   YNIKQVPIYHSIQTNGILINQAWCDFFKENNICVGVSIDGPDFLHNTHRKTPTGLGTHE
FT                   SVMRGIRYLQENDIYFNIIAVITQESLDYADEMFNFFWENGITDVAFNMEEIEGINETS
FT                   SLDKVGTEKKYYQFIKQFWELTSQTNDQFKVREFEAICGLICDNQRLSKTDMNHPFAIL
FT                   NIDYLGNFSTFDPELLSVDIKPYGNFILGNVLTDSLESVCDSKKFKQIYKDMLEGVNSC
FT                   RQSCDYFGVCGGGAGSNKYWENDSFNSTETQACRYRTKIVTDVVLEALENSFGIN"
FT   gene            complement(308430..308828)
FT                   /locus_tag="cce_0311"
FT   CDS_pept        complement(308430..308828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49662"
FT                   /db_xref="InterPro:IPR026356"
FT                   /db_xref="UniProtKB/TrEMBL:B1X121"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49662.1"
FT                   /translation="MQITTKITCVGFLLAVSTLTASIAKSQALLSDNNLTIESRLSRLT
FT                   EAIQQRGIDIAPETNNDLIGLGWGNGRGGSWGNGYRGGFANRHGGGGFVNRNPWRNGGG
FT                   FVNGRPWGDRGGFYNRSPWRNGGFINRW"
FT   gene            complement(308896..309252)
FT                   /locus_tag="cce_0312"
FT   CDS_pept        complement(308896..309252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49663"
FT                   /db_xref="InterPro:IPR026356"
FT                   /db_xref="UniProtKB/TrEMBL:B1X122"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49663.1"
FT                   /translation="MIITNKITFMGFLLAVSTLSVSVATANSQKPINAKVSNNIEYRLS
FT                   RITKAIEKGDIETTNSLPTEAENLLTRGFANRSGGGGFANRGGGGGGFVNRGGGGGFVN
FT                   RSPWPNGGSFYNRY"
FT   gene            309350..310297
FT                   /locus_tag="cce_0313"
FT   CDS_pept        309350..310297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0313"
FT                   /product="putative extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49664"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR026358"
FT                   /db_xref="UniProtKB/TrEMBL:B1X123"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49664.1"
FT                   /translation="MTKISNNSTVSFCIKGKIMYKKMPLVALSLMAMLTLPNKSLAETV
FT                   IERVARTGVLNVSTRVDLVPYAYVNDEDELVGYSVELIELIRETLAQEIGKDVQIKVIV
FT                   DDSLDERISSLLNREVDIACDTTFTWQRDRFVDFSLAYGVSGIKVFVKEDSNLSSPDSF
FT                   KNKRIAIIESVLSPESIKVIESQVTVVDVDSIEAGIKAVEDGEVDGFAFDGTILEGTRQ
FT                   TLTNPNAYKVVPDESYFKHGIACMVPEQDSTFLNLVNLTIGKLMDGYIRGDSRYVEMVN
FT                   RYFGEEGIVPFEPARIKDFFEIIIITREQIPPEQ"
FT   gene            complement(310299..311099)
FT                   /gene="panB"
FT                   /locus_tag="cce_0314"
FT   CDS_pept        complement(310299..311099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="cce_0314"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49665"
FT                   /db_xref="GOA:B1X124"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1X124"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49665.1"
FT                   /translation="MADFGNIMGLTTQQLITWKQQGRPIVALTAWDFAFAQLLDAAGID
FT                   IILVGDSLAMVALGYETTLPLTLDAMSHHAAAVRRGVKRALVVCDLPFLSYQESISQAI
FT                   HAAGRVLKETGVQAVKLEGGHPTAIETVARLSDIGIPVMGHVGLTPQSVHRLGYRQQGT
FT                   TESEAERILSEAIALSEAGAFAVVLEHIPANLARIITAKLPIPTIGIGAGSDCDGQVLV
FT                   TADLLGLSEKQPPFAKTYLNLRDIVTKAVSDFSQDVRDKKFPEN"
FT   gene            complement(311160..311879)
FT                   /gene="chlM"
FT                   /locus_tag="cce_0315"
FT   CDS_pept        complement(311160..311879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlM"
FT                   /locus_tag="cce_0315"
FT                   /product="magnesium-protoporphyrin O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49666"
FT                   /db_xref="GOA:B1X125"
FT                   /db_xref="InterPro:IPR010251"
FT                   /db_xref="InterPro:IPR010940"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1X125"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49666.1"
FT                   /translation="MCLKTNLPESMNTTTDDKTIVKDYFNATGFDRWRRIYGDGEVNKV
FT                   QKDIRLGHQQTIDTVVAWLKADGNLANLSICDAGCGVGSLSIPLAQEGAKIFASDISEK
FT                   MVTEAQERAQKALKDASNVTFAVQDLESLTGNYHTVICLDVLIHYPAEDAEKMIKHLAS
FT                   LSESRLILSFAPKTLCLTLLKKIGEFFPGPSKTTRAYQHKEKDIIQILEQNGFTIQRKD
FT                   MTSTRFYYSRILEAVKE"
FT   gene            complement(311913..312638)
FT                   /locus_tag="cce_0316"
FT   CDS_pept        complement(311913..312638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0316"
FT                   /product="probable serin-threonin phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49667"
FT                   /db_xref="GOA:B1X126"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1X126"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49667.1"
FT                   /translation="MMNRRFTGLTDPGLLRSVNQDNYYIDPEGRFFVVADGMGGHAGGQ
FT                   EASLIATQRIKEHLEQYWESEASSHDILEEAILKANEGILEDQQNHPERGEMGTTAVVV
FT                   LFRGEQPLRAHVGDSRLYRIRDGKLEQITEDHTWVARALKMGDIDPEQAKTHPGRHVLF
FT                   QCLGRKDTQKPEIGTLEIQPGDRLLLCSDGLTEEVADPAIQEIFDHSESCDDIAKNLVE
FT                   AAKDGGGSDNITVVVVVEE"
FT   gene            complement(312891..314645)
FT                   /locus_tag="cce_0317"
FT   CDS_pept        complement(312891..314645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0317"
FT                   /product="unknown"
FT                   /note="contains an ABC-1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49668"
FT                   /db_xref="GOA:B1X127"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1X127"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49668.1"
FT                   /translation="MSALSSNPQSSLVKKKGASVPRSITQLETAEKYRWNRENYSITRR
FT                   RFDIWRFVLSLLFRFWRNGKKWSYQGGFTEEKLAARRKIQAVWIRENLLNLGPTFIKVG
FT                   QLFSTRADLFPVEYVEELSKLQDEVPAFTYEQVSKIIEKDLGKSLSKLFRNFDPVPIAA
FT                   ASLGQVHKAKLHSGEEVVVKVQRPGLKQLFTIDLAILKKIAYYFQNHPRWGKGRDWIGI
FT                   YEECCKILWQETDYLNEGQNADTFRRNFRGENWVKVPRVYWRYTSPRVLTLEYLPGIKI
FT                   SHYEGLEAAGLDRKLLAKLGAKAYLCQLLNDGFFHADPHPGNIAVDTDGSLIFYDFGMM
FT                   GRINTNVREKLMDTLFGIAQKDGDRVVSSLVALGALSPTDDMGPVRRSVQFMLDNFMDK
FT                   PFEEQSIAEISDDLYEIAYDQPFRFPATFTFVMRAFSTLEGVGKGLDPNFNFMEVAQPF
FT                   ALDLVADMDGNTSNSIIDEITRQATKVSNTALSLPRRIDDTIEKLDRGDIRLRVRSVES
FT                   DRLLRRLGMMQMATNYSVFLSALVICGTLLFINGYIKIGVVVILLGLVPGWAFIRLLRR
FT                   INRLDNMF"
FT   gene            complement(314709..315032)
FT                   /locus_tag="cce_0318"
FT   CDS_pept        complement(314709..315032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0318"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49669"
FT                   /db_xref="InterPro:IPR040003"
FT                   /db_xref="UniProtKB/TrEMBL:B1X128"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49669.1"
FT                   /translation="MSNPVLHAFFLGRAFAEVLTEKAEESLTNALSELGKFDAEQRENL
FT                   REFIEEVQLRAEREATKGNTSTTTTTTTDNGSSVDLQETIDDLRAEIARLKAELKNYRS
FT                   TKA"
FT   gene            315216..315297
FT                   /locus_tag="cce_RNA006"
FT   tRNA            315216..315297
FT                   /locus_tag="cce_RNA006"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC; tRNA-Leu3"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            315802..317571
FT                   /locus_tag="cce_0319"
FT   CDS_pept        315802..317571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0319"
FT                   /product="putative S-layer OprB family
FT                   carbohydrate-selective porin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49670"
FT                   /db_xref="GOA:B1X129"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:B1X129"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49670.1"
FT                   /translation="MILMLKLLLTQTVSPVIIGLFFATQPAIASTDRNENLDIVAPTEA
FT                   LEIIRNRPQLQTPLNRDTSKQFKDAGSQPSMSQVTNVGELRDISPTDWAYEALRSLVER
FT                   YGCIVGYPDRTFRGNRALSRWEFAAGLNACLNTIERLIQENVAVLREDIEKLKRLAQEF
FT                   EQELIALGARVSNLEERVAFLEDHQFSTTTKLNGEVIITISDAWGERALDFREQDLFNQ
FT                   GLLERRRIDDNGVIGHRSRYNFDTSFTGEDLLKTRFESGTIVNWSDPTGTEMARLGHDS
FT                   DSGSDTFIDDVYYRFPIGNLTTWVGANSLDIDDIFDVGNPLLFAEESGALSRFIRYNPI
FT                   TFRGPEGKGIGINYAFNDVFILRGLYLSDTANDPSLGNGLFNGNYSTGAQLGVYPTDAL
FT                   SFTFTYLHSYFAAGNSDVSSSTGSYVEPDNQTPQTGQGIAKDPFLGAPTIRDSYGITGN
FT                   WRINETFNFSAWGGYALARAQGLDAEGNSRKGFGSDVWAWSASLSMVDIGKEGAVLSIA
FT                   GGSITNSRRIDAITGDLTVPDQDTPYIIETQYRYPLNDNILLTPGVFVILQPDGNNENN
FT                   SIWVGALRTTFTF"
FT   gene            complement(317642..318625)
FT                   /gene="por"
FT                   /locus_tag="cce_0320"
FT   CDS_pept        complement(317642..318625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="por"
FT                   /locus_tag="cce_0320"
FT                   /product="light-dependent protochlorophyllide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49671"
FT                   /db_xref="GOA:B1X130"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR005979"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1X130"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49671.1"
FT                   /translation="MGVSIHMVENHKSTVIITGASSGVGLYAAKALADRGWYVVMACRN
FT                   QPKAHQAAQSVGIPLDSYTVMQIDLGSLDSVRQFVKDFRATGKSLDALVCNAAIYMPLL
FT                   KEPLRSPEGYELSMTTNHLGHFLLCNLMLEDLKRSPAPEKRVVILGTVTHNPNELGGKI
FT                   PPRPDLGNLEGFADGFKEPVSMIDGKKFEPVKAYKDSKVCNVLTMRELHRRYHDNTGIV
FT                   FTSLYPGCVADTPLFRNHYPLFQKIFPWFQKNITGGYVSQELAGERVADVVTKPEYGQS
FT                   GSYWSWGNRQKKDRKAAFVQKVSPQAQDEAKAERMWELSEKLVGLP"
FT   gene            319002..319310
FT                   /locus_tag="cce_0321"
FT   CDS_pept        319002..319310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49672"
FT                   /db_xref="UniProtKB/TrEMBL:B1X131"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49672.1"
FT                   /translation="MYIAKNQVFLPKPKKSFFLKLSKYFRLLFPNKPMYHEHIEKTTGA
FT                   KQMNFNNTFAAILTIALTAGLNISAMANVPTEQENQKENNNPITETTQPQWCFPGRC"
FT   gene            319467..322166
FT                   /locus_tag="cce_0322"
FT   CDS_pept        319467..322166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0322"
FT                   /product="hypothetical protein"
FT                   /note="contains a filamentous haemagglutinin, N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49673"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B1X132"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49673.1"
FT                   /translation="MMSNNNDQYLCKKQIVLTGLNLIILKHLSFFSVASAQVFEDGTVN
FT                   TQVTSTNNQLVISGGTEKGNNLFHSFEQFSIPNNIEAYFNNSDNINNIISRVTGNSISN
FT                   IEGIIRANGTANLLLINPNGITFGPNSQINIGGSFLATTAENITFADGVQFGAINAQPN
FT                   SLLTMSVPVGLQFGSNPSPIRNQGNILGIKPGNTLALVGGDLIFSGSNLLVSDLQVELG
FT                   SVGSHSNVQIRNNEAGFQVGYQTVKNFQDISLSQESQLVAFNSTFNLQGRHITLDQSII
FT                   VSVTQGSQVAGDINVNASKSVELIGLKNSEFTTGFLAQVEEGATGRGGNLLINTQKLII
FT                   QDGAGLSAGSRGEGQAGTLMINASELVELTGTGFFSPSLLTTSTDSLGDGGEIEINTKQ
FT                   LIIRDGGSIEAFTLGNGQGGTITINASELVQISGSGIIGATQTETSSQITTSSGLQDVG
FT                   LGIAPGGNLSINTEQLKVTNGGIVNAGSLGSGNAGNVNIRANSIFLDNQGIITASSEGT
FT                   GNAGNLTINTDQLTVNERSEVAVRSIGTGEGGNLTLNAQSISLDDKSRLTATSEALDPE
FT                   IALELGLDPEVLELDNGLANAGSLNITTDNLRVNDDSEVTVSSFGLGNAGDINIRATDI
FT                   LLDNSSRLSAETASGEGGNISLDVAQFLTLRRGSTLSTTAGTTGGLGNGGNIDINALFI
FT                   IAVPTENSDIIANAFLGRGGNINIDAAGVFGIEERERLTPLSDITASSQFGQVGNIGIN
FT                   RPDVDPQRSLVKLPDEVVDTNNVIVDACRPGGALTRGEFTITGRGGLPSNPNEGVDNPT
FT                   GLTELGYPTNTDSSNFVPSEQNRSSPAPEVYTNQNETYTPTIVEAQGWIINADGNVVLT
FT                   AQASTVTPHSPGLSPATCYDLSNRNSSP"
FT   gene            322135..323865
FT                   /locus_tag="cce_0323"
FT   CDS_pept        322135..323865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0323"
FT                   /product="hypothetical protein"
FT                   /note="contains a bacterial surface antigen (D15) and
FT                   Polypeptide-transport-associated, ShlB-type domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49674"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B1X133"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49674.1"
FT                   /translation="MICQTVTRLPNLLCCSFCFLCLSGGFTAKLTAQSFDNSPIPPTSV
FT                   PELPQPVPLPETPLKPPTVSPVPTEEVSPNIPGTITVKQFRFEGNTAFDTEELTKVIEG
FT                   FIDRPLTFAELLQARSAITQYYIDRGYVTSGAYIPPQTIENGIVAIKIVEGQLEDIQVT
FT                   VEGKLNPNYVRDRLGLGGQTPLNIPRLVESLQLLQLNPVIDSISAELTPSPRPGNNILV
FT                   VNVVSARSFYPSLIFDNGRNPQVGEIRRGFNLAERNLLGLGDKAEFSYFNTDASDDVEV
FT                   TYQVPVNVYNGTIEVGYRSLTGEIIEEPLDILDINSDYQKYSLRFRQPIIQTPSQELTL
FT                   GLDIDHQKSKTLYLDGLAFPSRGSDTNGRTHISTIRFSQEWVGRSATQVLSARSEFDWG
FT                   IEAFGTTIPFDLQVNPDAPYSNYFLWRGQAQWVKLLADDTLFVLRSDMQFADRPIVSLE
FT                   QFSLGGIGNVKGYRQNSLLTDNGIFAGMELRFPVYRLPKDRFVVQIVPFLNYGQGWNSG
FT                   EEPDPPINELASVGVGLQVQYGDFFNARLDWANRLGKELFQGGDSLQDDGFFFTITISP
FT                   "
FT   gene            complement(323901..325058)
FT                   /locus_tag="cce_0324"
FT   CDS_pept        complement(323901..325058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0324"
FT                   /product="unknown"
FT                   /note="contains DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49675"
FT                   /db_xref="GOA:B1X134"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B1X134"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49675.1"
FT                   /translation="MARQGTFPLTDWLETHWTTPAFGGWLLAVLALCFFGAATNTMAGW
FT                   LYVLSGTILALLILSAILSLRSLSQIQVHRHAIQPVSAGDDLTIEVIIENKSKSPKTLL
FT                   QLWDIVPVVMEQPKNTAIEAIEPKGEYHWIYYLKTQQRGVYHWHEIELRSGSPLGLFWC
FT                   RRSQEVPAKAVVYPQILPLNHCPLIDTIGQEESDQKQSDRRFQGANEGVTKALRPYRYG
FT                   DPMRMIHWRTSAKYDEFQVRELEVITGGEDIIICLDSGSSWGNDNFEQAVIAAASLYFY
FT                   ASRAQLNVKLWTAKTGLIYGNRTVLETLAAVNAEEENQQHILPKIPLIWITQNPASFDN
FT                   LPSGSRWLLFPQESNKVSSFLTQRLIGLTINCEQSLQTQLQKIPQ"
FT   gene            325249..325818
FT                   /locus_tag="cce_0325"
FT   CDS_pept        325249..325818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49676"
FT                   /db_xref="UniProtKB/TrEMBL:B1X135"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49676.1"
FT                   /translation="MTTTIDARVKSVYKLAKTYPDNQQLQEAVGVVKTLRRSQGQLAFW
FT                   SEQHKIDKKQLKAEIITLSRENQALEVQIRLKVQDIDRLKSELTQINEQMTQLTEEKQR
FT                   MIAQRDRVIAQLKQIETEVELATIQVRQTNDLFKKFSIIWTLLQSLFFRDTRQGYGKID
FT                   NTLPDFKDKPQMGTSSADIGRDLLDK"
FT   gene            325840..326220
FT                   /locus_tag="cce_0326"
FT   CDS_pept        325840..326220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49677"
FT                   /db_xref="UniProtKB/TrEMBL:B1X136"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49677.1"
FT                   /translation="MSRFSELIEELEDLQQQDIKNSAKVFSITASLSTRLHQLLDAVET
FT                   SNKALPKSKITKEELIKRYGSYNNAYAAYKKAYGIKCKGWDRFLQAIEGLSPPTSLEER
FT                   VEKLEETVKLLVKILIENETKI"
FT   gene            326368..328827
FT                   /gene="recG"
FT                   /locus_tag="cce_0327"
FT   CDS_pept        326368..328827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="cce_0327"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49678"
FT                   /db_xref="GOA:B1X137"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B1X137"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49678.1"
FT                   /translation="MATGNPDWIRLDKALSIEADKGCTNLQGNQYQFNEFLCLNFGQSP
FT                   PTGTPTSDRRKWQNFAAQYADYSNLSVAQRKTLISQTRQFLYELRKTLETPRELPPPKL
FT                   PKTTAITDKKASLRPVTLDQSLNNLAEVGYKRGELLKRLGLHTVKDILFYYPRDHIDYA
FT                   RQVAISNLVAGETVTIVGTVKRCNCFTSPKNKKLSIFELILRDHTGHIKLNRFFAGTRF
FT                   TSRGWQERQKRIYPLGSIVAASGLVKQNRYGITLDNPEIEVLDSVGSSIESLKIGRVLP
FT                   VYPLTEGVGADLIRKAIIASLEAIKQIRDPLPRVLREQYGLMGLKDAIGNIHFPETPEL
FT                   LAHARRRLVFDEFFYLQLGFLQRRQEQKQVHNSAVFTPQGKLIKQFDDILPFKLTNAQQ
FT                   RVINEILEDLNSVTPMNRLVQGDVGAGKTIVAVFAILAALQSGYQAALMAPTEVLAEQH
FT                   YRKFIPWFNQLYLPVELLTGSTKKAKREEIHRQLQTGELPLLVGTHALIQDPVNFQKLG
FT                   LVVIDEQHRFGVQQRAKLLAKGKSPHVLTMTATPIPRTLALTLHGDLDVSQIDELPPGR
FT                   QAIQTTVLTGKERTQAYDLIRREVAQGRQVYIIFPMIEESEKLDVKAAVEEHKKLSEKV
FT                   FPDFKIGLLHGRMSSTAKDEVLTAFRDNEYQIIVSTTVIEVGVDVPNATIMLIENAERF
FT                   GLSQLHQLRGRVGRGSHKSYCLLMSSSKTPDVRQRLTVLEQSQDGFFISEMDLRFRGPG
FT                   TVLGTRQSGLPDFALASLVEDQEVLELARLAAEKIIVADQTLGSLPSLKKELETRYKKL
FT                   MGGEILT"
FT   gene            328984..330762
FT                   /locus_tag="cce_0328"
FT   CDS_pept        328984..330762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0328"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49679"
FT                   /db_xref="GOA:B1X138"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B1X138"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49679.1"
FT                   /translation="MLKLLKILDYGLIRLVFYLLIAIGLVKFSIWLFKPLTLQIRPFDI
FT                   IKEETVQRGQGEWVARRLSEKIRRIQGKLTEELPKPQDESSLPVIAIPNPILASPIETP
FT                   LVPSDVQNSLPNPEFFRPFNFDIIGFINFFATLLQRGPILEGSVFIHNNIYEIVAEAYQ
FT                   QQWRVSAGSLEESLTSLAYAIVFNQLQKYPQENVTRFDNAEDFQSFMNARLEFETYLDD
FT                   QGLARQSRLDHRLEKAIEYLKPLTEKNSRSILPFSYLASIYTCLNAPERAVIMLREAKT
FT                   IDPQDSWVNATLDKVQSRLASQESTGQLGALNELSNQQAFELIRVQKAIAAAQKTNTEQ
FT                   PVKVAVLADGFFSSLKELNDRILASKSFVPDEEITQEASGHGTSIVALIAAIAPTAQII
FT                   PIKVLSSKGIGQDSWILEGLEYASQQKAQVLLLPLGNSSSESRPVYDAMIDRIKRKNVL
FT                   PIASTGVDRSEVPQFPATIPGMFVVGTINNQQQLASFSSYGSWVSLVAPGVDIKTIGKD
FT                   DKVQVVRGGSYSSAIVAGVAALVFSLQPDLSVTDVETILQQSAVTITTHLPENNQELKM
FT                   RRVDALNAVIKAISSR"
FT   gene            complement(331047..331934)
FT                   /locus_tag="cce_0329"
FT   CDS_pept        complement(331047..331934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0329"
FT                   /product="probable sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49680"
FT                   /db_xref="GOA:B1X139"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1X139"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49680.1"
FT                   /translation="MCGVPMESNFLSAVFLPLALFMIMMGMGLGLKITDFQRILIEPKG
FT                   VFWGLIAQLIILPLVGFLLAGVFSLTPELAVGVIILAACPGGATSNVISYLVRGNVALS
FT                   ISLTAIGSLVTIVTIPLVINLGMQTFMGTDTALQLPLSKTITQIALMILLPISLGMLLN
FT                   YYQPKLAAKLEKIVKWLSLSFLGLIIFGLLLKERATLLSSFLQVGGVTLSLNLVTMFLG
FT                   YAIGIMAKLDEKSTKTITVEVGIQNGTLAITIASVLLNSPTMAIPAGIYSLVMFVTSAG
FT                   FALLVRNRKVMSIQ"
FT   gene            complement(332230..333426)
FT                   /locus_tag="cce_0330"
FT   CDS_pept        complement(332230..333426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49681"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:B1X140"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49681.1"
FT                   /translation="MLDIAKLAGKIPGISHHFQQEMTASSQRLELAKTILQQAQNQQEA
FT                   LIERYQTWRDRLIFSAAMPVEPLDTRITIVPPPHRHSVFATDGSQIAPSHHEIAYCYLI
FT                   NVGRVMLHYGQNLHPLLDSLPEVYYRPEDLYVSRQWGIRTEEWLGYRRSVLEAQCLADM
FT                   ACGWVNPPGAHHEPNLAMVDGSLVYWFLDGLAHDARDLILVPIQEAWEQLKAARIPLMG
FT                   YLSASRSVEGVNFLRLHNCTFDTPNCIMNCVDVEEQQIPCKVIEPLRDTTLWGENLQPG
FT                   QRGPLWQSSARILELYDEAQRIYFCYVNVGTEIARIEVPGWVAEDQDLFNQGLGIMLAQ
FT                   VNKGFGYPVALAESHNQAVIRGGDRIRFFALLEQQMIRAGLQNVGTSYKEARKRGSIA"
FT   gene            complement(333471..334163)
FT                   /locus_tag="cce_0331"
FT   CDS_pept        complement(333471..334163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0331"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49682"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B1X141"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49682.1"
FT                   /translation="MNPYRSLDYHIDNNPEAASLTINLKSLDKVFVKSASLTLKDDSIK
FT                   IGKEITTHSLGLDLHFSLDANLTINEVTAPKLPGSIYLIPDVLGSIQHYALQQKVGIIM
FT                   QIFSFLACSKNVQLRVMSSPVIKQISEKDSFFLHLGGMGDLWLNYCGNIQEISVDKNYI
FT                   INLGYLVAFEDTLTYEIKPIEGLSVSGLHIGTVGENNLFCHFQGNGKIWIQSRHRYALL
FT                   NFFAPFIH"
FT   gene            complement(334160..334924)
FT                   /locus_tag="cce_0332"
FT   CDS_pept        complement(334160..334924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0332"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49683"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B1X142"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49683.1"
FT                   /translation="MFPDENPPSKIKSIQGQQLFFLKYMKVKILNERESSIARILLKQD
FT                   ELLITQAGTLLAMRGNLTINTSFRRSRSVAKGNAQIDRTMATESLFLTEFRAMGDKNEV
FT                   WLAPSMMGNIIIHNITNYKLIVVASAYLACTGTMGLFFGVPEIKLPYNNQSLTLLSITG
FT                   NGQVLLNGLGAIYTIDVAGDYWVNIDNLVAFENSLKYEIVQGQSKGLSNWWRKPQLFMK
FT                   VTGEGKLYCQTHQAQHWGHLIAKKLNTKSTIL"
FT   gene            335004..335384
FT                   /locus_tag="cce_0333"
FT   CDS_pept        335004..335384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49684"
FT                   /db_xref="InterPro:IPR025578"
FT                   /db_xref="UniProtKB/TrEMBL:B1X143"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49684.1"
FT                   /translation="MNILHLVKLIGGVSVIGLGTSMVLTNPGQNDYESYATDTLTSYLK
FT                   HEVCSQASGGLASFLASHCKTLVDTGKPHIKRVIANKTVRQNYLLFSIYETELLLPSPV
FT                   PNYEFETIGAFQQFYTYQADKF"
FT   gene            complement(335271..335414)
FT                   /locus_tag="cce_0334"
FT   CDS_pept        complement(335271..335414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0334"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49685"
FT                   /db_xref="UniProtKB/TrEMBL:B1X144"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49685.1"
FT                   /translation="MAIRGGSHKTLKFICLIGIKLLKCPYSLKFIVRNRRRQKQFCFID
FT                   TK"
FT   gene            335391..336206
FT                   /locus_tag="cce_0335"
FT   CDS_pept        335391..336206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0335"
FT                   /product="putative Prokaryotic chromosome segregation and
FT                   condensation protein ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49686"
FT                   /db_xref="GOA:B1X145"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:B1X145"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49686.1"
FT                   /translation="MTTPPNGHSPSLNPMARSSATEVIETLINLAQEGEIDPWDVQVIE
FT                   VIDRFLSELGISEYSDNIYEQATLPKSGQAFLWASMLVRFKADSLERLERDDSAEEPPD
FT                   DLEEMTEEAERQFRISDLEKYLRRRSAAPPPRQRRVTLQELITHIEEIAEEIETATPSR
FT                   RRKATPRPHSQREAMKMVTQLAHQENLTELAQQLEVFFQEQWSNSGQTERKLDLDELLQ
FT                   RWHQVNPPQENHNQQDRVGIFWALLLLSSQSKVELSQQEFYQDLTIQVL"
FT   gene            336326..337516
FT                   /locus_tag="cce_0336"
FT   CDS_pept        336326..337516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0336"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49687"
FT                   /db_xref="GOA:B1X146"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037538"
FT                   /db_xref="UniProtKB/TrEMBL:B1X146"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49687.1"
FT                   /translation="MAKIEEIVFMKAMILAAGKGTRVRPITHTIPKPLIPILQKPVMEF
FT                   LLELLRKHGFDQIMVNVSHLAEEIESYFRDGQRFGVQIAYSFEGKIVDGDLVGEALGSA
FT                   GGLRRIQDFNPFFDDTFIVLCGDALIDLDLTAAVKCHKEKGAIATIITKSVPKEVVSSY
FT                   GVVVTDEEGRIKAFQEKPSVDEALSTKINTGIYIFEPEIINYIPPNQKYDIGGELFPRL
FT                   VEKGAPFYAVNMDFEWVDIGKVPDYWHAIRGVLQREIKNVQIPGIEVKPGIYTGLNVAV
FT                   NWDKVNIQGPVYIGGMTHIEDGATIIGPSMIGPNCWICSGATVDNSVIFEYSRLGPGVR
FT                   LVDKLVFGRYCVDKTGAAIDVQAAALDWLITDSRQSFPHEDQVQQKAIAELLNQDR"
FT   gene            complement(337513..338754)
FT                   /locus_tag="cce_0337"
FT   CDS_pept        complement(337513..338754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0337"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49688"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:B1X147"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49688.1"
FT                   /translation="MEILVISNGHGEDVIALSIIDALKKFPNVSKIVALPLVGTGYAYE
FT                   KANIPIIGTVKTMPSGGFNQDINQLWRDLNGGLLSLTYHQYQTIRKWGKKGGKLLAVGD
FT                   ILPLLFAWLSGGEFAFVGTAKSEYYLRDEKGWLTSTSLVERWLGSMYFPWERWLMRRLA
FT                   CRGIFVRDNLTAQILQKWSLPVYDLGNPMMDQFSVNPSVTFPCESEPLIILLLPGSRMP
FT                   EAQHNWQLILEGVHSVIEAFKERSLLFLAAITPSFNTVPFQEDLIDKGWQKELDRTYPL
FT                   SIQDPQSILFTHRNATLMISQQAYHDCLQVAHVGIAMAGTATEQFVGLGKPVITFPGEG
FT                   PQFTQKFAQNQTRLLGCSVTLVNTPQQVGTTLKQLMNDPKQLQNIAKNGQQRLGQPGAA
FT                   QRIAHCLINECFTN"
FT   gene            complement(338768..339460)
FT                   /locus_tag="cce_0338"
FT   CDS_pept        complement(338768..339460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0338"
FT                   /product="probable acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49689"
FT                   /db_xref="GOA:B1X148"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1X148"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49689.1"
FT                   /translation="MTIIAIIPARGGSKGVPRKNVRPLAGKPLIAHSIEDAQESSLIDQ
FT                   VYVSTDDQEIATVSAQYGAKIIDRPVELANDTASSESALIHAIAALEKQNIKPDLVVFL
FT                   QCTSPIRTGADIDQAIAKLNAQQADSLLSVSPSHRFLWEELNGLAKSINYDYRHRPRRQ
FT                   DMNPQYVENGSIYVFKPWVLKKTQNRLGGKISLYVMSEMAALEIDTIDDFRMIECLTGN
FT                   REQETGNR"
FT   gene            339609..340028
FT                   /locus_tag="cce_0339"
FT   CDS_pept        339609..340028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0339"
FT                   /product="UPF0047-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49690"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B1X149"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49690.1"
FT                   /translation="MNYYQQSLTIKTRGKDFHRITRDVENVVNQSGIETGLCTIFVRHT
FT                   SASLIIQENADPDVLTDLSHFFSKLVPEDSKLYVHSTEGPDDMPAHIRSMLTKTSEQIP
FT                   ISQGRLVLGTWQGIYLWEHRQRSHQRQVVVHINGE"
FT   gene            340109..341434
FT                   /locus_tag="cce_0340"
FT   CDS_pept        340109..341434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0340"
FT                   /product="unknown"
FT                   /note="contains DUF187"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49691"
FT                   /db_xref="GOA:B1X150"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B1X150"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49691.1"
FT                   /translation="MLLLSLFIFSLLKIMKQNLFDKSANSLVKFSRRWGRQSWVIFLVL
FT                   FGIYLTFIPFTFPFSAQSRNQPAEIRGVWLTNIDSEVLFNSQTLTEGINTLSELNFNTL
FT                   YPTVWNWGYTLYPSQVAKSVVGKELDPTEGLQGRDILKEIVKQGHDKGMSVIPWFEFGF
FT                   MAPADSELAKRHQDWLTKRQDDSTVWVEGNVHDRVWLSPFNPEVQEFLTNLLVEIVTNY
FT                   DIDGIQVDDHFGIPFDFGYDDVTVELYQQEHNGKMPPNTPSYLKMGSNNCLAQDTAWTE
FT                   WTEWRNNKITEYMGEVFAAVKAVKPDIIVSVSPNPQTFSKNCFLLDWQSWERKGLIEEL
FT                   VLQVYRQNMVDFEREINQPEVRQAKAHIPFAVGVLSGLKGRPVPMQRINDQVKATRNQK
FT                   FAGVSFFFYESLWNFGPKSSNERQFMFKQMFPTTVSRPLSKG"
FT   gene            342029..342874
FT                   /locus_tag="cce_0341"
FT   CDS_pept        342029..342874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0341"
FT                   /product="putative band 7 protein, cation conductance"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49692"
FT                   /db_xref="GOA:B1X151"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B1X151"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49692.1"
FT                   /translation="MTRQSTPSLQPLIGGIIAALLVVISFNSFVVINPGQAGVLSILGK
FT                   AQDGALLEGIHFKPPLVSAVDVYDVTVQKFEVPAQSATKDLQDLSASFAINFRLDPVQV
FT                   VTIRRTQGTLQNIVSKIVAPQTQESFKIAAAKRTVEQAITQRSELKEDFDNALNSRLEK
FT                   YGIIVLDTSVIDLNFSPEFAKAVEDKQIAEQKAQRAVYIAQEAEQEAQADINRAKGKAE
FT                   AQRLLAETLKAQGGELVLQKEAIEAWKEGGAQMPKVLVMGGESNSSVPFLFNFGDLATQ
FT                   "
FT   gene            342940..343623
FT                   /locus_tag="cce_0342"
FT   CDS_pept        342940..343623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0342"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49693"
FT                   /db_xref="GOA:B1X152"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X152"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49693.1"
FT                   /translation="MPTSCLCNMTNFAINVDNVSFSWHENAQVLKSCSLAVPEGEFWML
FT                   LGANGSGKSTLLRLLTNLLTPQTGTITMTPPVGFVFQNPDRQLVMPTVGADIAFGLVEE
FT                   KLPPLEVRYRVREALTAVNLLELERRPIYALSGGQKQRIAIAGAIARHCSVLLLDEPTA
FT                   LLDADTQIELVEQVQNLVKSRGITALWVTHRLEELNYCDGAFLLEGGKVVQQGDPQLIK
FT                   KKISH"
FT   gene            complement(343800..343946)
FT                   /locus_tag="cce_0343"
FT   CDS_pept        complement(343800..343946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0343"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF172"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49694"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B1X153"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49694.1"
FT                   /translation="MDQVNYRQIKENLPDIMEKVCNNHQPIIITRDHDQPVVLMSLADF
FT                   SSY"
FT   gene            complement(344031..344384)
FT                   /locus_tag="cce_0344"
FT   CDS_pept        complement(344031..344384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49695"
FT                   /db_xref="GOA:B1X154"
FT                   /db_xref="UniProtKB/TrEMBL:B1X154"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49695.1"
FT                   /translation="MIDPILRKTFGGLSLDYYFRHLIFSLFLTILFIFSVEEYSIELFA
FT                   FSFFNTFLYPYSRFAYRSSINYLTGNEGLIINPFLILVIKFFTMLLCWSLALFIAPMGL
FT                   LFLFLYHSQQAKS"
FT   gene            344625..344912
FT                   /locus_tag="cce_0345"
FT   CDS_pept        344625..344912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0345"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49696"
FT                   /db_xref="UniProtKB/TrEMBL:B1X155"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49696.1"
FT                   /translation="MTPEERLSQIEALFETAARYTVRHEEAISRNEEAIARHEETLTRL
FT                   DEQIIQTNLRMAELAEIVRELGQYQRESSQRIDQIWEYLMRQNGNGRGSN"
FT   gene            345199..345303
FT                   /locus_tag="cce_0346"
FT   CDS_pept        345199..345303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49697"
FT                   /db_xref="UniProtKB/TrEMBL:B1X156"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49697.1"
FT                   /translation="MRGLEQDHQGYRDFPYPSQADDTKIRSSVGVNGR"
FT   gene            complement(345339..345698)
FT                   /locus_tag="cce_0347"
FT   CDS_pept        complement(345339..345698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0347"
FT                   /product="DUF196-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49698"
FT                   /db_xref="GOA:B1X157"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B1X157"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49698.1"
FT                   /translation="MRGVKSTFIFDSQQKSPEAITHTGQKIDVFYVVTYDIVCDRRRKK
FT                   VSDLLEGYGQRVQYSVFECVLTKAQYKQLCTRMKERVNLDEDSIRFYPISDHTLGQVEL
FT                   WGGKDLTKPPSSTIV"
FT   gene            complement(345718..346710)
FT                   /locus_tag="cce_0348"
FT   CDS_pept        complement(345718..346710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0348"
FT                   /product="DUF48-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49699"
FT                   /db_xref="GOA:B1X158"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1X158"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49699.1"
FT                   /translation="MKTLYVSQQGCYVKLDQETLKVEKKRQLLAEIQLPLIEQVLIFGK
FT                   SQMTTQAIRACLWRNIPIVYLSRMGYCYGRIMSLKRGYRHLTRYQQQLDFSQRLLTARE
FT                   LVKAKLKNCRVILQRQQRRLQSDKLLFAIDSLNYLIEQANLAETIERLMGFEGVGASTY
FT                   FSAFGDCLTPSEFIFLARSRRPPGNPVNAMLSFGYQVLWNHLLALIELQGLDPYQACLH
FT                   QGSERHAALASDLIEEFRAPMVDSLVLYLVNRRIMNADDDFEYHDGGCYLNNTGRKKYL
FT                   KHFVQRMEETVQTTPDEKQPRWDLLMQQVKRYKAFVYSPAYGYQPYLIR"
FT   gene            complement(346707..346994)
FT                   /locus_tag="cce_0349"
FT   CDS_pept        complement(346707..346994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49700"
FT                   /db_xref="GOA:B1X159"
FT                   /db_xref="UniProtKB/TrEMBL:B1X159"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49700.1"
FT                   /translation="MYISKRAAFVRNIAASAINCIVTLTLLLIAPLGLAAVITNTFLVT
FT                   FSTFIVCSICDFIIVWLSFSPPPKRIIHQSGNLTRWQQSQQIERKNIDKE"
FT   gene            347126..348370
FT                   /locus_tag="cce_0350"
FT   CDS_pept        347126..348370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49701"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B1X160"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49701.1"
FT                   /translation="MGILYKNSLLLDSMKNKFKPHRYSDLESFERLLLLIAILVKYPGV
FT                   GYRDRNLLDTTEIHYNALEEVKFYLQKLADQLGIDLPEDYPAITTLRKDLETLKDYQIL
FT                   EKRMYRWGYYLGTGVMSPLELKIALDALESLAIKQGDPRIRKITEQFKKRLRGFAALED
FT                   QQLFYPVRQQLNHAINYTDPDEMMEKGVYRQTLFHHIHILETAIIEGQIIEISRKKDLY
FT                   DNKRVGIMKVYPLQLIYHNVAWYLLHEDYKNEHLVISRVNRLGNYCKILEPSGRGINKQ
FT                   KQSLTKAYQLLENGWGLKLGNLEEQKQELAGKLNFVKAKVRFFYPVSQFIEEGERRHPK
FT                   QKIKRGKIDPQTHQPQYIDYSVALPLRSLDEFYFWLNSYGEYVQVLAPSELVERHQRSA
FT                   LTLVSRYGCNKDNIT"
FT   gene            348517..351600
FT                   /locus_tag="cce_0351"
FT   CDS_pept        348517..351600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0351"
FT                   /product="hypothetical protein"
FT                   /note="contains a CRISPR-associated protein Crm2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49702"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:B1X161"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49702.1"
FT                   /translation="MSHLYHPYWQAKIWALLHDPALKPLSDRYGFAREGQWQLLRCMQG
FT                   CKSPKDNKKVLGDCVLQGNWLNHVGLCDLVASASDRSTIGRLDPQYSAVTYQQQTGLQI
FT                   RHLLSGEPQNLKVNNNWQENLITKRKKLEAKEAEFLDKISQWEDPKKVFWALWRCYAEV
FT                   LEKEEALIHLLPAETRLPDGSLWSHVSMTSALAGGLAGYYKQAENYPIKNQKFNDYSRP
FT                   YLVNFTFSPVQELIKASRKMRDFWAGSWILHYLSAKVSYAIANEYGPDTLLYPCLYQQP
FT                   LIDNWLLEEYSDFKEWIEPHKPDQLLTAGFPNVIIMILPNNHKSQQDLKDNPIYAATQL
FT                   AKRTLKEEWKKLGDQSLEFLQDSKQWQNINPNTWDKWLKCQWQTYYTAFPIGDPESDLT
FT                   CSLRVGKNETEEQKKDAFEAWCHQQNQLTNPKESLFETNEEKFLKAIFKLTDIETEKEP
FT                   PKTKYSKQPNLNVGSWWAYVFDQLRTSLNAVKNARTWELPTAFTVRSSLSGIGSAVHPI
FT                   VNEEKPDRISEKEINEFWSEKFGLFDGTEKLNATEIVKRVLHKLLPEILNYEEQEISLY
FT                   YPDLTAGVAGYLKNALLNNQQSEIDYYKRSCHKIYKEIQPLLDNDNLSQSWGIPWINNN
FT                   KELKLSNTIHHPRLLNAGWLLEDVEISHDSNIEYREKLEELSTKRTTIQQVINKYYPSN
FT                   NPTNWYILVAGDGDSMRDWLRGSKLKNYGEYLPDELREKIINDSNDEIPKEYKEPLQNF
FT                   LEVRKRMGPSTHSALSRALLDFSNQLVPYLTEQRYAGRLIYSGGDDVLAYTNLWEWDNW
FT                   LWDIRQCFKGQEDPYNEFKNEGDYWQWNKPNKPKNIAQRPLFTMGKCATISFGIVIAHH
FT                   SIPLAIALESLWEAEEEAKEHYTQKDNKDTYKDAVQVRVLYGNGNTLKSTSKFDIFNQW
FT                   KQLLKLDLEPSLFEQAATIWEQHPIPDKSAIEPWTKAFCSRRDIGEELQQDYQKILTSF
FT                   IQGLWITTPQNNLDKEVKNWLKLAAFVKRNRKISLNQE"
FT   gene            351607..352155
FT                   /locus_tag="cce_0352"
FT   CDS_pept        351607..352155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0352"
FT                   /product="unknown"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49703"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1X162"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49703.1"
FT                   /translation="MQLITRKFNVNEYHKMAETGILTPEDRVELIKGEIIAMSPIGRKH
FT                   AATVNRLNQLLCQKFYNKVIVSVQNSIRLDNYSEPQPDIVLLKPRSDFYESKIPEPEDI
FT                   YLLIEVADSTIKYDQDVKLPLYAESKISEVWIVNLNNKTLEVYRQPQNKTYVEQKKNVQ
FT                   SISPIAFPETTLTINDIFS"
FT   gene            352158..353348
FT                   /locus_tag="cce_0353"
FT   CDS_pept        352158..353348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49704"
FT                   /db_xref="InterPro:IPR019117"
FT                   /db_xref="UniProtKB/TrEMBL:B1X163"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49704.1"
FT                   /translation="MYWYTLTPTDVLMLRDAKPFSPQERAWAGSVFPPNGHTIAGALRG
FT                   LLGTKDNFKLKGVFFVKETPRQDTNNPEFTLYFPSPLGFVGNKPLIPLNWDKSLSLNYI
FT                   FWDQTKPCPLTTKKPDYQEDKLDKKYRKYLPYEAILNYLQDSKFQEGDLLQLNDEPETP
FT                   WKIETRSHNSIETNTKQVKDADGYFVENAIRMLPGWHLAIAIDQLTHENIENLSNKSEK
FT                   LLTLRLGGEGHRVILQRCESLDTQWNQLKEISNNNFKNDQKAIAYLVTPGVFEKHHNGQ
FT                   AICKPYPWEWKLAHTINGNQKSGDLVSVATAKAVPISCRIRDKNDQNKSIPAPQVFAVP
FT                   PGTQYYLNQPCYLFADPHNPDTQHLKENQEKQAYHKAKRLLELGYSELFWIKWENH"
FT   gene            353333..354637
FT                   /locus_tag="cce_0354"
FT   CDS_pept        353333..354637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49705"
FT                   /db_xref="UniProtKB/TrEMBL:B1X164"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49705.1"
FT                   /translation="MGESLIMASIVLSFVGNQDPASETTNQEGSIITLIRHLIKLNSKI
FT                   RKVILLYTEDTKDNAILTKEWLQQDDFKISTNQIELIAVSSNLSDDPVDVKLATQEANK
FT                   GLKQAKNYRKDNDIFEFNSSSGTPSMKTAWGILQASSYGINSRLWQVRNPKKIQPSQEL
FT                   VFENNVNVFKDESNFSVIKKQLQNYNYSGAIESLNNSDLDSKISHNLMEYGYYRLAFDF
FT                   QSAREVIQPYQEEISQELIKNINDLYNENILELLQEVYYKGIIKIKNKQYADFLVLLFS
FT                   FQENILKFLVKQQILKDTSQPLHWKVAKEKINYQLQKGELNEYLKNYSYDGRSLKLNGD
FT                   INRIVMLAILDYFSQLDNHLSQITLLLKQLENYCQIRNELVHDIKRVSELENESEIIKT
FT                   MREILILTKPNFQTVNPFNLLNEQIVKQLTPLVRG"
FT   gene            354642..355535
FT                   /locus_tag="cce_0355"
FT   CDS_pept        354642..355535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0355"
FT                   /product="DUF324-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49706"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:B1X165"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49706.1"
FT                   /translation="MKDFRLNYLYSLSPIHCGGEGDLGNILEIAREVHTNFPYIPGSSI
FT                   RGSIRNEVDIINSDATNKLFGKELDDDGNMGVHQVWFGDARLLWVPMKTMSFNGNQDIF
FT                   TWVSCHSLIRDHAIISNLPFVTFPNEAVGTNAGTYEVADAQIKVLKITPDQEKTITFLG
FT                   EFPDSLKDSVKPTWESNHIVLPDADFQVLMEHSLWTQVRNKISDGTKEDTEAGSAEVFW
FT                   TDVCIPRDTIFYLPWGYSLSKIDPISTDEHNKLMEVIQGLIQVGGQANVGRGWVQSWVS
FT                   HSTFEFNKQEQQLTNV"
FT   gene            355545..356087
FT                   /locus_tag="cce_0356"
FT   CDS_pept        355545..356087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49707"
FT                   /db_xref="UniProtKB/TrEMBL:B1X166"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49707.1"
FT                   /translation="MAKKNKLSQFPRGKKTVSANTNVTATPPKYNANNTKSELKISQAT
FT                   ITNSKKVQPEQMSLFAHAAIQVYIEKKGEKSLDKEDLNAVLRLSQHLRIFGLLSAVGYI
FT                   NQTNEQEGKVRKRTVPVWHCLLGYLIAPSENLDTKDLMEKVINLTKNEPQQYMSMWRKS
FT                   LLLAPHWNFWARAYSKD"
FT   gene            356197..357990
FT                   /locus_tag="cce_0357"
FT   CDS_pept        356197..357990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0357"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49708"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:B1X167"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49708.1"
FT                   /translation="MYTGNKLIELLEKQQETRYKTNLFRKGTFRIQWRAKVGSYPHPDG
FT                   ETMISAGEPCGNWETYKQQPRNDKFINKKGKEETIKKLEQYLNELPKLPINGYIPGSSI
FT                   RGLVRAWVKKDPDKRSRMNELLGYQDDEKITPGKIEFLDAYPDKPTRLTIDIINPQQEF
FT                   QVLHNQEKQSNPCPLYTLGDGDNKIKVTIAIRGIPNKATEEDVKQVWEWVEQALHFYGV
FT                   GSRTASGYGMIKSENKPKPIRPKNEISKTFNFTLYSQGCYGANQKNRDDVQLRPSHWRG
FT                   WLRSWVLRFLLGVMSRKNAEKILGDLLGNIDENSGKSYKGCVRLELVKNQLWGEVSEDE
FT                   PDFYTWKGQLKITAPKDILSKIILPIIRFACSVGGVGRGWRRPLHIFSFNNGNKAARGC
FT                   YLKLSHKVPDKNTGEKKIRLYQLSPNKPELWSKTYDQWLKAIKSYCGDKITIDTTINQN
FT                   LEAEVFSPNTCAIYAVPGPDQNPIDESYQTWQNIRDNEETRGEGMTLIYQSKYKKKTEV
FT                   GGDAGNGNASCSWVSIRRVNIPNKIAQTQCQEIVCLFMGGQLTKIDHTDNQNNLRSHFL
FT                   KDLSNIPDSTLLFGVSPDNNN"
FT   gene            complement(358083..359309)
FT                   /locus_tag="cce_0358"
FT   CDS_pept        complement(358083..359309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0358"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49709"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B1X168"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49709.1"
FT                   /translation="MPSNSQLNLMTNILQLEGFTVMDYQLIKGMGIVLSLEKVDKKTTC
FT                   IYCGSVTRKLHQNNELTIRDLSWGEQDVYLKINRRQMRCEKCQKKFTEELKDIKKKRTY
FT                   TERLKKKIVAEVLNGDIKNVAQRNGVSEQEIETMLKDIGQELGKKKPQKLRRLGIDEIA
FT                   VVKGQGKYYVVLVDLDKGVIIGLIEKRTEEEVSKYLEAWGEEVLRQIVEVSIDFWQPYK
FT                   KVAKKLMPQAEIVADRFHVMKQVTDELDAQRKKSKREAIALKDSPEKKQLLSGLNKSKY
FT                   ALLKNEEDLSDQQKEKLEEIYKTVPILSKMYLLKEKFRKVFDENIDWISGLFELADWCA
FT                   EAHTVYPKSFGTIRRWMGEIIAYFDERTNSGVVEGINNKLKLIKRRGYGFRNFDNFKLR
FT                   SFLTWHFSG"
FT   gene            complement(360099..361442)
FT                   /locus_tag="cce_0359"
FT   CDS_pept        complement(360099..361442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0359"
FT                   /product="putative NrtC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49710"
FT                   /db_xref="UniProtKB/TrEMBL:B1X169"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49710.1"
FT                   /translation="MKRRNFIKYSGLGLASLGVAACSKVDIFNQQKTDVNFGTLEKSNL
FT                   ILGYVPNGDAAPLIVAQEKGFFERYGLSVTLKRLETWEEVKEELLGWTMDAGQLPYAFP
FT                   ILAQLGEDEAPLISLMTLNLNSSAITITQKAWDAGIRPSVDYFNFTDFEENIRRYWRNR
FT                   ETPVNLAVDSAFSTDTYLTRYWLSAIGLMPKTEVELVEFPASQMIYKLQAGMIDGYSAS
FT                   SPWNQQTVLEKAGFVSYVSRDIWQGHPNKILATMDGWAKKHPNTTRALMAAVIEACQYC
FT                   DRLENQTEVAAILAQPDYLNLDTSLIESTLMGNYSYSYETSENYQRFIPDYTIFHHREA
FT                   DYLGENDCANYPWRSHAVWMLTQMIRWHDLDIYDYPKEADKLLDKIYPITIYEEVAEAL
FT                   NIPLPSNNMKKETNTAFIDGRSFDPSNPVAYLNQFPIRANGPQIFGFV"
FT   gene            complement(361472..361843)
FT                   /locus_tag="cce_0360"
FT   CDS_pept        complement(361472..361843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49711"
FT                   /db_xref="UniProtKB/TrEMBL:B1X170"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49711.1"
FT                   /translation="MLKFFKIILLAITIISFSTQMAYADQCSYVDKEQALKAATFLKLN
FT                   QLIYLFCEPCGETTPQPVTIRSISVGTVDYENYWQVSINNQGVDLAYTYVPSSLGQKPI
FT                   NLAALADCPAQDVSPFINP"
FT   gene            361941..362147
FT                   /locus_tag="cce_0361"
FT   CDS_pept        361941..362147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49712"
FT                   /db_xref="UniProtKB/TrEMBL:B1X171"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49712.1"
FT                   /translation="MLELDDLNLHIQYITNDLGEKTAVILPITEFEELLEDLEDLKTIA
FT                   DRKDEETISHEAVIAELKEDDIL"
FT   gene            complement(362204..365230)
FT                   /locus_tag="cce_0362"
FT   CDS_pept        complement(362204..365230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0362"
FT                   /product="putative exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49713"
FT                   /db_xref="GOA:B1X172"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B1X172"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49713.1"
FT                   /translation="MIPLQLTLKNFLSYRETVLDFRGLHTACICGANGAGKSSLLEAIT
FT                   WAIWGKSRTASDEDIIHTTAQYVRVDFEFISYEQSYRIIRSRQRGRSNTLDFQINSSGE
FT                   FISLSGKGIKATQEIILSTLKLDYDTFINSAYLRQGRADEFMLRGAADRKKVLAELLKL
FT                   DHYQALADKAKDLSKQYKGQEEQIKLNLDRIKQQLEEKKDINNQKKTLNQEIEQLQKSQ
FT                   EVHRDKLQKIKEKDSHRQAWIEQLTWHQNKQQTLNKESKELEQEQFQLVRKINEADKLI
FT                   NQEQEVTEKYEELLLLQKQEETLSHQFQLSQNIQQKKQKIEQEIFKKNNQLQLQIRQQQ
FT                   TRLEQLAEQEQDLQKTISQADDIKATVEKLNNHRQRLQELDKLQHTVTPLLKQKQILET
FT                   ELEKLKANLEAKLEQFENLENQYHQELEKIPERRQLLIELDNKIQEIDNQKVYQKRVKE
FT                   KSQERKLTQEKLIVNQKNYTEKIEELQQKINLLNNPESTCPLCEQDLDENRRHHVIDKT
FT                   NKQQEKLQQQIWFLQEELSVIKRDIKSLISEDKQLENQLKTSGNIQQEFSRIEAQLDQA
FT                   GEVKIKLKKLLKEKEMIENVINTETYGMNIQNEIKIINQRLEKLNYDEQTHALARGEVE
FT                   RLRWAEIKQARIEDAIGNQKKIEQQKPEIIAKLEQLETERNNLETNSELKQEINKIEEE
FT                   LNNLNYDRSYHQRISDYIRKSQSCVVDYQKLQDVKQDYPQLQEQLKNIETKINNNQEEQ
FT                   KDTEKFVQQLSTQLETIEDHSQEIEILETKLQLQREQLDNLLGQKGRIEQSLSQLESLK
FT                   KQQEEQEKEYNDVRKQYRVHTELSKAFSKNGIQLLMIENVLPQLETETNNILSRLTGNQ
FT                   FHIRFITQRAGKSGSSRKKSAKMIDTLDIIISDAKGTRAYETYSGGEAFRINFSVRLAL
FT                   AKLLAQRAGTTLQMLIIDEGFGTQDAQGCERLVAAINAISSEFSCILAVTHMPQFKEAF
FT                   QNRIEVYKTNEGSKINLVS"
FT   gene            complement(365344..365490)
FT                   /locus_tag="cce_0363"
FT   CDS_pept        complement(365344..365490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49714"
FT                   /db_xref="GOA:B1X173"
FT                   /db_xref="UniProtKB/TrEMBL:B1X173"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49714.1"
FT                   /translation="MNQGKIVAIITGAISIFLAVAYLVIVQLLDFRGEMIPAPTFDIIF
FT                   NLC"
FT   gene            365602..366036
FT                   /locus_tag="cce_0364"
FT   CDS_pept        365602..366036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0364"
FT                   /product="unknown"
FT                   /note="contains a glutathione-dependent
FT                   formaldehyde-activating, GFA domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49715"
FT                   /db_xref="GOA:B1X174"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B1X174"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49715.1"
FT                   /translation="MSELSMIKGSCLCGAVNISTSSINHHLAACHCNMCRKWGGAALLG
FT                   VECNDGISFEGEENIQVYQSSQWAERGFCQKCGSNLFYRLKENNHYYVPVGIFDNADNL
FT                   VFDLEVFIEEKPNYYSFANETKKMTGEELFSMFSSSSEKE"
FT   gene            366082..366435
FT                   /locus_tag="cce_0365"
FT   CDS_pept        366082..366435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0365"
FT                   /product="histidine triad family protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49716"
FT                   /db_xref="GOA:B1X175"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B1X175"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49716.1"
FT                   /translation="MSSTMTDTIFSKIIQREIPANIVYEDDLCLAFTDINPQAPTHILV
FT                   IPKKPIPKLEEAQEDDHRLLGHLLMKVKQVAQEAGLTKGYRVVINNGEDGGQTVNHLHL
FT                   HILGGRSLTWPPG"
FT   gene            complement(366496..366858)
FT                   /locus_tag="cce_0366"
FT   CDS_pept        complement(366496..366858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0366"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49717"
FT                   /db_xref="GOA:B1X176"
FT                   /db_xref="UniProtKB/TrEMBL:B1X176"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49717.1"
FT                   /translation="MYYFPQPPYFLVVAGLFIGLTCGLAFEATLKSQINAMLKKPIDQM
FT                   LKGSGLQLPFFGICIGICVFLSAGLEIFLFDRWLSYAISLPMTIFIAALVWIQLESLLK
FT                   QLKEGGSKAIDLDAFY"
FT   gene            complement(366886..368604)
FT                   /locus_tag="cce_0367"
FT   CDS_pept        complement(366886..368604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0367"
FT                   /product="unknown"
FT                   /note="contains an ABC-1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49718"
FT                   /db_xref="GOA:B1X177"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B1X177"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49718.1"
FT                   /translation="MTWQTIESYDPSSNIQQQKRYDAAAIARYYHRHPWEVIQRAITII
FT                   WSFGWFLLHLQWDHWFNPDKDNKQKCATELRQILTRLGPTFIKVGQALSTRPDLIRPDF
FT                   LDELIKLQDQLPPFDNEIAFSIIEKSLGTSIDEAYREISPHPVAAASLGQVYRAVLHTG
FT                   EEVAVKVQRPNLRPILTRDLFLMRWAACQFGRFLPLNLGHDLTLIIDEFGVKLFEEIDY
FT                   VNEGRNAEKFAANFRNDDDVKVPVIYWSYSSDRILTLEWIQGYKLTDTDKIRAAGLDPY
FT                   AIVKIGVTSGLRQLLEHGFFHADPHPGNLFATLDGRMAFIDFGMMDQLEEETKETIASS
FT                   VVQLINQDYDALARDFVKLGFLTPDTDIEPIIPALERVLGNAIGQSVGDFNFKTITDDF
FT                   SELMYEYPFRVPAKFALIIRSLITQEGLALSLDPNFKIVEVAYPYVARRLLTGESPQLR
FT                   RRLLEVLFKNGKFQWQRLENMIRIARSDEQFDLLPTARLGLQYLLSDEGRYLRHQLLLA
FT                   LTEDDRLHTEEVQRIWALISDDLQPQQLFGVAMKAFRQFSTAGVAAILPDTADVN"
FT   gene            complement(368731..369504)
FT                   /locus_tag="cce_0368"
FT   CDS_pept        complement(368731..369504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0368"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49719"
FT                   /db_xref="GOA:B1X178"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X178"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49719.1"
FT                   /translation="MTAESLSLTQKSSQPSPSHDYHPIIIRLEEITKIYGSENTKVKAL
FT                   DKINLTIEKGEYCTIMGASGSGKSTLMNILGCLDRPSSGRYYLDNIDVSRLPDSQLAEI
FT                   RNGKIGFVFQQFHLLPQMTALENVILPMIYGEVSPTERRNRALEALEKVGLGNRINNKP
FT                   NQLSGGQQQRVAIARAIVNEPVLLLADEPTGALDSQTTEEVLDIFESLHQVGITVVVVT
FT                   HEAEVARHSRRVIWFKDGQIVHSHINPQELHGVVD"
FT   gene            369600..370145
FT                   /locus_tag="cce_0369"
FT   CDS_pept        369600..370145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0369"
FT                   /product="hypothetical protein"
FT                   /note="contains a pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49720"
FT                   /db_xref="GOA:B1X179"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B1X179"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49720.1"
FT                   /translation="MAQFYSSLTPELIKFIKEQKIFFTATAPIEGRINLSPKGIDTFRC
FT                   LDQQTVGYLDLTGSGNETSAHLEDNGRMTIMFCSFSEKPLILRLYGQGKVIHPRDEEWR
FT                   QLYPNFPTYEGERQMIILTLSSAQTSCGFGVPIYEYQETRDTLIEWAKKKGKTGIYDYW
FT                   QQKNQVSIDGLPTKLLEE"
FT   gene            370328..371509
FT                   /locus_tag="cce_0370"
FT   CDS_pept        370328..371509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0370"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49721"
FT                   /db_xref="GOA:B1X180"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B1X180"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49721.1"
FT                   /translation="MLMKTMKLTKFLGSLVRYSIPMILSIILSFGGFHVLSSQAETIGE
FT                   LAQTPINITPDSFVAEAVAKTGPAVVRIDTETVVTRQIDPFFDDPFFRDFFGQQFRPPQ
FT                   QQRITGQGSGFIIDSTGIILTNAHVVNSADKVTVTLKDGRTFNGQVKGTDEITDLAVVA
FT                   ISPQGQTLPVAPLGDSANLKVGDWAIAVGNPVGLDNTVTLGIISTIGRSAAKAGIPDKR
FT                   LDFIQTDAAINPGNSGGPLLNSKGEVIGINTAIRADAMGIGFAIPINKAKTLEKILASG
FT                   QKVPHPYIGVQMINITPEIAKENNRNPNSPMMVAEVEGILVVQVVPNSPAERARLRRGD
FT                   VIVGVNGQPVKDGTDLQKIVEKAGINSSLRLKLYRGDRLLELTVKTEQMQGVS"
FT   gene            371645..373012
FT                   /gene="matE2"
FT                   /locus_tag="cce_0371"
FT   CDS_pept        371645..373012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matE2"
FT                   /locus_tag="cce_0371"
FT                   /product="DNA-damage-inducible/multi antimicrobial
FT                   extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49722"
FT                   /db_xref="GOA:B1X181"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B1X181"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49722.1"
FT                   /translation="MESSFKIVHLETYKNRCLEFFNFPSFSWRFLRLASINILSNLMVP
FT                   IAGLLSITFLGHLQDIHHLAGVTLATIIFNYLYRALGFLRTSTTGITAQGMGRKDSQDV
FT                   LLVLLKNGLLALSLGLIILLLQYPLRWIGFNLVSAAPLVKASAQAYYDTRILGAPAALL
FT                   NFVLIGWFLGKEQSSKVLWLSIIGNGANVILDYLLIIRWGLDSSGAGLATSLSQIIMCL
FT                   VGVLFVSLDINWNEVKQIVQKISFEQWKGNLMLNRDLFIRTLILLSAFSLFTNVSSAMG
FT                   TLVLAENSVLLQVFSLVVYFIDGLAFATESLAGNFKGQGIKKQLIPLLKFSGSLSFILA
FT                   LISVSVLILFPKTLFGLLTNHTEIYPYLISHVIWLLPVLGFGSIAFILDGYFIGLAEGV
FT                   MLRNTAFGSTFIGFVPVAIIAWHYNNSNLLWLALSLFMATRVLLLGLKVPKTLDNL"
FT   gene            complement(373028..375637)
FT                   /locus_tag="cce_0372"
FT   CDS_pept        complement(373028..375637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0372"
FT                   /product="unknown"
FT                   /note="contains EAL, Chase2 and GGDEF domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49723"
FT                   /db_xref="GOA:B1X182"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1X182"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49723.1"
FT                   /translation="MITKLHQVIRSFLVDNSNEKSSEDIKRIPVNSGKNNQKQSQQLWL
FT                   FSLPSIIISTLFVTGGIITLRQTGHLQFLELVAYDQMVRVVSSNGSDPRLLIVEVNEED
FT                   IKQQKKWPLTDEVIAKVLNQLQEHNPRLIALDIYRDIPHPPGTDTLTKALEQDNIVVVK
FT                   QLPMGDEPGVTAPETVPKNRVGFSDLPIDPDNVVRRTFLYVESPSGKIKEYSFALQIVL
FT                   NYLSDNYSSFQVNPDYLKLNSTKIIALNNTSGGYVLPPSEAMGWQILVKYRSKQIRQVI
FT                   SLTDVLTGNFDPNLIKDKIVLIGVTTPNEKDTFPTPYSATATENFEMAGVEIHGQIVSQ
FT                   LLGTVLQEEQTFWFWPEGVEWVWIGFWSLLGGVVVWRSQRLWILGGNVILVVAGLWGLC
FT                   FLLFTQSGWIPLVPPLLGFLLSGTCVLAYKTVYQTYHDPLTGLANRRSLEQRLQQLNHQ
FT                   NISQQSELVAVLFIDVNRFKSINDGLGHQAGDYLLTAMSQRLQQQLNSRKHLGRVGGDE
FT                   FAIWLKPVKDKQDVVSFAEKLQQVLSQPLSWQGQEIYPTVTVGISFEETGRNFHGPELL
FT                   RYADIAMHKAKEFNCSRPQIFEAGMDTQAVQRWHLETDLRLGLEQKEFQLYYQPIISLT
FT                   TGNIAGFEALVRWNSKTRGFVSPGDFIPVAEETGLIVPLGEWILTEACRQIRAWHERFP
FT                   RNPALIMSVNLSGRQFSQPNLVKQIQTILDVAGIEGDRLKLEITESMIMNNVEEAISLL
FT                   NRLKGLGLRLSIDDFGTGYSSLSYLHRFPVDTLKVDKSFVGRMEDGKDSHKYIQIVRTI
FT                   ISLGHNLDLDVIAEGIETEGQMNILESLRCKYGQGYLFSRPLSSENAEALLAEDNPI"
FT   gene            375921..376769
FT                   /locus_tag="cce_0373"
FT   CDS_pept        375921..376769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0373"
FT                   /product="DUF928-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49724"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:B1X183"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49724.1"
FT                   /translation="MFDNKPIKTTTGVVTVSALMLLSFTSIGATQTERGRNNANQPEES
FT                   IADSIPDRRKGGASRRPQTSQNTEDEEVVQAPQRRKPAASRNDNNQCNFNPQELVALIP
FT                   ENLHGKTTELSPTLYFSVPAITASTEIEFVLRGPEDELIEKQTFSGKGQAGIMSLKLPK
FT                   VPHLSSANSEKTYHWYLSIICNQSDRADDVVVEGLLQPITLQSNLLQQLETATLEERIK
FT                   LYQSHDLWHERLHTLAKMRRSQPQNTQLAQKLGELLESVQLDPTIGQKPLLETEMLSLS
FT                   H"
FT   gene            complement(376766..377614)
FT                   /gene="rffM"
FT                   /locus_tag="cce_0374"
FT   CDS_pept        complement(376766..377614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffM"
FT                   /locus_tag="cce_0374"
FT                   /product="probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49725"
FT                   /db_xref="GOA:B1X184"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:B1X184"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49725.1"
FT                   /translation="MSVLRIKKVGVRRQKVEGNRLWILKSNLFPVPYVEIWSMVMRTSP
FT                   KTSSVLGLPVHLSDNYTGWLLQCLEKEQGVHVVTLNAEMAMLAEKDPLVAKIIKEADLV
FT                   IPDGAGVVIYLKMRGQQQQRCPGIELAQSLIEGLGSNGQGNVIAFYGGKPGVTAAAADY
FT                   WRGKLPEANIITAHGYLSPEEQETWKNTLKIQQPRLILVGLGVPRQEVWIRENRALCPQ
FT                   AIWVGVGGSFDIWSGTKSRAPGWLRNNNLEWLYRLYQEPWRWRRMLVLPQFFLKSLFYR
FT                   H"
FT   gene            complement(377559..379718)
FT                   /locus_tag="cce_0375"
FT   CDS_pept        complement(377559..379718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0375"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49726"
FT                   /db_xref="GOA:B1X185"
FT                   /db_xref="InterPro:IPR018776"
FT                   /db_xref="UniProtKB/TrEMBL:B1X185"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49726.1"
FT                   /translation="MTLKDIIKSVHQWLYKHRLAIGILLLYSIVAISLMAPMASSQIIN
FT                   GNFNDTASHVGYIAQARTAIIEGQFPLRVAPLENNSWRYPGFQFYSQLPYFIGGWFYKL
FT                   VTPTNPYEAYKLVIIIALTIGGFYIYRLSCQLTQSRVAAILAGVAYMSAPYFLNNIHAR
FT                   GAFTEAIAQGILPVVLYYVIQCYLTGKRRYLIFSAISWFCLAVTHIITFVYGTLFFALL
FT                   ALIVVIQTRKTDFTFSRLIPPLQSYGLGWLLGFYFLAPVVFISSHLAISKQLNRNNPFY
FT                   TNNYTPLANLLSPTSLPPEPSETGLAGTYGLHPAIGWILLGAWLVVMYYYYFSPSIPAK
FT                   LNKTRPYMIALLWVFAVALFLTWSPINIWAILPRQLWVTQFTFRLLTHVMWAGALLTAY
FT                   ATVLIFRRRLDRRHLILGILIIVFASRPWLPAAKGTLTVDQLLQEPLFRYSGALDYLDR
FT                   SPITTLYGKAELPLLHPDWTPGYSTWNTFVNHPLLLEAELRYPVWEPGENPVLFIEGEV
FT                   PLENIAETATLEVHLDGKVIGSFPLVSRELKGEVPLPSLPESSHDFGLKFVVQGETRNG
FT                   QPLNIRVKQLFLDGMLPKHTLIPVTETEENCQQQGVSTVCEITVSEEANIVQLPVLYYP
FT                   DMLKVWVNDKGFNKIFAVYYRDYNLTGLDLKPGTYTIRTTFHGLAWANWISGLAWLGLI
FT                   SMMILPNFVRFKDKEGRSQEAEGRR"
FT   gene            complement(379733..381505)
FT                   /locus_tag="cce_0376"
FT   CDS_pept        complement(379733..381505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49727"
FT                   /db_xref="GOA:B1X186"
FT                   /db_xref="UniProtKB/TrEMBL:B1X186"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49727.1"
FT                   /translation="MGFKYIRLEEFPRQLLFIFLIVLYYIIGFHLIDQTSITSDESAYI
FT                   GAAYAYTQGLGLNQEHPLFFKLINSLILSVFFPNYNLEVPSINIVSGEESIEARLAAFN
FT                   LGYTLLMDNANNFYRLLLSLRLPYLIFNSFIFIWFYLYTFIFKKIPSQISLVFAVLYVF
FT                   SPSFYSHNFLIAFDVAVSVYALLSILTLMVIYDTVINTDDNFLGFHFLVFTVCFFIALN
FT                   AKFSNLILLPITIGTYIFIAIYLFKENKKQKLKQFSVLAVFSLIIQALLISLMYRWAFR
FT                   NLPNQSLIDNLWAYIDGIKMNLSTAGGIREPFWNGQFMSMTSLGYLTKIFWFKENPGLF
FT                   IIGLFLLLALIYNISYQKIVITNYINKKILPLIILGSAYPLIYFWLTKDSRFIIGYRYF
FT                   YPLVLFVYLLIASLTVILKHKWQKYVLLGGLTLYVYLGIVGISQSLSYVNPLWNQEKWK
FT                   LADDSTLNWGQETEHGVKYLLTQNRLPEDNNNVITYQLFGVNIGFVQYLDLLSKIENYP
FT                   INIQSYYAQPRFNPETETITQLPYEYLLIDSTVKQQIHAQKENNPVATENWSFLINNQP
FT                   IFSRNDIIFVYKLN"
FT   gene            381775..382662
FT                   /locus_tag="cce_0377"
FT   CDS_pept        381775..382662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0377"
FT                   /product="unknown"
FT                   /note="contains a methyltransferase FkbM domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49728"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1X187"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49728.1"
FT                   /translation="MNQTMAIKDYLINKLRRVLGIIDILAALDQVLKDQKRELIKEILN
FT                   QIKPGSIVECCINDVELLAPIEPLQVYQHCVFPNAEQKLNFLIENHCAEWLCSHINYGD
FT                   TVLDIGAAFGVISFPLAKAVGKKGHIYAFEPAKNTQDTLQKILSLNHISNITVVTQAIS
FT                   DKSGIAEFIEYSQDNESSWASDTSTLASDNNIDEYKKFTTYQVSVITLDEYIAKNAIEP
FT                   SAIKMDIEGFEFYALQGGKQTLEKYLPYLCIDIHADVKTGKSSLVEIEPFLQSLGYSLT
FT                   MEEHTLYGIPPEKT"
FT   gene            382747..383748
FT                   /locus_tag="cce_0378"
FT   CDS_pept        382747..383748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0378"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49729"
FT                   /db_xref="GOA:B1X188"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1X188"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49729.1"
FT                   /translation="MLISIIIPCYNEQEVIQITHNRLVSVLEKITPQFELIYVDDGSQD
FT                   QTADHLRQLQQKDERVKVVLLSRNFGHQMAVTAGLDHICGDAVVLIDADLQDPPEVIQE
FT                   MIDRWYEGYDVAYGVRTDRQGETPFKLWSAKAFYRIMNRLSDVTIPLDTGDFRLMDRQV
FT                   VEALKMMPERDRFLRGMVSWVGFRQVAVPYQRSPRLAGVSKYPLFKMIRFAADGILSFS
FT                   LVPLRVAIWAGLFTVALSIIGIIYALFVRLFTLSWVPGWTISFIAILFIGGIQLVFLGV
FT                   IGEYIGRIYREDKRRPLYLVRERLGFQFDNQNSHRHRGKKVTYAGENSNEMI"
FT   gene            383791..384999
FT                   /locus_tag="cce_0379"
FT   CDS_pept        383791..384999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0379"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49730"
FT                   /db_xref="GOA:B1X189"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:B1X189"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49730.1"
FT                   /translation="MNNICRVCDSTNLELAIDLGHQPWCNNFLKLEEVGQEPFYPLRVL
FT                   YCHNCGTVQLDYTVKKEIMFGDHTYLSGVTKSLSEHFKNVAHEVDDRFFKNTPNKSVLD
FT                   IGSNDGTQLKHFQALGYDVLGVESSKTTAKIAEEAGVPTVNDFFNLEVVKRLDRKFNAI
FT                   NAAGVFFHLEELHSVTEGIREALTEDGVFVVQFLYMKRIVDNLAFDQIYHEHLLYYNLN
FT                   TIEVLLNRHGLSMFDAYLSPIHGGSIIGFVTHKGEKQASDRLQKMRQAEVEEKSNEFST
FT                   YLDFSKRIEQMKADNLAYLDKAKKEGKSVWGFGAPVKGNTMLNYFGVGTQYLDYLVEKN
FT                   ELRRGLYSPGMHIPIVIEKELTELPDIYYVLAWNFKKEILANNQHLIDKGIEFYFPVNP
FT                   QDI"
FT   gene            385122..385286
FT                   /locus_tag="cce_0380"
FT   CDS_pept        385122..385286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0380"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49731"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B1X190"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49731.1"
FT                   /translation="MKTVKKLYETDFNLWLEETARLLKENKLEELDIENLIEEIEAWKE
FT                   VKKKDFVVT"
FT   gene            385379..385573
FT                   /locus_tag="cce_0381"
FT   CDS_pept        385379..385573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0381"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49732"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B1X191"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49732.1"
FT                   /translation="MLDDLEDSPSYKPYYDNIFDKCYQNGRKYAKAQTGLPIKTFPEVC
FT                   PFPKTEILTSDYLPEDDNN"
FT   gene            385799..387307
FT                   /locus_tag="cce_0382"
FT   CDS_pept        385799..387307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0382"
FT                   /product="hypothetical protein"
FT                   /note="contains a thymidylate synthase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49733"
FT                   /db_xref="GOA:B1X192"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:B1X192"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49733.1"
FT                   /translation="MTLKSSNYQFTYTPHYKPNQLICGHGQTAIITGWTVRQTIAKKLN
FT                   PEDYAVIGNLYSPTRGISPLIRNLLANPHVRFLVILDATKEDKNARGCQCLLDFLQQGF
FT                   TQGTSDTGRDIWVINSEITGYIDIEIDANALETLRQSLDYKLVNSISEAINFIKEFSQQ
FT                   KNKQPWGEPLTFPMMETTPTVLPGPRYGHRIEGKTIAETWVKILHRIKTTGTIRPTQYG
FT                   QWQELIDLTSIITDEPLNFYFPSSNYLPIKRDFINDYIGQILDDAPQKEGVKYTYGQRL
FT                   RSWFERDQIQQAIDKLITDKDSSRVVMSLWDVKDYENNDSPPCLNHIWVRIVDNELSLT
FT                   ATFRSNDMFSAWPANAMGLRALQKHIIEQINKTSNHNFQFGPLIIISQSAHIYSDCWEH
FT                   ADKVIETEYTRICQQKNYTDPSGSFLISIKNNQIIVEHITPGSGEVVNCYSGKTAKQVY
FT                   QKIADTCPGLEVKHAMYLGSELQKAEICLVTNTDFYQQDIPLVF"
FT   gene            387353..388039
FT                   /locus_tag="cce_0383"
FT   CDS_pept        387353..388039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49734"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN92"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49734.1"
FT                   /translation="MTILSDQDIRQEIGINIYIYPYKKDNLKGSSYNLTASQLAWDLST
FT                   RKSIYDSSQNKITIQPKTTALIETNESIWVSQKISGTYYSRVREVSKGTGHISTTLDPN
FT                   YIGCSLIALRNHSQSPIEITPETDPFVTLIFQYLHTPSTKEQTRNTSGRRDLLSTLGIQ
FT                   LNKEETEFLDREFMNNKDALLNKLLECDDYKIIQKNESKKKKRDLNKYQIKRKTFFLKN
FT                   NNNILF"
FT   gene            388279..388707
FT                   /locus_tag="cce_0384"
FT   CDS_pept        388279..388707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0384"
FT                   /product="deoxyuridine 5'triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49735"
FT                   /db_xref="GOA:B1WN93"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WN93"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49735.1"
FT                   /translation="MQIKIIKLKEKAIIPKYEHDNDSGLDLVSTETVEIPSGESKLVKT
FT                   GISIELPPNTEAQIRPRSGLALKHQITVLNTPGTIDEGYRGEIGVILINHGKRSFKVTE
FT                   GMRIAQMVIAPVIRVKIQEVEQLSDTIRGQGGFGSTGV"
FT   gene            388915..389181
FT                   /locus_tag="cce_0385"
FT   CDS_pept        388915..389181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49736"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN94"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49736.1"
FT                   /translation="MYILGVGISVGLLVLGGPTNVKETNITRVSREEWAKMKGETDWDK
FT                   IKGMTDEEIEKNALDDPDSQPIPDEMWEDAQVVFPQQNTAVNS"
FT   gene            389515..389634
FT                   /locus_tag="cce_0386"
FT   CDS_pept        389515..389634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49737"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN95"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49737.1"
FT                   /translation="MMKVLLDSNVWISGLLWRGKAREVINLAQQKKITVLCYR"
FT   gene            389906..390448
FT                   /locus_tag="cce_0387"
FT   CDS_pept        389906..390448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0387"
FT                   /product="putative cytidine/deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49738"
FT                   /db_xref="GOA:B1WN96"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN96"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49738.1"
FT                   /translation="MTFLEEQRPTWDEYFIMIAKLAATRSTCLAFPVGAVIVKDRQLLA
FT                   TGYNGSPSGTAHCTAQGFCYPGLDSCDSSSSLPSRAIHAEANAIAQAAKYGISTHGASI
FT                   YVTLEPCVSCLKLIISAGIKDVFYETGFNKGEKALVRDAFLKDGLVNLTQIHLSSETAK
FT                   RASIFLLNPTSVAREMT"
FT   gene            390476..393217
FT                   /locus_tag="cce_0388"
FT   CDS_pept        390476..393217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0388"
FT                   /product="cation transporter, P-type ATPase family, E1-E2
FT                   type"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49739"
FT                   /db_xref="GOA:B1WN97"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN97"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49739.1"
FT                   /translation="MQTKSSSSHLYHELSDLEVLKTFNSDVEKGLTAEEVARRLEQYGF
FT                   NELEIKQGKPAWLRLLLQFHQPLLYILLIAGAIKALLGSWTNAGVIWGVTMINAAIGFI
FT                   QESKAEEAIASLSKAVTTEATVIRDNSTIEIPSRDLVPGDIVLLVSGDKVPGDLRLLRV
FT                   RNLQIDESALTGESLPVTKSVSPLPAETTLAERTNMAYTGSFVTFGQGKGIVVATSEAT
FT                   EVGKISQSLDQRVNLNTPLTRKFTKFSQTLVYVILALATLTFTIGIGQGESWVYMFEAA
FT                   VALAVSAIPEGLPAVVTITLAIGVNRMAKRNAIIRKLSAVEALGSATVICSDKTGTLTE
FT                   NQMTVQSIYAGEEQYSVSGGGYSPKGEISCDLQEPHSHQSIDTLSPVLEDCLKAGLLCN
FT                   DSHLEARHADWMVVGDPTEGALIAAGAKAGLSQAALNNAMPRLDVIPFESEFQYMATLH
FT                   RDGEESQSERVIYVKGSVEAILSRSQYQLQHDGQRVRIDRAFIEDKVERMAEQGLRVLA
FT                   FAKKEVNRYQHSLNHEDIESELIFLGLQGMIDPPRPEAIAAIDNCQSAGIRVKMITGDH
FT                   LATAKAIAQRMGIQLGEKVLAFSGQQLSQMDTATLVKTVEEGSVFARVAPAQKLQLVEA
FT                   LQSQGEIVAMTGDGVNDAPALKQADIGIAMGKGGTDVARDAADMLLTDDNFASIEAAVE
FT                   EGRTVYQNLRKAIAFLLPVNGGESMTILISALLARDLPILSLQVLWLNMINSVTMTVPL
FT                   AFEPKTPGLMQKPPRDPQQPLLTKRLLRRILLISLFNWMLIFGIFEWANTTTGNIAIAR
FT                   TMAIQALVAARIVYLLSISSLGMGLVSRFRSHSTLITNTPMIVIGIATAIILQILFSQW
FT                   GLMNSLFNTAPLNGHQWLICLLPMLPMIPVAFFANCLDSPQS"
FT   gene            complement(393239..393931)
FT                   /locus_tag="cce_0389"
FT   CDS_pept        complement(393239..393931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0389"
FT                   /product="unknown"
FT                   /note="contains a TrkA-N domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49740"
FT                   /db_xref="GOA:B1WN98"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN98"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49740.1"
FT                   /translation="MQSLNFLSSLRRETRQFAVIGLGRFGRAVCGTLHKLGYEVLGTDI
FT                   NEALVAQILAEKLASSAIELDSTKPNALKEAGIFEFDTVIVAIGNYLEESIITTLNAKE
FT                   GGVKYVVAKASSDIHGKLLQRVGADLVVFPEYQAGCDLAHVLTQNPGVMERFELDPDHS
FT                   IVETRIPEEFHGKTLEELKLRSRYKISVLAVGKDDKFNINPPPQEKLNKDLLMVVIGSN
FT                   KAIQKLPI"
FT   gene            complement(393995..395359)
FT                   /gene="trk"
FT                   /locus_tag="cce_0390"
FT   CDS_pept        complement(393995..395359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trk"
FT                   /locus_tag="cce_0390"
FT                   /product="probable K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49741"
FT                   /db_xref="GOA:B1WN99"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B1WN99"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49741.1"
FT                   /translation="MTIARTICVGFLAVIAVGTLLLMLPFATNDGSWNNPLVALFTSTS
FT                   AVCVTGLIVVDTGSYFSFWGQLIILLLIQVGGLGYMTTTTFLILLLGRRFDLRQKLAIQ
FT                   ESFDRPFLHGNSQTLIRSIIATTLIFEILGILLMFNVFAEKYGNLEGLWLAIFHSISAW
FT                   NNAGFSLFTDSLMGFYDSWTINLVIPLLIIFGGIGYQVIMELYMAVVHRITNKRERLMF
FT                   SLNFKVVISTTIILLVAGTIIFFIIEYSNPDTFGQLNFNSKLLTAWFQSVTTRTAGFNS
FT                   IDIGQMTFAGLFLTMGLMFIGASPSGTGGGIKTTTLRILTNCTRSVLRGNDEVVMFRRE
FT                   IAVPLILKAVAVVFGSTNMVVLMTFLISLNEGIVNPSFFDSGVSSLQVLFEVISAFATV
FT                   GLSTGITASLSPISQLLLILTMYTGRVGILLFMAAIVGETQPRVVQYPEETLLVG"
FT   gene            complement(395579..396142)
FT                   /locus_tag="cce_0391"
FT   CDS_pept        complement(395579..396142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0391"
FT                   /product="hypothetical protein"
FT                   /note="contains a Ribonucleotide reductase regulator
FT                   NrdR-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49742"
FT                   /db_xref="GOA:B1WNA0"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WNA0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49742.1"
FT                   /translation="MQCPYCQHTNSRVLESRSSEGGQSIRRRRECLNCKHRFTTYERIE
FT                   FVPITVIKHDGKKESFDASKLLRGMVRACEKTGISHQRLETIVDDIEAYLQQRPQREVT
FT                   THEIGQLVLKYLREENEVAYIRFASVYGRFKGIKDFVETLDQLQEETISSPMSQWSKSS
FT                   TRDRDQSQTSPCLSLTHNGSENSR"
FT   gene            complement(396322..396417)
FT                   /gene="psbT"
FT                   /locus_tag="cce_0392"
FT   CDS_pept        complement(396322..396417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbT"
FT                   /locus_tag="cce_0392"
FT                   /product="photosystem II protein T"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49743"
FT                   /db_xref="GOA:B1WNA1"
FT                   /db_xref="InterPro:IPR001743"
FT                   /db_xref="InterPro:IPR037268"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WNA1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49743.1"
FT                   /translation="MESVAYIVVLTMALAVLFFAIAFREPPRIQK"
FT   gene            complement(396581..396886)
FT                   /locus_tag="cce_0393"
FT   CDS_pept        complement(396581..396886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49744"
FT                   /db_xref="InterPro:IPR018741"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49744.1"
FT                   /translation="MFMEELRKRLNEDMADVNWNDIKPHAQRDAVIVVHENLNLLDVGV
FT                   AIAQDDKMVVEHWITEQLISKPSNQQLSDWNINPTQLFKTLIVQPFVLVQRLGRRE"
FT   gene            complement(396977..398437)
FT                   /gene="npl"
FT                   /locus_tag="cce_0394"
FT   CDS_pept        complement(396977..398437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npl"
FT                   /locus_tag="cce_0394"
FT                   /product="glycoside hydrolase family 13, putative
FT                   neopullulanase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49745"
FT                   /db_xref="GOA:B1WNA3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49745.1"
FT                   /translation="MAIKTPDWVKHAVFYQIYPDAFARKVPPHQKWLLDVPLEDWDAPP
FT                   TYQGYKGGNLWGVIDKLDYLQDLGVTALYFTPIFRSASNHRYHTHDYYGIDPLLGDREA
FT                   FDLLLKAAHEKGFKVVLDGVFNHASRGFFFFNDILENGPNSPWLDWFKIQGWPLSAYDG
FT                   SLPANYVSWIDYRALPQFNHDNPAVREYIMQVGEYWLHQGIDGWRLDVPDCVKADGFWE
FT                   EFRERVKGVNPEAYIVGEIAFDATQWLDGKQFDGVMNYPFGRLTAAFIIGDRVDKDIIP
FT                   HFYEPYEPLDAPGYAKGIEELLARHPWEIQLTQLNLLDSHDTSRFLSIAKGDRTSAKLG
FT                   ALLLFTFPGTPNIFYGDEIGIEGGHEPDCRKGFPAEEKWDSEALAYYKQLIRIRKKYRA
FT                   LCTGDYQTLYAQEKVYVFARISEEEALIIAVNNGQEKAEINLSELEKVPSLLTIKPNNM
FT                   IHGEGSSNWDNAQLQLIIPPRCGLILAS"
FT   gene            complement(398565..399383)
FT                   /locus_tag="cce_0395"
FT   CDS_pept        complement(398565..399383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0395"
FT                   /product="nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49746"
FT                   /db_xref="GOA:B1WNA4"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49746.1"
FT                   /translation="MKPYLAAAIQMTSKPDLDKNLVEAEELIELAVRRGAELIGLPENF
FT                   AFLGEEEDKLSQAKEISQKAQKFLKTMAQRFQVTILGGGFPVPVEGDPSKAYNTAILVD
FT                   PTGKELYRYQKVHLFDVDLPDGNTYQESSTVMPGSQLPDIYPSQDLGNLGLSICYDVRF
FT                   PELYRHLSHQGVDVLFIPAAFTAFTGKDHWQVLLQARAIENTCYIIAPAQTGNHYARRF
FT                   THGHAVIIDPWGIILEDAGQQPGMALAEINPQRIKQVRQQMPSLQHRVFM"
FT   gene            complement(399453..400826)
FT                   /gene="fumC"
FT                   /locus_tag="cce_0396"
FT   CDS_pept        complement(399453..400826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="cce_0396"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49747"
FT                   /db_xref="GOA:B1WNA5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49747.1"
FT                   /translation="MRIEQDSMGKIEVPSEAYWGAQTQRSLHYFAIGHDTMPREMIRAI
FT                   GILKKATAIVNKDLGKLAPEKAKLIIEAADEVISGKLNQHFPLKIWQTGSGTQTNMNAN
FT                   EVIANRAIELAGGILGSKDPIHPNDHVNMSQSSNDTFPTAMHIAAVEEIHRNLLPMVTK
FT                   LKNSLETKTKEFQNVVKIGRTHLMDAVPLTLGQEFSGYISQLDKDIARIQQSLPDLYEL
FT                   AIGGTAVGTGLNTHPDFAEKVAQEIAQITDLPFISAPNKFAALAAHDAMVMCSGTLKTL
FT                   AGSLMKIANDIRWLGSGPRCGIGELILPANEPGSSIMPGKVNPTQCEAMTMVCVQVMGY
FT                   DTAITMAGSQGNFELNVFKPLLIFNLLNSIRLLADACSSFADHLVVGLKINQEQIEHYL
FT                   NNSLMLVTALNPHIGYDKAAKVAKKAYEENTTLEAACISLGFLSQEEFKTIINPEKMT"
FT   gene            complement(400844..401833)
FT                   /locus_tag="cce_0397"
FT   CDS_pept        complement(400844..401833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0397"
FT                   /product="hypothetical protein"
FT                   /note="contains a HTTM domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49748"
FT                   /db_xref="GOA:B1WNA6"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49748.1"
FT                   /translation="MPELMKKATKKLYSFWFAKESTLSLGVFRIIFGLFILNILLLSYF
FT                   HWNEYYGVNGLISLDRFINARGGWFLASFKSIFALSNNPQFIWLIYGLSLGITLCFIVG
FT                   LGTRIATIFLYIIWFSLCNRNSAIIDGKDVVVQMLLFYSCFAPLGNSLSVDNIFRAKLL
FT                   RQRRHILRYVPAKQSVWGLRLLQFSIAFIYPFSAIDKLYSDIAWREGSIMYYISLYDAW
FT                   FRFTDVELFHNYFLSIMTTYSALILEFLFPILVWFKRTKYWILSIMALFHISIAIVMNE
FT                   FVLQFSLVMLISYTLFIEPKTIKKLFSIFKRKYSVLSQKLIIENKVNF"
FT   gene            complement(401821..402363)
FT                   /locus_tag="cce_0398"
FT   CDS_pept        complement(401821..402363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49749"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49749.1"
FT                   /translation="MISQLATNKSVNYLKKVGVVVIVIGSLGSHLVHNTPLNSPIFPHL
FT                   FARFTALTAMSSQWRMFSVVDRFSWRLEIVAIHKNGKTQTLPIFAEQETGFFEKHFINF
FT                   REGKLHQNLFVYPDARYHYSDYLCRIFQNETNPIRTIRYDLFWRQILPPQQAAIRDQYL
FT                   TEEFSDLGKLGEYQCQN"
FT   gene            complement(402666..404006)
FT                   /gene="natB"
FT                   /locus_tag="cce_0399"
FT   CDS_pept        complement(402666..404006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natB"
FT                   /locus_tag="cce_0399"
FT                   /product="probable ABC transporter periplasmic branched
FT                   chain amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49750"
FT                   /db_xref="GOA:B1WNA8"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49750.1"
FT                   /translation="MRSESIMNSLLTQYRLKSPLAWGLALAFSSSLLVGCNNPTPTDTG
FT                   TSPSPNTPTASGEGLKLGALLPVTGDLSSIGANMPEAVKLAVDEINACGGVNGQPVTLV
FT                   TEDTQTDPTAGGAAMTKLAEVDRVAGVVGAFASSVSGAAVGIAAQNKVMLISPGSTSPV
FT                   FTDQAKNGEFNGYWARTAPPDTYQAQALAALAQKQGFENVSTVVINNDYGVGFEQQFVG
FT                   SFEKAGGKLTNKEQPVRYDPKAATLDSEAAAAFANNPDAVAAVLYAETGSILLQAAYKQ
FT                   GLSEGVTVLLTDGVYSEDFVEQVGKTPDGKYILEGALGTVPGADGQALDAFTTKWNEKT
FT                   GKDVTAFVPHSWDATILLMLAAEAAKANTGEAIQSKIREVANAPGTEVSDPCEAIALVR
FT                   DGEDINYQGASGNVDIDENGDVVGSYDVWTVKADGTTEVIDKVSPTE"
FT   gene            complement(404144..404230)
FT                   /locus_tag="cce_RNA007"
FT   tRNA            complement(404144..404230)
FT                   /locus_tag="cce_RNA007"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC; tRNA-Ser1"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            404380..404646
FT                   /gene="psaK1"
FT                   /locus_tag="cce_0400"
FT   CDS_pept        404380..404646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaK1"
FT                   /locus_tag="cce_0400"
FT                   /product="photosystem I reaction center subunit X"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49751"
FT                   /db_xref="GOA:B1WNA9"
FT                   /db_xref="InterPro:IPR000549"
FT                   /db_xref="InterPro:IPR017492"
FT                   /db_xref="InterPro:IPR035982"
FT                   /db_xref="InterPro:IPR037101"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNA9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49751.1"
FT                   /translation="MYSTLLLAASAVPTTIQWSPKVAMIMIVCNIFAIAVGKFTIAKPS
FT                   EGPGLPSPQMFGGMGLGALLGTTSFGHILGAGVILGLANTGAL"
FT   gene            complement(404718..406037)
FT                   /gene="murA"
FT                   /locus_tag="cce_0401"
FT   CDS_pept        complement(404718..406037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="cce_0401"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49752"
FT                   /db_xref="GOA:B1WNB0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49752.1"
FT                   /translation="MTTPLDEQQSVLEIQGQTPLRGEVNISGAKNSALVLMAGAILCSE
FT                   DCRLRNLPLLVDIERMTQILAAIGVKLNRKGDVIDINAQDIGQDQAPYELVSQLRASFF
FT                   VIGPLLARLGMTRVPLPGGCAIGARPVDLHVRGLQAMGADVRIEHGVVHACVRGSRKRL
FT                   QGAKIYLDYPSVGATETIMMAATLAEGETIIENAAQEPEIADLANFCRSMGAKIKGAGT
FT                   NKIIISGVERLHSTDYCVIPDRIEAGTLLIAGAITQSEISLSPVFPEHLASVIAKLREM
FT                   GPQVIMEGPDRLRLVPAPVRATDIKTLPFPGFPTDMQAQFMALLTLSEGSSMVTETVFE
FT                   NRLRHVAELQRMGADIRVKGNIALVKGVPFLSGAPVMATDLRASAALVLAGLAAQGTTL
FT                   VQGLHHLDRGYDNLEGKLRKLGANIRRISVVDEPEYSALS"
FT   gene            406277..406360
FT                   /locus_tag="cce_RNA008"
FT   tRNA            406277..406360
FT                   /locus_tag="cce_RNA008"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUG; tRNA-Leu4"
FT                   /inference="profile:tRNAscan-SE:1.23"
FT   gene            406388..407176
FT                   /gene="spoU"
FT                   /locus_tag="cce_0402"
FT   CDS_pept        406388..407176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="cce_0402"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49753"
FT                   /db_xref="GOA:B1WNB1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49753.1"
FT                   /translation="MITSIRNPLIKQIRKLHRTKGRREHNLLLLEGTHLVETAYKENCS
FT                   LITLCYTEEWQARYPQLWESVSKRVKRSELVSADVLASMTTTVNPDGVVATARFQPRTE
FT                   EEITDFRLGLIIERLQDPGNLGTIIRTAAAVEIDAIWLSDDSVEIDNPKVLRASAGAWF
FT                   QVPIFVTSDLTTVIKKHKNHGVNIVATLPNATETYWQLQFTQPTLILLGNEGSGLSNSL
FT                   IALADELVSIPLSQGVESLNVAIATALLLYEAKRQKIFNS"
FT   gene            complement(407222..409021)
FT                   /locus_tag="cce_0403"
FT   CDS_pept        complement(407222..409021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0403"
FT                   /product="hypothetical protein"
FT                   /note="contains a MscS mechanosensitive ion channel domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49754"
FT                   /db_xref="GOA:B1WNB2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49754.1"
FT                   /translation="MISKTRKIRSILTIMLLTLLSLLSLHFYSPTIAQIKPISLLEISS
FT                   ERDLFSNYILAQESQQKEESSSDESLNIDPPAPVKLDGETLFEFRTNIEGIPNQERAEV
FT                   AMKRIKEVAKDRSININNLVIKTIDDLYIIYVDNNLLLYLGESDAQANNKPLEELAQNY
FT                   SEIIKNAIIEYRKKRTLSYFGIRGLLSLLSTILVIVIFRFLNWFVPVVSRRILEGRSVL
FT                   FRTLRIQNWTLLSIYRQKQLTILSLKIIRWIIIFILLYFYIPLVLSLFPQTERLGKSVF
FT                   NSFFGALGKVWAGFIDYLPNLFLIIITLVITHYLIRLCHPFFRAVEEERVTISGFYPDW
FT                   AEPSYKLTVILIIGLAAAIIFPYLPGFDSPAFQGISILAGALVTFGGASTIANLIGGFV
FT                   VIYTRAFQIGDRIKIDEYQGVVIEKTILSTRIRNQNNEIITIPNSILIISKIINYTATT
FT                   RDLEQPLILHTTITLGYDVSWRLVHETLTNCALDTTDILDDPAPYVWQTSLDDFYISYQ
FT                   LRVCTNKTTSIEIGDIYTELHQKIQDKCAEVGIEIMSPHYAAVRDGNQNTIPENYLPKD
FT                   YKTPGFRLHPLESFFQGNIEKDN"
FT   gene            409232..410092
FT                   /gene="purU"
FT                   /locus_tag="cce_0404"
FT   CDS_pept        409232..410092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="cce_0404"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49755"
FT                   /db_xref="GOA:B1WNB3"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49755.1"
FT                   /translation="MSMNGSTATLLISCPDQQGLVAKFANFIYDNGGNIIHADQHTDFE
FT                   AGLFLTRIEWQLNGFKLSRDMMASSFASVAKPLQAVWEIHFSDTIPRLALFVTKQDHCL
FT                   LDLLWRWQAKEIRADIPLIISNHEKLKAIAKQFDIDFYHFNLTKENKNRQEARQLELLR
FT                   EHRINLVILAKYMQILTPEFINHFPHIINIHHSFLPAFAGAKPYHRAHERGVKIIGATA
FT                   HYVTADLDEGPIIEQDVVRVSHRDTIPDLIRKGKDLERVVLARAVRLHLQHRVLVYGNR
FT                   TVVFA"
FT   gene            410220..411113
FT                   /gene="mmsB"
FT                   /locus_tag="cce_0405"
FT   CDS_pept        410220..411113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="cce_0405"
FT                   /product="putative 3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49756"
FT                   /db_xref="GOA:B1WNB4"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49756.1"
FT                   /translation="MTQQLAFVGLGLMGGFMAANLAKKGLAVKAWNRSPNRPGITIAHN
FT                   AGAMIAPSIEAAVKEADIIFTCVGDVPDVNDVIFGENGIINHAKPGALIVDFSTIGTQA
FT                   AREIGTQLKAQQFRFLDAPISGGDIGAKQGTLTIMVGGEKKDFEECFPYFEAMGKIIIY
FT                   CGSTGNGQAVKMCNQALCSVHMIALCEAIKMAETQNIDPNLMIEVCQTGAAGSWALANL
FT                   GPKIVDSDLEPGFAIKHLLKDLRLVQEIMAESDNQLPGVALAESFLKVVANMDNGKAKE
FT                   QGTQAMIRYYNQENNV"
FT   gene            411106..412404
FT                   /locus_tag="cce_0406"
FT   CDS_pept        411106..412404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49757"
FT                   /db_xref="GOA:B1WNB5"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49757.1"
FT                   /translation="MSKKLIFQGTTTYVSEHWYAKVIFPLVEVKKLLQTIYEFLLHLIW
FT                   SELIYGKKLDNELDSLVAFFIFCLLSLLGYYFRDYVQIIIIVFFIIWYLDCWFAKHQYF
FT                   QKNSKIDIYLYEIDKNKIIGCLSLPKTTTQSVFASFSLEEVNYISIIKLPLLGGTFQEI
FT                   LDEVWQTEIYLYNGKHFVVDENLFPHESLVTAKKLANYFKADIIFAHSQGKHSYVEQEL
FT                   NPIFLSHLFNQNSGGVRYQKNSRKIHIYTQWQWSNSWNFLKRLFEKAGFFVFIIIMSGF
FT                   MIKWGGLLNNIILVIRGKDDIIYLSSPLQWLIPNWHWRNILEFVVVLGVFIYQGWQLSR
FT                   VKHIYITKYYLKFFIDNKMINKIKTSDIKISFVINNSYPEILIIGENKVVNITKFQQEN
FT                   IAQIFWSYLDEALKTFQQQQPKRLDNQVPEEKD"
FT   gene            412505..413851
FT                   /locus_tag="cce_0407"
FT   CDS_pept        412505..413851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0407"
FT                   /product="unknown"
FT                   /note="contains Mur ligase and DUF1727 domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49758"
FT                   /db_xref="GOA:B1WNB6"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49758.1"
FT                   /translation="MNIVDRVRLGLAVGVAKTITAAVRVLGLGAASVLPGAISRRFHPR
FT                   LLSLLCEQVKQGVILVVGTNGKTTTSLLLRTILEDQNYKVAHNETGANLINGLVTALLN
FT                   KTNLIGTLTADYAILEVDENIVPLLLKDCQPRVLLGLNLFRDQLDRYGEVDAISQRWQT
FT                   AIGPLSPETIIILNADDPTLSYLGQQLTQKVRYFGLSEPNLYLDEIPHAVDSIYCPSCG
FT                   YPLTYEGVYLSHLGDYSCEKCGFHKSPLDLNSQDWPQILIGVYNKYNTLAAGLVAQELN
FT                   IEKKPIFQTVKQFKAAFGRAEELTIKGKQVRILLSKNPVGMNETIRAVNDIKKMGKSST
FT                   TLLVLNDRIPDGTDVSWIWDVDTEPLVKLGGNLVVSGDRTYDMALRLKYSQDTLPEKNN
FT                   HVKLIVKENLQEAIETALNLTTEAETLHIVPTYSAMLEVRGILTGRQIL"
FT   gene            414049..414546
FT                   /locus_tag="cce_0408"
FT   CDS_pept        414049..414546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0408"
FT                   /product="hypothetical protein"
FT                   /note="contains a HNH endonuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49759"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49759.1"
FT                   /translation="MGKVLVLNASYEPLNITSWRRAVVLLIKGKAEQLENNERFIYTDF
FT                   PLPSVIRLRHYVRVPYKEIPLTRRNILERDRHTCQYCRYKGEQLTLDHVIPRSRGGGET
FT                   WENLVTACVRCNVKKGNRTPKEAHMNLRHPPRRPYSSLQFELVKHTRGNLNQEWRKYII
FT                   GI"
FT   gene            complement(414543..414752)
FT                   /locus_tag="cce_0409"
FT   CDS_pept        complement(414543..414752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49760"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49760.1"
FT                   /translation="MLVILTRDNILSVNQVCPGCLLADQKGTPRWHHGKLGCGHSLDKR
FT                   DTRQAQVYQCEMGFQVAEVDGQLA"
FT   gene            416243..418183
FT                   /locus_tag="cce_0410"
FT   CDS_pept        416243..418183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0410"
FT                   /product="reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49761"
FT                   /db_xref="GOA:B1WNB9"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNB9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49761.1"
FT                   /translation="MVRICRRTHGEMECRGTSSSKMPKTDSKQKTVGWDKNLTRFKQEI
FT                   ETQDDWGKINWKNLERKVYKLQKRIYKASSRGDVKAIRRLQKTLIKSWSAKCLAVRRVT
FT                   QDNQGRKTAGVDGVKSLTPKQRLTLVNQLKLSPKVKPTRRVWIPKSGTDEERPLGIPTM
FT                   YDRALQGLVKMALEPEWEARFEPNSYGFRIGRSCHDAINAIFKAIKCKSKFVLDADISK
FT                   CFDRINHKKLLEKLNTYPTLRKQIRAWLKAGVMDGKELFPTLEGTPQGGVLSPLLANIA
FT                   LHGMEECIKELTESHSMKRENGKYEKPLKHKRQSVSLIRYADDFVILHEDITFILKCKD
FT                   RIAKWLNGMGLELKPSKTRLTHTLNDYEGEKAGFDFLGFHIQQFKAGKYRTGKDTSGKP
FT                   LGFKTIITPSQKSLRRHYEKIAEVIQRYRGKSQVVLIKQLNPIIRGWCNYFATVQSSKA
FT                   FSKLDALIFWKLYKWGKHRHHTKTKRWVLNKYWTPINGDNWVFAKKGNNPLRLSKHSET
FT                   KIQSFIKVRGESSPYDGNLIYWSTRMGKNPEMPKRTAFLLKRQKGRCAHCGLFFQERDV
FT                   IELDHIIPKSKGGEDKYQNWQLLHRHCHDEKTTKDGSLGTQSGCNSTKPKSLFENPKDY
FT                   LWIDDMLVTTF"
FT   gene            complement(418398..419000)
FT                   /locus_tag="cce_0411"
FT   CDS_pept        complement(418398..419000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0411"
FT                   /product="putative acetyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49762"
FT                   /db_xref="GOA:B1WNC0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49762.1"
FT                   /translation="MELESNSSPITDDQPWVDLCQYDQSWYDRGRPGWYVLLWWLVQSI
FT                   AFPLSLHNANNFRCWLLRLFGAEIGKKVIIRPTARFTYPWKVSIGDYSWVGDDVVFYSL
FT                   EAIKMGSHSVISQKCYLCTGSHDFQDTTFNLVVKPIIIGNGVWIATDCFIAPGVQIGSN
FT                   AVIGARSSVFRDIPTAMVAWGSPCKVHYPRAMKSVFT"
FT   gene            complement(419005..419955)
FT                   /locus_tag="cce_0412"
FT   CDS_pept        complement(419005..419955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0412"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49763"
FT                   /db_xref="GOA:B1WNC1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49763.1"
FT                   /translation="MFKMTAKVPVSVLIPALNEELNLPACLESVARADEVFVVDSQSSD
FT                   RSIEISEEYGAKVVQFHFNGRWPKKKNWSLENLPFRNEWVLIVDCDERITPELWDEIEE
FT                   AIKNNNFNGYYLNRKVFFLGKWIRYGGKYPDWNLRLFRHQSGRYENLNTEDIPNTGDNE
FT                   VHEHVILQGNVGYLKEDMLHIDFRDIYHWLQRHNRYSNWEARVYYNLLTGQDDSGTIGA
FT                   NLFGDAVQRKRFLKKIWVRLPFKPLLRFVLFYFIRLGFLDGRAGYIYGRLLSQYEYQIG
FT                   VKLYELRQFGGQLNVNKNPQPTDSKTTSEPIKVKL"
FT   gene            420112..421647
FT                   /locus_tag="cce_0413"
FT   CDS_pept        420112..421647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0413"
FT                   /product="unknown"
FT                   /note="contains a secretion protein HlyD domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49764"
FT                   /db_xref="GOA:B1WNC2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49764.1"
FT                   /translation="MFDTKQPSSTTEESNRKVNKMSQEKEKKSGIRRWPLIWGVLILIT
FT                   TTGSGVTWWLTQQSNNKSSSALAQATPPTSVKLDTLKPGVVKNVSDVVGTLEAQDAVIL
FT                   RPEIQGRINEILVREGDLITKGQQILQLDSSDWQAELLEAQAQLASRKARLAELEAGNR
FT                   VEDIQEAKARLREAKARLSNAQAGGSLEEIAQAEAQVNAAQASAELAQQRVARYKTLEQ
FT                   EGAVSTDEYQEYVTEARNASAELEQAQRRLSQLKKSRLTDIDELQAAVEREEQNLRRLQ
FT                   TGPRQEVIAQARADVAEAIAQVRTAEVNVSKTRIVAPISGIVGDIPVEAGDYVGQGDTL
FT                   TTLTQNHFLELNLSIPLEDASRLRLGLPVQIIDNQGKAIATGNISFISPNVTADSQLVL
FT                   AKATFDGNNRSLLNRQFIQARIIWQQGQGLLIPTTAVSRLGGQTFVFVAQANDSNKEGA
FT                   APFIAEQRQVELGEVQGNNYQVISGLQPGEKIVTAGILQLKDGAPIQEVNNQK"
FT   gene            421677..424802
FT                   /locus_tag="cce_0414"
FT   CDS_pept        421677..424802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0414"
FT                   /product="RND multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49765"
FT                   /db_xref="GOA:B1WNC3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49765.1"
FT                   /translation="MNFVDFFIKRPVFSSVCALLILLVGLISLLNLPLDQFPEITPTRV
FT                   QVESTYNGASAEVVENAVTNILERQINGVEGLRYISSSSSNSGTSSITVTFDSSRNPDL
FT                   ASVDVQNQVSVVQSQLPDAVQRTGVQVTRQSNSLLLGIGLYSDNNRYDNVFLSNYADQY
FT                   LVDALKRLDGVGNVRIFGERRYAMRLWLDPNKLASRGLTTQDVVNALSEQNLQVGAGKI
FT                   GAEPAPDGQQFQFDLRAISQLKDPKEFENLLLKTDENGGLVYFKDVGRAELGAQDYSSF
FT                   LRFRGQEAVGMGIYQRTGSNALEVAKRVEQEMDRLSAFFPPDLQYVVAFDTTQFIEESL
FT                   SEVVKTLFMAVGLVIIVILIFLQNWRTTLIPALTIPLALIGTFAFIKLFNFSINSLTLF
FT                   GLTLATGMVVDDAIIVVEQINRYIEDENMSPQAAASKAMGELSSAVIATSLVLMAVFIP
FT                   VAFFPGTTGALYRQFALTIAFSIVISTFLALTLTPSLCALLLEKGQKLPGFLGTIFNQF
FT                   NHFLDWVKGQYRRSLHTLSNLRLAVVGVFAVLLLLTAWLYTKVPTAFTPEEDQGYFITI
FT                   IQAPQGVSLQYTSDVMRQVENIILEEPDVKATFAVGGFAFGGSSANQGVIFSPLKPFKE
FT                   RPGPQHSAQAIIGKLWGKFSQIPEANIFPVNPPAIRGLSNFGGFVYQLQDQQGSEDINK
FT                   LVQVMGQLLGAANQNPAIGQAFSRFSADTPQFLIEVNRNKAQALQVSIDDIFSTLQTAL
FT                   GSRYVNDFTLQQRTYRVYIQADKEFRANPQDINQLYVRSQNGQMVPLSNLVTLTPTTGA
FT                   QTISHYNLYRSVEINGSPAPGVGSGTALEAMETVSQQVLPPGFGYEWSGTSLEELDSAG
FT                   LAPIIFGLGLLFVFLVLAAQYENYIDPLIIIVAVPLAILGALTAQLLRGFANDVYCQIG
FT                   LVMLIGLASKNAILIVEFANQLRDEGLPLVKAAIEAAQERLRPILMTAVSTLLGIFPLV
FT                   VATGAGSGSRQSLGTAVFGGMLVASFLSLFVVPILYIVIKMTTEKFLPKKSS"
FT   gene            complement(425034..426770)
FT                   /locus_tag="cce_0415"
FT   CDS_pept        complement(425034..426770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0415"
FT                   /product="hypothetical protein"
FT                   /note="contains FbpA fibronectin-binding and DUF814
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49766"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49766.1"
FT                   /translation="MQSVDVTTLSAICYDLQTHWIPAKVEQVYQRDRYTIFIALRTLKK
FT                   RSWLTISWHPQAARLCIGDSPPRTPDTFTFSDQLRHQLNGFALIALKMISPWERVVDLQ
FT                   FAKRPGDEPVWHLFVEIMGKYSNVILTDSKQQIVAVAHQVNANQSTVRTVQTGQPYELP
FT                   PALTGTFPKLEEDQTRWQERVSLIPGSLKKQLLNSYRGLSPVVASSMIKEAGLNPQDST
FT                   ESLTEKDWKKLYQCWQFWLKSLKTKQFKPGYTEEGYTVLGWGIIDKIINIQTLINDYYA
FT                   NKINQEKFKQVKHQLQQKLKSCLKKLYSKANNFNQKIQQSSEADEYRQKGDLLMAHSHL
FT                   WEPGMNSMTLKDFETEKPIKIPLNPEKNAIQNAQLCYKKHQKLKRAKGAVEPLLNEVQE
FT                   EINYLEQVEDSLQQIDDYQSLEDLQTLQEIKEELIQQNYLPSPAQQMSNISDESQPYQH
FT                   KTPSGFEVWIGRNNRQNDRLTFRTAGDYDLWFHTQESAGSHVLLRLEPGAVPNEADLHC
FT                   AADWAAYYSKARQSEQVPVVYTEPKYVYKPKGAKPGMVIYKRERVLWGKPHKIQSYLKN
FT                   HD"
FT   gene            complement(426845..427465)
FT                   /locus_tag="cce_0416"
FT   CDS_pept        complement(426845..427465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0416"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49767"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49767.1"
FT                   /translation="MFSGGVLCMKGLLSILLMSAVITVPNKALSTPILPSLLLSQPNRE
FT                   EHLDQKIQVAFPEFAVVYLKSGNMTTGNFIDLNNRSLIISFKGYTTGIPLNEIKSIEFK
FT                   DQVLIPADETVICQRSNNQCRPVPFNQDQDQEPTILENIPITNLSLFQGAKTALLTVSN
FT                   TSQNEGRENINYLSNENINIINSLEIDESGELITLTLIPTKRK"
FT   gene            complement(427642..428214)
FT                   /locus_tag="cce_0417"
FT   CDS_pept        complement(427642..428214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0417"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49768"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49768.1"
FT                   /translation="MSIKSSHYEQLLCEYSDRLSAISLLKQHRSYLEMIPSLRRPEESL
FT                   ITIPLPVVKVRQPKPLNESRLTSPNIQEAIQLPCDLAIIMCDPEWKIKLGSEILIFIHR
FT                   PHEDFSHLLSRWRQTQIHLDKDYEWLMPQTEAHMLSEGGEKVYPLFVVFENTLDRIKKG
FT                   LKGADLPYIVQNSIPEGSEEMLESISE"
FT   gene            complement(428303..429517)
FT                   /gene="pilC"
FT                   /locus_tag="cce_0418"
FT   CDS_pept        complement(428303..429517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="cce_0418"
FT                   /product="pilin biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49769"
FT                   /db_xref="GOA:B1WNC7"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49769.1"
FT                   /translation="MPTYIAQVKDLQGKISKQKVQATSPDQARAMLRQQYPAIGKISEA
FT                   GMQFDFSGIGGALNNVSVKDKAIFSRQFSVMINAGVAIVRCLGVLADQATNPKLKKALL
FT                   AISAEVQQGVSLSEALGKHEDCFDQLYVSMVEAGETGGVLDEVLNRLAKLLEDMARLQN
FT                   QIKSAMAYPVTVGILAVIVFFAMTIFLIPVFAGIFEDLGAELPALTQFMLYLSGIMRSW
FT                   KILIPIVGGFALVFGIKQYYKTPVGRLQIDKFLLKMPLFGDLNEKSAVARFCRVFGTLT
FT                   RSGVPILTSLEIVCNTVGNKVIANAVAGAQAEIQQGGMMSLALQNANVFPQLAIQMICI
FT                   GEETGELDAMMMKVADFYEDEVEQAVKALTSVIEPLMMVLIAGMVGVILLSMYLPMFKI
FT                   FDQLA"
FT   gene            complement(429557..430663)
FT                   /gene="pilT1"
FT                   /locus_tag="cce_0419"
FT   CDS_pept        complement(429557..430663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT1"
FT                   /locus_tag="cce_0419"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49770"
FT                   /db_xref="GOA:B1WNC8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49770.1"
FT                   /translation="MDMMIEDLMEQLVEMGGSDMHIQAGAPIYFRISGKLAPIDEEPLS
FT                   PQESQKLIFSMLNNTQRKELEQNWELDCSYGVKGLARFRVNVYKERGCYAACLRALSSK
FT                   IPNFEQLGLPNIVREMAERPRGLVLVTGQTGSGKTTTLAAILDLINRTRQEHILTVEDP
FT                   IEYVFPNVKSLFHQRQKGEDTKSFANALKASLREDPDIILVGEMRDLETISLAITAAET
FT                   GHLVFGTLHTNSAAGTIDRIVDVFPANQQAQIRAMLSNSLIAVFSQCLAKKKNPKPGEF
FT                   GRAMAQEIMIVTPAIANLMREGKAGQIYSAIQTGMKLGMQTMEQALANLVVSGAVSFEE
FT                   AISKSAKPDELQRLISGATAAVKGRVRR"
FT   gene            complement(430700..432733)
FT                   /gene="gspE"
FT                   /locus_tag="cce_0420"
FT   CDS_pept        complement(430700..432733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="cce_0420"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49771"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNC9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49771.1"
FT                   /translation="MSSLSSSNLSSSKRSRAVALRNYFSPFGNKLIEAGYVGPDQMKQA
FT                   LVETRKSGRPLTEVLQVMTGEPLSPDLLRQYKKHHLFELKILYGVDSIDPEVSPVADRQ
FT                   MAELINSLISFDICRRHRILPLSQHGGEPPSVLVAMVDPDNLAAQDDLNRILRAKNLEL
FT                   RRMVITQEDYDRLLEQYHELQGEIDAENERLKQEAAMNKMADLTAIVGNLDASISDAED
FT                   ESHDALDSNDADQAPIINLVNKILAKALQEGTSDIHVEPQEETLRIRFRKDGVLQQAFD
FT                   PLPRKVTPAVVARFKIMADLDIAERRLPQDGKIRRIYQGRKVDFRVNTLPSRYGEKVCL
FT                   RILDNSATQLGLDKLITNQETLQIVRDLASRPFGLFLVTGPTGSGKSTSLYSVLAERNN
FT                   PGVNISTAEDPIEYSLPGITQVQVIREKGMNFASILRAFMRQDPDVILVGETRDVETAK
FT                   TAIEAALTGHLVLTTLHTNDAPGAVARLDEMGVEPFMISGALLGVLAQRLMRRVCSECR
FT                   VAYHPTKAELARFGLSASNDDEMTIYKANKLTADEITEAKQNGTLCEKCGGSGYKGRVG
FT                   VYEVMRNTERIQSLINEGATTDRIKEAAVEEGMITILAYSLQLVQEGHTTLEEVERVTF
FT                   TDTGLEAELKAKRKSSLECKTCHAGLEPEWMDCPYCMTPRFT"
FT   gene            complement(432814..433008)
FT                   /locus_tag="cce_0421"
FT   CDS_pept        complement(432814..433008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49772"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49772.1"
FT                   /translation="MKISWKKLLIQTSVWITSEIVLNLIGLDNIADYSEFIFKQKETIF
FT                   LTTAISERSALRCAYVIVG"
FT   gene            complement(433248..434807)
FT                   /gene="kaiC1"
FT                   /locus_tag="cce_0422"
FT   CDS_pept        complement(433248..434807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiC1"
FT                   /locus_tag="cce_0422"
FT                   /product="circadian clock protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49773"
FT                   /db_xref="GOA:B1WND1"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR013503"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49773.1"
FT                   /translation="MNQPLPRENQPQPLAPKGVRKIRTMIEGLDEITHGGLPLGRTTLA
FT                   SGTSGTGKTLLAVQFLYHGIKYFDYPGLFVTFEESPHDIIENAYSFGWDLQKLIDEGQL
FT                   FILDASPDPEGQEVVGNFDLSALIERIQYAIHKYKAKLVSIDSVTAVFQQYDAASVVRR
FT                   EIFRLVARLKQLGVTSILTTERVEEYGQIARFGVEEFVSDNVLILRNVLEGERRRRTIE
FT                   ILKLRGTTHMKGEYPFTITNDGINIFPLGAMRLTQRSSNARISSGVETLDEMCGGGFFK
FT                   DSIILATGATGTGKTLLVSKFLEEGCRQGERAILFAYEESRAQLSRNAFSWGIDFEEME
FT                   RKGLLKLLCTYPESAGLEDHLQIIKSEISEFKPSRIAIDSLSALARGVTNNAFRQFVIG
FT                   VTGYAKQEEITGFFTNTTDQFMGAHSITESHISTITDTILMLQYVEIRGEMSRAINVFK
FT                   MRGSWHDKGIREYMINQDGPIIQDSFRNYERIISGSPSRITVDEKSELSRIVRGVKDKT
FT                   EE"
FT   gene            complement(434900..435220)
FT                   /gene="kaiB1"
FT                   /locus_tag="cce_0423"
FT   CDS_pept        complement(434900..435220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiB1"
FT                   /locus_tag="cce_0423"
FT                   /product="circadian clock protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49774"
FT                   /db_xref="GOA:B1WND2"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR013474"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49774.1"
FT                   /translation="MAMIDFKKTYVLKLYVAGNTPNSVRALKTLKNILEDEFKGVYALK
FT                   VIDVLKNPQLAEEDKILATPTLAKILPPPVRKIIGDLSDREKVLIGLDLLYEEIKEREN
FT                   DP"
FT   gene            complement(435307..436203)
FT                   /gene="kaiA"
FT                   /locus_tag="cce_0424"
FT   CDS_pept        complement(435307..436203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiA"
FT                   /locus_tag="cce_0424"
FT                   /product="circadian clock protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49775"
FT                   /db_xref="GOA:B1WND3"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011648"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR020844"
FT                   /db_xref="InterPro:IPR020856"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49775.1"
FT                   /translation="MQTRLSICLYSSDEHLTQLLTHHLSGDRYRLHIIDQLEDLVPFLE
FT                   DHSETIDCLIVKQEPSILPLFNQLYEQGTLVPVIIFEDKVESSDNVEPPTFLYHSAEVR
FT                   YRVKELDEIQVTIDRAITKFLHLGPSCFLTDQSLSSQRDIGTEKNQSFLLLQQRRLAEK
FT                   LKERLGYLGVYYKRNPKYFYRNLSPEDKRELLKELMANYREIILNYFDEDSEVNQAIDQ
FT                   FVNQAFFADISVSRVLEIHMELMDEFSQQLKLEGRSEEILLDYRLTIIDILAHLGEMYR
FT                   RCIPRGDLLFDLLNQID"
FT   gene            complement(436319..437236)
FT                   /locus_tag="cce_0425"
FT   CDS_pept        complement(436319..437236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0425"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49776"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49776.1"
FT                   /translation="MNDIPEFILFAQHGWADTNEEISQLATTLAQEKTIIMTPNLGWVK
FT                   TWLSIDPLIEIVSQKAEEISNKYPQTPWRIIGHSMGGLIWLEVLHQNPQWWEKIHSLVL
FT                   IASPVGGADLARIIDPLAIGVGIASDLGKNRRLKADRITKIVPTLVIAGNTDNGSDGTI
FT                   PISSTKLSYSHFVCLPNISHSQLKNHPVLVDVIQKFWKTSPTPALFEKDFPTVLIERLQ
FT                   LIPGMTDGHPRDFEKAKSYLNFERGISIKLWKNPLNILHVFIANEQQECLYSGFVGWIH
FT                   SEGLYQALEAIHQDYYELVIHGLD"
FT   gene            complement(437253..437891)
FT                   /gene="purN"
FT                   /locus_tag="cce_0426"
FT   CDS_pept        complement(437253..437891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="cce_0426"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49777"
FT                   /db_xref="GOA:B1WND5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49777.1"
FT                   /translation="MENLTPSFISPQVSSEDLKLETPLKLGILASGSGTNFEAIADAIK
FT                   QQELNAKIPLLIYNNPQAKVQEKAAAFNIESKLLNHRHFKRREDLDQAIVDLFKSYNIN
FT                   WVIMAGWMRIVTPVLLGAFPNHVINIHPSLLPSFKGIKAVEQALEAGVKITGCTVHLAS
FT                   LEVDSGPILLQAAVPILQDDTPETLHARIQIQEHKIFPLAIALAAKKYP"
FT   gene            complement(438065..439099)
FT                   /locus_tag="cce_0427"
FT   CDS_pept        complement(438065..439099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0427"
FT                   /product="probable oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49778"
FT                   /db_xref="GOA:B1WND6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49778.1"
FT                   /translation="MDIRTCNINLNHWYVVAQSTEVTTKPIEVRLWYHSIVLYRDSQGK
FT                   IHGLENRCPHRQVKLSEGKVVENNLECAYHGWRFDRQGMCSYIPYLSDNQGLPQCKINV
FT                   YPLEESDGFIWIFLGNKQLLESPTFKPIRIPEWEHLNYIGTVSFIDCQAHFSFLIENLM
FT                   DMYHGHLHNDYQAWTEAKLKELTTTEEAVKGVYDAKSYYKIDKIWSIFQLFFPQFRSLH
FT                   FQPLMVSYCYPHWQSTLGEYFTLYCLFCPISLTHTKAYLIHFTSLNAFWRLHKLPRWFR
FT                   QFIKDKLWGTAQRMLDGLVRQDIIMIEQEQQAYIEGRQKPTYEINPIIPAVKKMIKTQV
FT                   KQQE"
FT   gene            439140..439601
FT                   /locus_tag="cce_0428"
FT   CDS_pept        439140..439601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49779"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49779.1"
FT                   /translation="MTQEWINVTGIITKGHQVASGMAKDSPYPQGTIQMQTPFFQQLGL
FT                   DISLFFSGTLNINIRPYKFKLYNPQYTFKAVKWNAHSPAETFSFSSCQVIHRKTKYTGL
FT                   IYYPHPETKPNHFQDDSTLEILTQPLDYLEYGQSIQLNLNPTEIDIFFD"
FT   gene            439619..440092
FT                   /locus_tag="cce_0429"
FT   CDS_pept        439619..440092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0429"
FT                   /product="putative prokaryotic chromosome segregation and
FT                   condensation protein ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49780"
FT                   /db_xref="GOA:B1WND8"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49780.1"
FT                   /translation="MKLATKIEAILYLKGQPLTLIDIAQWANCEVDTAQEAMMELISDY
FT                   AYRDSALEVVETEAGYSLQLRSLFDDLTDNIIPAELGKGTLRTLAAIALKNPIVQTDLI
FT                   ELRGSTAYQHVQELVELGFVRKRRQESGRSYLLEVTTKFHQYFEIDQFPQSTD"
FT   gene            440175..440534
FT                   /locus_tag="cce_0430"
FT   CDS_pept        440175..440534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49781"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:B1WND9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49781.1"
FT                   /translation="MVFNFDFFASEPEEQNPNTLIQYLQKQHPDTLSRIAQSASPEIQQ
FT                   IITQNVQGLVGMLPSGDFNIQVTTDRENLANLLASAMMTGYFLSQMEQRKNLEANLSNV
FT                   DSISPNQSHDQKGKD"
FT   gene            440534..440653
FT                   /locus_tag="cce_0431"
FT   CDS_pept        440534..440653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49782"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49782.1"
FT                   /translation="MVRGHQVKGTSGVIITYSILSPDNTPVQGLTSSSKASHH"
FT   gene            complement(440621..440752)
FT                   /locus_tag="cce_0432"
FT   CDS_pept        complement(440621..440752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49783"
FT                   /db_xref="GOA:B1WNE1"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49783.1"
FT                   /translation="MTEELINVWKYTMTVDQLLLLIALLSPGILLSALVMGSFARGG"
FT   gene            complement(440958..441356)
FT                   /locus_tag="cce_0433"
FT   CDS_pept        complement(440958..441356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0433"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49784"
FT                   /db_xref="GOA:B1WNE2"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49784.1"
FT                   /translation="MEIVQKTELGKVDSLTFVKSFLVWSFTLIVCLLVVGFPLVVLMAT
FT                   FGALASVVLQSVLPVSAVLLVVGSLIGVNLLVVFLGAALLTVKGIHPQDVHWLRWLHGE
FT                   ATPSHTSIYAACPLTCNLAQEVLSGHIC"
FT   gene            441846..443189
FT                   /gene="pilT2"
FT                   /locus_tag="cce_0434"
FT   CDS_pept        441846..443189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT2"
FT                   /locus_tag="cce_0434"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49785"
FT                   /db_xref="GOA:B1WNE3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49785.1"
FT                   /translation="MTQSQRPSLPPLPPPPIPPVNDFQEASTDMMEIAKASENDGATQF
FT                   IPASSITTESQSSAKLAQAPTVPKPPIESAIPAPPPLPTTPPRGFGRSPGQPTLAELVR
FT                   HAFDEGFSDIHLGVGEKPRMRDRGEMVILEYPDIDENTFMSWLREILKEDEIQRFKKEL
FT                   EFDGATQYDFARVRINIFDSLRGPAMVLRLIPLKILTMEQLRLPMIFKDISDAHKGLIL
FT                   VTGPTGSGKSTTMAAMVDYINKEHPKHIITIEDPVEFVHQSRRSLIKQREVGMHTLKFD
FT                   NALKAALREDPDIILVGEMRDKETVNTALKAAQTGHLVMGTLHTNSAVKTLERILSLYN
FT                   AEEREAMRVAIAESLVAIIAQGLCRTTDGKRAAYHDILINTETIKDYIIQGKNDEILEL
FT                   MKDGEFDGMITTNQALFNLYQEGRITEETALELSPTPNEIAMMLRGRI"
FT   gene            443289..444050
FT                   /gene="kaiB3"
FT                   /locus_tag="cce_0435"
FT   CDS_pept        443289..444050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiB3"
FT                   /locus_tag="cce_0435"
FT                   /product="circadian clock protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49786"
FT                   /db_xref="GOA:B1WNE4"
FT                   /db_xref="InterPro:IPR011649"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039022"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49786.1"
FT                   /translation="MAETTRVVPELFKGIALFTPGGDLVYCVDNNKQVHWHSQLCLVLQ
FT                   ELLKLPEPPHFLVPGYTATIDRWFCTREKRVKTVAEVYPAVRRYEPLLNVLFNVKDVVW
FT                   TTANWQEEVCDPVVIETYRSQFPQLWENHDLLVRLDERWEQELKTQFNPVETQKKDEFE
FT                   TNQGYILRLFVSGHHPSTKQTLKKIHHLLETQLSHPYTLKVIDIAKHPEMAETHHVSAT
FT                   PTLVRVWPKPTRRIVGELTDLSRVLQLITTN"
FT   gene            444113..444433
FT                   /locus_tag="cce_0436"
FT   CDS_pept        444113..444433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0436"
FT                   /product="UPF0136-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49787"
FT                   /db_xref="GOA:B1WNE5"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49787.1"
FT                   /translation="MDTLNLATIATLIYGILLLLGGIMGYVTAKSKPSLISGVLSGLLL
FT                   LLSAFFQWQQISVGLILAQILTLILAIVFGIRFWKTRKFMPAGLMLGISVAMLTILFQT
FT                   TS"
FT   gene            complement(444430..444819)
FT                   /locus_tag="cce_0437"
FT   CDS_pept        complement(444430..444819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49788"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49788.1"
FT                   /translation="MDYIYFLANASLTLRVIEYLQRKYDSSLCSMTVIHQINGWIIKIK
FT                   FKQPLTPEEHGNFKAFMNELGIPYELEIRLQMVFWSLETGQSPIDVMSRYQVAIVSHGS
FT                   PDSSDIEAFRQQFTRGLGYCPETLA"
FT   gene            445095..446180
FT                   /gene="queA"
FT                   /locus_tag="cce_0438"
FT   CDS_pept        445095..446180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="cce_0438"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49789"
FT                   /db_xref="GOA:B1WNE7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49789.1"
FT                   /translation="MSSDHLLSSYDYDLPPELIAQNPMIPRDHSRLLVINSPTTHIHSV
FT                   FRDLPKWLLPGDLLVFNNTRVIPARLYGKKTTGAPVEILLLEEKEPFCWLALVKPGKRF
FT                   KIGSEIHFPLDHNDDKEDMFLAATVLDRDEETGGRLLKFNVDSLDLFWKKIEEIGQIPF
FT                   PPYVTESEADSSQYQTIYAQKPGAVAAPTAGLHFTDELLDNLQHKRINQAYITLHVGLG
FT                   TFRPVDMENIKEHKMHQEWIEVPDVTVEKIKETKANGGRVIAVGTTVVRALEGAAKAAE
FT                   MEGKKDLKAFRGKTDIFIYPGYSWRVIDGMITNFHLPKSSLLMLVSALIGRERLLDLYQ
FT                   IAIKEKYRFYSFGDGMLILLS"
FT   gene            complement(446169..447311)
FT                   /locus_tag="cce_0439"
FT   CDS_pept        complement(446169..447311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0439"
FT                   /product="unknown"
FT                   /note="contains DUF323 and a CopG-like DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49790"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49790.1"
FT                   /translation="MSNIQVSVRIPPKLYEKLLAHTNAVGLPKSKVITQALSQYLETDE
FT                   KEKPSSSIEERLVNVEKRLERLESSPTLDKSSNVIQTKEKEKKSQPTLSFKTPPLQEFF
FT                   FERPIIDETGTILKRLKGESQCFKEELGDGIILEMIYIPGGTFVMGSTSDEPGSQVCEQ
FT                   PQHTVTLEGFFLGKFPITQKQWEIVAQYPKVNRDLGVDPSCFKGSDRPVESLSWEDAVE
FT                   FCDRLSQYTQRPYQLPSEAQWEYACRGETTSPFYFGPTLTGDLANYMAKRLYAGESSSL
FT                   YRQETTSVSAFYPNGFGLYDLHGNVWEWCADAWYSSYDNASTSGKPRSSSQQETRRVLR
FT                   GGSWDEDAYHCRCASRYAYHPQAVGVSQIGFRVMLMASGQ"
FT   gene            447494..448441
FT                   /gene="bacA"
FT                   /locus_tag="cce_0440"
FT   CDS_pept        447494..448441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="cce_0440"
FT                   /product="probable bacitracin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49791"
FT                   /db_xref="GOA:B1WNE9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNE9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49791.1"
FT                   /translation="MIQLKPRTLRLFHLMTLSSGLIFLLSSVTLAQGDTSDHAIAKFNW
FT                   FKAIILGMVQGLTEFLPISSTAHLKVVPVALGWGDPGVAFTAVIQLGSIAAVLWYFWSD
FT                   LSQITRGMIKAIRYSDYESHDFRLGVGIALGTLPIVFFGLLMKLLITDLDNSPLRSIGV
FT                   IAGASIFMALLLALSEKISTHKRSFEELSWQDGLLMGLAQSLALIPGVSRSGSTITSGL
FT                   FLNLERATAARFSFLLGIPAITLAGLVELKEVFDVGLSNDIIVPLIVGVISSAIFSYLA
FT                   IAWLIRYLQKQDTWIFVWYRLGFGLFILGSMFFN"
FT   gene            complement(448536..449264)
FT                   /gene="psb29"
FT                   /locus_tag="cce_0441"
FT   CDS_pept        complement(448536..449264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psb29"
FT                   /locus_tag="cce_0441"
FT                   /product="photosystem II 22 kD protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49792"
FT                   /db_xref="GOA:B1WNF0"
FT                   /db_xref="InterPro:IPR017499"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WNF0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49792.1"
FT                   /translation="MDNIRTVSDTKRKFYGYHTRPINSIYRRFVEELLVEMHLLSVNVD
FT                   FKYDPIYALGVVTSFERFMQGYSPESDKTSIFNALCQAVDGNSEQYHQEAEALINEAKG
FT                   LSITEFKEKLGQEGGDGILWGTCGAIAQNPKFKYSRLFGVGLYTLLMEIDPDLVKEEDK
FT                   RNQTIKEVSDALQFSSDKLQKDLDLYRSNLDKMQQLLTVIEDTLEADRKKRASQKLEKK
FT                   PEVVEEKEHKENEEQQQSSN"
FT   gene            449306..449422
FT                   /locus_tag="cce_0442"
FT   CDS_pept        449306..449422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49793"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49793.1"
FT                   /translation="MSPVKSPLPRGLFLEKRAEGAGEAGKAAEASPYYVRRC"
FT   gene            complement(449436..450143)
FT                   /locus_tag="cce_0443"
FT   CDS_pept        complement(449436..450143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49794"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49794.1"
FT                   /translation="MVIMSRVISKVLSPAMQLWLRSQVEQVETLELSIQGSDRQILKGH
FT                   VSGVMLNSNQAIYQGLHLGEIQLKGENIRINIGQVLRGKPLQLLEAIRVSGAVAITNQN
FT                   LQASISSALLGEGFKGLLETLLEHQGITEASHLLESYEINWHGAYLDNSYFILQGNLTH
FT                   NGTINPLKIKAKLTLIPPQTLQLSEVEIQGIPDLNSHEIKPFSVDLGSDVSINAFDLNA
FT                   DKLVCQGELLIRP"
FT   gene            complement(450239..452986)
FT                   /locus_tag="cce_0444"
FT   CDS_pept        complement(450239..452986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0444"
FT                   /product="methyl accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49795"
FT                   /db_xref="GOA:B1WNF3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49795.1"
FT                   /translation="MASGTDYAKLYNEAYVAYGQGNFEEAAALMEPMAEAFPEDPDVLL
FT                   LRGHIYFSLGRYETACQQYQSVIGHTDRPDLVDCAKQGLAQAQQLLAQSGDNHRSNELA
FT                   EPSEIASESVDRKEQWSEPTDSSGDWESEDFELDGLDWDSAIFDDDDLGEPTIGHQVSQ
FT                   GQPFDNNHHPPEQRPANFEMEVDPFTTLSEVKPFDSQTDIPKTNTSDKENWTDFVDHEF
FT                   SDFSFGDEQGLETEAHTGGEIAGDEDNTFVVSSSLNPPSLDNRGSTTSPEEPSSDWSNY
FT                   PAQDDPTIQATPRMMPSNPAQEQNQVLDKFDAFQEEALEDLSNFDFTEMSDQLPDSDLF
FT                   SQASEDLSGSLGLQTGDLLSEQGSQTVNWVKSDDMAHSSLSNSETKVIKPTVEAKQGYL
FT                   GWFHNAPLNLKPWMAAGSTGIVSFVAILLVSGFAWLISPQAESTKVVDKKSTADKVETS
FT                   ENNTNPLQATGQASQQSPSTPNNKKQAKSGDPILLLALTGGLVGFGGTLFFGLIASYHL
FT                   KRTIADLQTQFGSMYGGDYNVKATIYSEDELGQLSYNFNQLSRVILTTTSEAQQRAAEM
FT                   EQAREELQRQVIRLLDDVEGAARGDLTVEAEVTADVLGAVADAFNLTIHNLREIVAQVK
FT                   RTAKQVNKSSTDSELFARNNSRDALRMAEELAVTLNSVQVMTESIQRVAENAREAEEVA
FT                   HTSSVTALKGGEAVERTVAGILQIRETVSETTRKVKRLAEASQEISKIVALISQIASRT
FT                   NLLALNASIQAARAGEAGRGFAIVADEVRQLADRSAKSLKEIEQIVLQIQSETGSVMTA
FT                   MEEGIQQVIDVTDKSEQAKRSLEDIIDVSNHINTLVRSITGDTIQQQENSKAVSQVMQS
FT                   VELTAQETSQESQRVAGSLQNLVGISRDLLASVERFHIEEAQKS"
FT   gene            complement(453091..453621)
FT                   /gene="cheW"
FT                   /locus_tag="cce_0445"
FT   CDS_pept        complement(453091..453621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="cce_0445"
FT                   /product="probable chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49796"
FT                   /db_xref="GOA:B1WNF4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49796.1"
FT                   /translation="MVGNLDLGQDNKQDMSPELQALQTPEGELYLRFHLPSKEEFALPA
FT                   VAIREVMQQSPERITPIPNASPLLLGTLNLRGQVIWVADLGQFLGNTVPLRTDRPEIPV
FT                   IAVEEQETILGLAIDQLGDMEWLDIEQLQAPTNVADHIAPYVQGEWVAEEQSHQVLRLL
FT                   DQVAILRSARWAT"
FT   gene            complement(453652..454017)
FT                   /locus_tag="cce_0446"
FT   CDS_pept        complement(453652..454017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0446"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49797"
FT                   /db_xref="GOA:B1WNF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49797.1"
FT                   /translation="MRAVLLVEDSPAQQRMIATILKKNGWQVIIAEDGIQALETIKEAS
FT                   PDLIVLDIVMPKMNGYEVCRRIKTNPSTQNVPIVMCSSKGEEFDRYWGIKQGADAYIAK
FT                   PFEDIELIGTIQQLLRQ"
FT   gene            complement(454210..454311)
FT                   /locus_tag="cce_0447"
FT   CDS_pept        complement(454210..454311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49798"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49798.1"
FT                   /translation="MLHQQPGVIEPGDKDHSKISLIVLLFSQKIWAT"
FT   gene            complement(454271..455503)
FT                   /locus_tag="cce_0448"
FT   CDS_pept        complement(454271..455503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0448"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49799"
FT                   /db_xref="GOA:B1WNF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024186"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49799.1"
FT                   /translation="MQGTLNEIDIRSILQLIELGQRTGELLIEAYQTSLGNQGDDHPSS
FT                   NFGSSQPLTIEASRIFWLVFFVNGQIVYTIHSKNRGCRRLQDYLSRYQMQVVPEELESL
FT                   ERITHNDIEYVYLWQLIEQHRLTPEQGKTIIQQMVKETLFDLLSLRQGAFIFEMGLGLD
FT                   PLLTSLEIGPLVMEMMKEVQQWKQLHPYFQSPQQALIIADQQQLKETLPQKAYEQLVHW
FT                   ADGKTSLRRLSRRLQRNLGTLARGIYPYVERGWLHPIIITSPSVSISKNLWDEPTTRHR
FT                   PHIVCLDDDLTIGKTVEAILTKNHYHTSLITDPLSGLSHLFELNPDVILCDIAMPKLDG
FT                   YEICAMLRHSKAFQYIPIIMLTGKEGFIDRIRARMMGATDYLTKPFGEQELLLLIEKYV
FT                   APTTRSHRTRR"
FT   gene            456363..457979
FT                   /locus_tag="cce_0449"
FT   CDS_pept        456363..457979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0449"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49800"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49800.1"
FT                   /translation="MWLVLYLAEVKKQTRGFIGGSRTEIKLLACQHNDQTWSSVPGEEV
FT                   VALEELEQLGEGTLLMVNLGNNRQVQGEPELAAPELVRQLQKLSRLSEKLKTQQEEIEQ
FT                   WKQSLQYQSQELTRREAEMEARLEQLEEIEKELSQIERRRQEADSAWNRVEQTQQQFQD
FT                   FQRRFGPVLELPGAEAEKMQELIVRLAQSSTGLESLEKPFRAAINASEAQQEILNQFWQ
FT                   QLDTLKAEVQRQTRQVQQQGEILENRFQALEETQTSLEEAKIQWGVQQNILSNKQDRLQ
FT                   KVNDNLRVIQELQHTLEQVAGGVGDMVSETKVDVVSLEDMPLGELEEKVKSLQGDLDKL
FT                   VRFVNDQEEELTLQCQTVQELQDKLAEAGDFERLDLESELAEEQERKQFLDETLVGQRR
FT                   NLKERQEVLLQYLRVLRRRQGVIDFDSNTPAVNIDPVLIQLEEWENRTTEERETLETEI
FT                   HHLHNSVQEIQTMIKQLDTEQVQKIKQLEGERENWQQAQIEVAQLQVRLDIYENSLKPL
FT                   QRELDETKHQLGILGEWLNPS"
FT   gene            complement(458097..459068)
FT                   /gene="cbiB"
FT                   /gene_synonym="cobD"
FT                   /locus_tag="cce_0450"
FT   CDS_pept        complement(458097..459068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiB"
FT                   /gene_synonym="cobD"
FT                   /locus_tag="cce_0450"
FT                   /product="cobalamin biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49801"
FT                   /db_xref="GOA:B1WNF9"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNF9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49801.1"
FT                   /translation="MHLNATIIILIFATILDYLIGDPWGWLHPVQVMGWLISRYSNFVL
FT                   SIFHTKTQRRCAGVILGLGLIISSGIVGWSINLIKYHLDPFLGIFLEIILLASCLAGRS
FT                   LRLAAFDVLTPLREGNIDLARTKLSQYVGRDTVNLSPEEIWRATLETVSENAIDGVTAP
FT                   LFYAIAGAFFPGGGSVALALAYKGASTLDSTVGYQQEPFKDIGWFSAKFEDLLTWIPCR
FT                   LTVLTLAILSGKPLVVLSICRRDAPKDPSPNSGWSECIYAAILGVQLGGKNTYQGIVKE
FT                   KPLLGEPINAITCQSIEKALSLTRICCLLWLGLGVTGLWLFS"
FT   gene            complement(459117..459527)
FT                   /locus_tag="cce_0451"
FT   CDS_pept        complement(459117..459527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0451"
FT                   /product="hypothetical protein"
FT                   /note="contains a glutathione-dependent
FT                   formaldehyde-activating, GFA domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49802"
FT                   /db_xref="GOA:B1WNG0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49802.1"
FT                   /translation="MLYKDIIVMVNSHSSVVVQGGCHCGAVRFEAVIDKFEAIDCNCSI
FT                   CRKKGFLHLLVPPENFTLIKGEQMLTTYTFNTHTAQHTFCSVCGIHSFYSPRSHPGWFD
FT                   INVNCLDPVTLSDFEIKTFDGQNWEKNVEKIR"
FT   gene            complement(459517..459978)
FT                   /locus_tag="cce_0452"
FT   CDS_pept        complement(459517..459978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0452"
FT                   /product="hypothetical protein"
FT                   /note="contains a transcriptional regulator, Rrf2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49803"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49803.1"
FT                   /translation="MRKINPMKLTTRSHYSVKALLDLSLQPNYGPTSVKAIAKRQDLPA
FT                   PYLEKLLIKMRRSGLVNSLRGSQGGYQLARQPSQISLGQILDAVGDTIEPLPYYNPDIE
FT                   QVEDWVTFSLWKRLHEKLKEALYKITLADLYYDARSWKASLGEAISFVV"
FT   gene            460266..460658
FT                   /locus_tag="cce_0453"
FT   CDS_pept        460266..460658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0453"
FT                   /product="putative transcriptional regulator AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49804"
FT                   /db_xref="GOA:B1WNG2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR027360"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49804.1"
FT                   /translation="MKLMTQDKPLTGHALVEKVKELGDLSKEEKARACGYYTQTKNGVE
FT                   RVNMMKFLNALIDAEGIELDSSAEGQGRGGRSASYKISVQSNGNLLIGSAYTKKMNLQP
FT                   GDEFEITLGRKHIHLKQVGAPDEDEV"
FT   gene            complement(460840..461112)
FT                   /locus_tag="cce_0454"
FT   CDS_pept        complement(460840..461112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49805"
FT                   /db_xref="InterPro:IPR021489"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49805.1"
FT                   /translation="MTLPAPDTPLYNHPLPVIEQWLSDLGCQQDQQNLNCWTVTKPNWK
FT                   AQLSLDVEEIIVCYLKAGADGSDITRAFKYSLSREDVEAAVFSGP"
FT   gene            complement(461109..461684)
FT                   /locus_tag="cce_0455"
FT   CDS_pept        complement(461109..461684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0455"
FT                   /product="hypothetical protein"
FT                   /note="contains a DnaJ N-terminal four helical 'J' domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49806"
FT                   /db_xref="GOA:B1WNG4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49806.1"
FT                   /translation="MTEQQTTKQSTSRKSPVQMPFANSHYAILGLHPSASVIEIRRAYR
FT                   ELSKRYHPDTTELPSAMATAKFQRLNEAYGVLSNPQARSLYDLQIGYSRWNVIQTPSEP
FT                   IKNPKTGQWSHSAYLDASDRPLSGGELFALFILGLTLLGCLVLAIFIAILRGDEVIPTT
FT                   ALPQDYASVVPILLSEVHNTTQTLITLL"
FT   gene            461751..462350
FT                   /locus_tag="cce_0456"
FT   CDS_pept        461751..462350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0456"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49807"
FT                   /db_xref="GOA:B1WNG5"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49807.1"
FT                   /translation="MRLLNLFRERGTQFSKLLIRLCLISLLSLSLSFGWWGMSPATANI
FT                   DDDRLDGNIFVVYAGNGSLVPAKLSLKGSLDRKMPTVLVYYLDDSRDCKQFAIVVSRIQ
FT                   EFYGRAANILPISVDSIPVQDAYTKDEPGYYYQDIIPQTVILDGAGNKVFDGKGQVEYE
FT                   AVDDVLREVFDLLPRSESVELRRRTVNEFNDELVDS"
FT   gene            462408..463172
FT                   /locus_tag="cce_0457"
FT   CDS_pept        462408..463172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0457"
FT                   /product="probable polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49808"
FT                   /db_xref="GOA:B1WNG6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49808.1"
FT                   /translation="MIMIIPKFWSIILLLVIMLGLMLSIVFYQPRWLFKMILQVAPGVH
FT                   YFADTDDPVITITIDDGPDSITTPKILETLENHNVNVTFFLIGERIKDNELIVQEIIKN
FT                   GHEIGNHMVKDEKSIFLPLEDFEQEFVEADKTLHQFLSNSSSKVQWFRPGGGWYNSQML
FT                   DIVKKYNYQTVLGSIFPYDTHIPCSNFASYQILTNLRSGGIIVLHDSAKDGQSGEWGER
FT                   TNKTLKKILPEIKKRGYRIVTLSEMFFTHEYE"
FT   gene            complement(463318..464073)
FT                   /locus_tag="cce_0458"
FT   CDS_pept        complement(463318..464073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0458"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49809"
FT                   /db_xref="GOA:B1WNG7"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49809.1"
FT                   /translation="MMKPLKILILSLIILVAFVLLGSQSLTYDASIIPEKNSSPYYDYH
FT                   GLHSRDGIGKFYLGREIAKVMGHREFLWLERPNREQQEKPQKLLEALNLKPTDTIADIG
FT                   AGSGYFSFRLASFVPNGKVLAVDIQPEMLDIIDFLKQENKVNNIETILGTIKNPNLPKN
FT                   TVDIILMVDAYHEFEYPREMMENIVTSLKPGGMVILAEYRRENPLIPIKMLHKMTEKQV
FT                   KKEMNVVGLTWEKTEEILPQQHLIFFTKI"
FT   gene            464194..464763
FT                   /locus_tag="cce_0459"
FT   CDS_pept        464194..464763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0459"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49810"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49810.1"
FT                   /translation="MGIKIMNKLLWGICIGLVGISAGLSPIIAEEKKSSISYFSRSPRL
FT                   INVMTTYRGARVGSPRYYYTIELPDESGEALKTITINKRQGFEEIDYYPKATIAFQGTP
FT                   NHRENALTIEESTWDKTTETMTITFDPPVSPGTTFTVGLKAKQNPDHGGTYLFGVTVFP
FT                   DGNNPRDLYLGSGRLYFEGTDSGDYD"
FT   gene            complement(464926..465789)
FT                   /gene="fabI"
FT                   /locus_tag="cce_0460"
FT   CDS_pept        complement(464926..465789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="cce_0460"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49811"
FT                   /db_xref="GOA:B1WNG9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNG9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49811.1"
FT                   /translation="MVLSLIIATIMEQWGLIQQKLCPFVKIIMLDLTGKNALVTGIANN
FT                   RSIAWGIAQQLHKAGANLAVTYLPDEKGRFEKKVRDVVEPINPSLILPCNVQNEDQVEA
FT                   TFKAIGDTWGKLDIVIHCLAFADKEGLGGDFSSISREAFSQSLEISTFSLGNLAKYAKP
FT                   LMTEGGSIVTLTYLGGVKVIPNYNLMGVAKAGLEMSVRYLASELGPDQIRVNAISAGPI
FT                   RTLASSAVGGILEMIRHVEAVAPLKRTVTQLEVGNTAAFLCSDLASGITGQVIYVDAGY
FT                   EIMGMG"
FT   gene            465933..466613
FT                   /gene="ntcA"
FT                   /locus_tag="cce_0461"
FT   CDS_pept        465933..466613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="cce_0461"
FT                   /product="nitrogen-responsive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49812"
FT                   /db_xref="GOA:B1WNH0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49812.1"
FT                   /translation="MMELSVPQDKPLAAVFRRIGGGAYPPVVEAFDRGKTIFFPGDPAE
FT                   RVYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLITGQRSDRFYHAVAFTPVELL
FT                   SSPIEQVEQALKNNPDLSILMLQGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDF
FT                   GVPTPEGIRIDLKLSHQAIAEAIGSTRVTVTRLLGDLRQEEMISIHKKKITVHNPVALS
FT                   QQFA"
FT   gene            466638..468098
FT                   /locus_tag="cce_0462"
FT   CDS_pept        466638..468098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0462"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49813"
FT                   /db_xref="GOA:B1WNH1"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49813.1"
FT                   /translation="MTSAYILIASILVLGGLVAALGDRLGSKVGKKRLTIGNLRPKQTA
FT                   VVVTVLTGTLIAALTFGILLAFSKSLREGLFELDEIQKQLRIARADLERLGIDKEDTEK
FT                   ELQKAKEEQETVEKKLQSTNDNFNQAKQQLKSVSNQATQLKADIQTLLTERKELRQNKI
FT                   ELDQEIQQLKQEISQRDEELRKGKAQIAQQTRILNERQKRLQSLEEQQSTLQAEIDRRD
FT                   DEITKLDQAINEKDMALKEREFQLQQLERESSYLQRQVAILEQYYQTYQELRERKIAIV
FT                   RGQVLSIGAVRLVVPKAGTQVVDELLRQANRTAIELVGKGSIKPDERVVKITQGQVQQL
FT                   VEQLQDGREYVVRIIAAGNYVQGEKEVRVFADIALNQQIFSEGETIAIISMDSLDLTDE
FT                   IIQERLDLLLSATQFRARRSGILGGIQVGDGRLKTVVDFIEEIKQSEQGLDELRAIAME
FT                   DTKTIGPLKLKLLGIRNGEIIIESEEES"
FT   gene            468095..468514
FT                   /locus_tag="cce_0463"
FT   CDS_pept        468095..468514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0463"
FT                   /product="putative resolvase, RNase H-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49814"
FT                   /db_xref="GOA:B1WNH2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49814.1"
FT                   /translation="MNQKSSSMVLGFDPGRDKCGVAIADNKGKIYYHEVVESSQGISTL
FT                   NNLIEQFSINFLVMGNQTTSKQWKKQLESELLVSVPIVLIDERNSTLEARDRYWEMYPP
FT                   QGLMRLLPKGMRNPPRPIDDIVAILLIERYFNSIK"
FT   gene            468526..469374
FT                   /locus_tag="cce_0464"
FT   CDS_pept        468526..469374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0464"
FT                   /product="unknown"
FT                   /note="contains a Sulfotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49815"
FT                   /db_xref="GOA:B1WNH3"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49815.1"
FT                   /translation="MTLPQVVNQFIKNPDHLPKNIIWRFPKKISTNKHIFVLGAPRSGT
FT                   TLAKLILTSHPYLIGPGYETAFFTYRDIFSFRFKGIKQKKMDELRQNCHDIVEFFDIFT
FT                   NHVLMDHPEAKYYVEKTPQHVLQLAFLTKYFPSSKFIHMVRDGRDGFCSAKHHKNVVQG
FT                   SDVKRYANYWRKCLNSRIKLGDKDNILDVKYEALASDPEITIKGMMSFIGEPYHPQQLQ
FT                   PGKYSNNAITKIKTPVFEKLSANINDSSIQRYKKELSTEEIEIFNTIAGEQLRHFGYEV
FT                   G"
FT   gene            469654..470151
FT                   /locus_tag="cce_0465"
FT   CDS_pept        469654..470151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49816"
FT                   /db_xref="GOA:B1WNH4"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49816.1"
FT                   /translation="MSASDVQPPQSYRKEEVQEILHLAIARKTEVEELSRTQLWEIAAE
FT                   LDIDAAVLQLAEKDWLLQKQQQEKKDEFNQYRQRQLKRKFIRYGIINSFVILLNLLAAG
FT                   TLSWSLYILILLGLPLALDTFKTFQTEGEEYEKAFQQWYFKKEMKASISSLWNRIKTAW
FT                   LS"
FT   gene            complement(470210..470311)
FT                   /locus_tag="cce_0466"
FT   CDS_pept        complement(470210..470311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49817"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49817.1"
FT                   /translation="MGFFTLTLMFSPQNYPNFACFDCTLFRVIFQST"
FT   gene            470286..471665
FT                   /locus_tag="cce_0467"
FT   CDS_pept        470286..471665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49818"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49818.1"
FT                   /translation="MRVKVKKPILVAGIAISFLLWLGESLHEEVIAIGEWGVVSLMAIG
FT                   TGVWWWQEKQPQKPISQTISPLTITEVNQAIADGQKILKIVKQENPKYNLSSLETQLGK
FT                   LPEKLNNQAVSLGLIGNSIPEKSSLKQLLNKEKNYINIQWLEEDNTEKTHQRIDLIIFL
FT                   VSTDLTQSQWQTIQQCHRNHQRCLISLNQLEQYNLEEQEIILQQIKQRVQTIIPPHDVI
FT                   PINSSPKTLKVRQYKEDNSYQEWTEIQPPQIVSLTSRLDSILSQEREQLIWGKVWREAQ
FT                   DIKQQGKEILNAIRRDRALPMMEKYQWIAAAAAFANPVSSLDLLATAAINAQMVVDLSG
FT                   IYQQKFTLSQGQAVSGTIGKLMIKLGLVELSTHAISSLLKSNAITYVAGGATQAISAAY
FT                   LTRVAGLSLIEYFQEQEINSHSDQSFNIEQLSTKIKQVFEQTRRTEILQGFVKQTLPKL
FT                   S"
FT   gene            471851..473302
FT                   /locus_tag="cce_0468"
FT   CDS_pept        471851..473302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0468"
FT                   /product="hypothetical protein"
FT                   /note="contains a MFS 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49819"
FT                   /db_xref="GOA:B1WNH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49819.1"
FT                   /translation="MTVSDSETTPTPINKTLDAANPEESMARSNSSKKSPRQGFAPVLE
FT                   NPQFLILWIGQVFSQLADKVYLVLMIAFIAGHFQGENQPISGWVSAIMIAFTIPAVFFG
FT                   SLAGVYVDRWSKKGVLVISNLIRAAFVFIIPPLLWLSQGDTLTLNVSWLPHWLRSWHNQ
FT                   TQEAFLLPLGFLILLVLTLVDSTITQFFAPAEQATIPLVVKRRHLLSANSLFTTTMMAM
FT                   TIVGFAIGEPLLEVASHLAENLGFSWEEGKAFVVGISYLIAGLLLLLLKTGEKREQYEK
FT                   EQPHVLEDIKDGIRYLGSNHRVRNALIQLVILFCIFAALSVLAVRMAETIPGMKAEQFG
FT                   FLLATGGLGMGCGAAVLGGWGQQFRNHQLGLWGSMGMAVSLVGLSLSTSSLWLTLLMTT
FT                   FLGVFAAFVGVPMQTTIQAETPVDMRGKVFGLQNNAVNIALSLPLALAGIAETFFGLQP
FT                   VLLSLGVMAIAGGILTWLMGMKESV"
FT   gene            complement(473299..473484)
FT                   /locus_tag="cce_0469"
FT   CDS_pept        complement(473299..473484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49820"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49820.1"
FT                   /translation="MNSPPLIRQLVEKALYLKRLTPEIEMAINHELSRTGYISDVDYEA
FT                   LELLMSEMDEGRIRFT"
FT   gene            473962..474315
FT                   /locus_tag="cce_0470"
FT   CDS_pept        473962..474315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0470"
FT                   /product="hypothetical protein"
FT                   /note="contains an Anti-sigma factor antagonist domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49821"
FT                   /db_xref="GOA:B1WNH9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNH9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49821.1"
FT                   /translation="MMGSQLINLSVAVLEPTGYITAANIDDFQEKLTNFVRNNPSRDYL
FT                   VDMHQVEFIDSAGLMAIVSAFRLAQRLNKKLSVCSLSPSVRIIFELTQLDRALEIYESR
FT                   QTYEASFNETVAA"
FT   gene            474412..476994
FT                   /locus_tag="cce_0471"
FT   CDS_pept        474412..476994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0471"
FT                   /product="unknown"
FT                   /note="contains UPF0004"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49822"
FT                   /db_xref="GOA:B1WNI0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49822.1"
FT                   /translation="MFVTIAIEKLLTPDINKPARYLGNELGAKHKPWNEATVRWVLTYP
FT                   EVYELGASNLGHIILYNILNSQPRQLCDRTYLPAPDLAEKLRQSNTPLFALESRRSLTD
FT                   FDILGFNLSYELGATNILEMLDLAQIPLTWKERDSGNYPLIFAGGQTATSNPEPFAEFF
FT                   DFMALGDGEELLPEIGLIIEQGKENNLSKQALLLDLAQIPGVYVPRFYDETEAGEVVPN
FT                   RPDVPARILRRVSPPMPAYAIGLVPYIETIHDRLVVEIRRGCTRGCRFCQPGMLTRPAR
FT                   DVQPDDVIETIERGIRETGHNEFSLLSLSCSDYLALPAVGTEIKNRLKDENITLSLPSQ
FT                   RVDRFDENIANIVGGNRQSGLTFAPEAGTQRMRDVINKGLTNEELLRGVKTAVEQGWDK
FT                   VKLYFMIGLPGETDMDVLGIVETVRWLRQECRIKGRKPLQFTITVSNFTPKPHTPFQWH
FT                   SVSTAEFKRKQELLREAFRSLRGVKANYTDVRISGMEDFVGRGDRRLSPVIRRAWELGA
FT                   GMDSWWENAQQAYEAWEQAINEAGLSWKYRQVEEGEWNIFEGNTDSYNAPLPWDHINTG
FT                   IEKKWLQEDLQRALEAATVPDCAFEGCSHCGVCGLDFGHNIVVQPPTIPQFSGHFKPNQ
FT                   DRLQRFRVYFGKIGEMALVSHLDLVRLFDRVVRRAALPISFTGGYHPGPRISIANALTL
FT                   GVTSNGEIVDFELTEMMDINKFRHALEENLPSDIPVYNVEEVSVNSTSATRLLEEAEYL
FT                   MTVETEDKIAQETWQSWIEKVLNSSEINWEKTTKSGKKKTVNLRDRLSSLSLDSYQDNA
FT                   VTLHYIGSCRNDGTMLQPQHVMLMLEKISGMELQLVKVHRQRLILAAS"
FT   gene            complement(477028..477366)
FT                   /locus_tag="cce_0472"
FT   CDS_pept        complement(477028..477366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0472"
FT                   /product="XisI-like fdxN element excision controlling
FT                   factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49823"
FT                   /db_xref="InterPro:IPR014968"
FT                   /db_xref="InterPro:IPR035943"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49823.1"
FT                   /translation="MDNSTLNYQDIIEEILNEYIDYLGEDEQVEIKLICDSNKGHYLLT
FT                   EIGWSNGYRLYGTLIHIDIIDDKLWIQQDGTEEGIAEELVKKGISKDRIVLAYKSLQER
FT                   KITEFAVS"
FT   gene            477647..477835
FT                   /locus_tag="cce_0473"
FT   CDS_pept        477647..477835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49824"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49824.1"
FT                   /translation="MWWRSSRLDRIEANIERLAKISEATNRRIDRFVEATDQQIQAIQT
FT                   RTDQFQRALEYLLSKDR"
FT   gene            477921..478496
FT                   /locus_tag="cce_0474"
FT   CDS_pept        477921..478496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49825"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49825.1"
FT                   /translation="MNINSTFYASIYNDLTELPTEIFDMKILQELDLKGNNIEHISVEI
FT                   SKLTKLRYLRLDDNKIKDLPSCFAKLTNLEELSLQRNCISSIPTAIFELPNLLYLTLTS
FT                   NSIDLFPDNPLEFKLTKLKTLDLINNKLIKLPSYISRFNNLEELFLDDNLLEEIPDCIC
FT                   QLTKLKYISLYDNPIVYYPKCISNIIDM"
FT   gene            complement(478597..479202)
FT                   /gene="gst4"
FT                   /locus_tag="cce_0475"
FT   CDS_pept        complement(478597..479202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst4"
FT                   /locus_tag="cce_0475"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49826"
FT                   /db_xref="GOA:B1WNI4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49826.1"
FT                   /translation="MYKLYDFLPSGNGYKVRLLLTQLQIPFTRIEVNILNNESRTPEFL
FT                   TKNPNGKIPVLEISPNQYLTESNAILFYLSQNTSYFPNNNFEQAQVMQWLFFEQYSHEP
FT                   NIATSRYWISILGKEREYKQQLKQKKILGYAALNVMEKHLQTQDFFVGKTYTIADIGLY
FT                   AYTHVAEEGGFSLTEFSYIKRWLNRIENQPRYIGISNF"
FT   gene            479231..479710
FT                   /gene="ispF"
FT                   /locus_tag="cce_0476"
FT   CDS_pept        479231..479710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="cce_0476"
FT                   /product="2-C-methyl-D-erythritol 24-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49827"
FT                   /db_xref="GOA:B1WNI5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49827.1"
FT                   /translation="MNIRIGNGYDIHRLVPDRPLILGGIKIPHSLGLLGHSDADALTHA
FT                   IMDAMLGALSLGDIGHYFPPSDHKWAGADSLLLLQQVDELIQANGWQVGNIDSVIIAEQ
FT                   PKMKPHLQAMQEKLAHTLQINIDQVGIKATTNEKLGPVGREEGIAVYTVVLLVKS"
FT   gene            complement(479700..480257)
FT                   /locus_tag="cce_0477"
FT   CDS_pept        complement(479700..480257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0477"
FT                   /product="hypothetical protein"
FT                   /note="contains a Thioredoxin fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49828"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49828.1"
FT                   /translation="MSKTTTTSQFRLVGQLESFVIKKGDKIKYLRMKVEEKEYWLKIPK
FT                   KLRSEIDINMIPGTWLEVTGNREFKKKKGFFELEVSQVTLLPNPDKPCAVILSESESSS
FT                   VGKILVCQKSSCWKRGGKSVCQQLEQELEQQGLSDRVKIKLTGCLKQCKKGPNVVIMPH
FT                   KARYCQVQPGEVDKLVNKHFTT"
FT   gene            complement(480291..480554)
FT                   /locus_tag="cce_0478"
FT   CDS_pept        complement(480291..480554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49829"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49829.1"
FT                   /translation="MLESMNLTNLPLEPRQVVEVDWCDRWIVYHRLRELDIPCSCETHK
FT                   PLQANLSSPTAIIQLWSVTKQYSASRQELIDWLKSCWNLNKR"
FT   gene            480742..481341
FT                   /locus_tag="cce_0479"
FT   CDS_pept        480742..481341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0479"
FT                   /product="probable nutrient-stress induced DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49830"
FT                   /db_xref="GOA:B1WNI8"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49830.1"
FT                   /translation="MSYFNDRSVVKKGITDMATAQGLLRAFGEVGENPVLLDKSVTTPV
FT                   CEGLNLLIASFQGLFLQYEKHHFVVEGSEFYSLHEYFSESYEEVRGHVHDLAERLNGLG
FT                   GIPVASFSKLAELCCFEPEADGMYDCRKMVEHDLAAEQAIIKVLRSQAAQAESLGDRAT
FT                   RHQLEEILLETEERAYHLDHFLTHDSLTVAFVGNGN"
FT   gene            complement(481443..481769)
FT                   /locus_tag="cce_0480"
FT   CDS_pept        complement(481443..481769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0480"
FT                   /product="hypothetical protein"
FT                   /note="contains a rare lipoprotein A domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49831"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNI9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49831.1"
FT                   /translation="MKKVSLSILMIALAAMPAQAQTATYYASHYQGQKTASGVRFNNSA
FT                   MMAAHPSLPFGTKVKVTNRKTGKSVIVRIVDRCRCSLDLSQSAFRTIGSLKSGRIPVRI
FT                   TVLN"
FT   gene            481950..482708
FT                   /locus_tag="cce_0481"
FT   CDS_pept        481950..482708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0481"
FT                   /product="unknown"
FT                   /note="contains TPR_1 tetratricopeptide repeat domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49832"
FT                   /db_xref="GOA:B1WNJ0"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49832.1"
FT                   /translation="MFNYLHQVVRFPVVSSQYSLKKKNIFVYLSSLGLLLLVINVIMGC
FT                   NHQSSSIPIESSLLTVDTVEMVQQGIEKSRQGNYEAAVDDFNQVLAQNPQDINAYFNRG
FT                   FAYSSLGQFEQALADFTKVLKLDPQMVQAYVNRGNVYLQLGEDEKAISDYEKALKINPN
FT                   DAFAQNNLGLAHLNSGSPELAKIDFTQAVTIDPLYGEAYYNRGLALLDLGETKKAIADF
FT                   QKAAEIWEEMGEQTASEAALAEINALKANN"
FT   gene            482806..483003
FT                   /locus_tag="cce_0482"
FT   CDS_pept        482806..483003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0482"
FT                   /product="putative heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49833"
FT                   /db_xref="GOA:B1WNJ1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49833.1"
FT                   /translation="MTITLKVPSIACGACANTITKAIEGQKPEAKVSVDVDSKIVTVET
FT                   DASTETIKEIISEAGHTVED"
FT   gene            483123..483542
FT                   /locus_tag="cce_0483"
FT   CDS_pept        483123..483542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0483"
FT                   /product="hypothetical protein"
FT                   /note="contains a Glyoxalase/extradiol ring-cleavage
FT                   dioxygenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49834"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49834.1"
FT                   /translation="MTIRPFHVAFPVINLEETRYFYETILGCTVGRTSEHWIDFNLFGH
FT                   QITAHLCSKNSHEVSVNLVDGKKVPVQHWGVILEMKEWQVLAEKLKASQITFVIEPYLR
FT                   FKGEVGEQATMFFLDPSGNALEFKAFRDDQSIFAK"
FT   gene            complement(483668..485632)
FT                   /gene="recJ1"
FT                   /locus_tag="cce_0484"
FT   CDS_pept        complement(483668..485632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ1"
FT                   /locus_tag="cce_0484"
FT                   /product="single-stranded-DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49835"
FT                   /db_xref="GOA:B1WNJ3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49835.1"
FT                   /translation="MKLPDQRWYIASPNPDQVKMLVAETGLSPLLAQVILNRGIDSPNL
FT                   AQVYINPEVETLPDPLDEFPDLLSSIELLKEAIEIGEKIAICGDYDADGMTSTSLLLRA
FT                   LTHLGGDAYYEIPSRMKDGYGINERIVEKFAEEGVGVVLTVDNGIAAYEPIKRAIELGL
FT                   TVIITDHHDLPEKLPPADAILNPKLLSIHSPYRGLAGVGVAYILAVTLAEQFNKTEEII
FT                   DSLLELFTLGTIADLAPLVGVNRRWLKKGLKQLPNSQLAGIQALMQVAGVSEEQKQLKP
FT                   DDIGFKLGPRINAVGRIGDPQTAIELLTTDDPGIALERAMQCEQINGKRKGLCEEIEKE
FT                   AIHLIKTTPINYKKDRVLVVINHKWHHGVIGIVASRLVERYGVPVFIGTYEEDDPSKIR
FT                   GSARGIEEFNIFEALVYCDDLLGKYGGHKAAGGFGLKSNNLIAFKERLSQFAHQLLEPH
FT                   HIKPLVKIDGEANFKQLNAQLYQHIDSLQPWGIENAFPVFWTPNVKILEQRTVGKNHLK
FT                   LVLGQEDGQEMKAIAWRFGSYFPLPKRLDIAYKLTENYWNGTVNIELEIVGVRLPAGTT
FT                   IQPKNTFTYQGKDYICHYFKQEKELRIKNAQGKVLAVRKGQQKGLLGINRQEAKEVDVT
FT                   QNPYFDIIKAAMNTLNLTK"
FT   gene            485680..486531
FT                   /locus_tag="cce_0485"
FT   CDS_pept        485680..486531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0485"
FT                   /product="unknown"
FT                   /note="contains a GTP-binding protein, HSR1-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49836"
FT                   /db_xref="GOA:B1WNJ4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49836.1"
FT                   /translation="MPLIQWYPGHIAKAERQLKEQLNRVDVIFEVLDARIPLASHHPDV
FT                   PQWIGDKPRLLVLNRMDMIPESVRQGWLNWFAAQGETVYYTNAKQGKGIKPLKKAAQEA
FT                   GVQMNQRRRDRGMRPRGVRAVVIGFPNVGKSALINRLLGRKVVASARRAGVTRQLQWIR
FT                   IADDLELLDAPGIIPAKLDTQEDAVKLAICEDIGEAAYDNQQIGAALVDLLVELNFEKI
FT                   LSSRYQLDPQEMTGEEYIEILGNTRYKGDKERATMQLLNDFRKGIMGQIPLELPPTEQV
FT                   KS"
FT   gene            486701..486838
FT                   /locus_tag="cce_0486"
FT   CDS_pept        486701..486838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49837"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49837.1"
FT                   /translation="MSTLELVNIAYPEFNVTETNPESYYLLRLMNLYGADFNEEEILNF
FT                   "
FT   gene            487011..487247
FT                   /locus_tag="cce_0487"
FT   CDS_pept        487011..487247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49838"
FT                   /db_xref="GOA:B1WNJ6"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49838.1"
FT                   /translation="MVKQFPVNAGEMVERADRLMSAASNRYRVVVQVSRRAKRCRHEDN
FT                   ENGDTSMMKPVIRAVLEMSDEFTEPEIIGHELN"
FT   gene            487430..488161
FT                   /locus_tag="cce_0488"
FT   CDS_pept        487430..488161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0488"
FT                   /product="unknown"
FT                   /note="contains a GUN4-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49839"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR032192"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNJ7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49839.1"
FT                   /translation="MTDQQTATIDNTDNNLSQLTDQFINGTQKDQLQLIPQLMRMGEGG
FT                   WQVLMKFLQASDENAVDIVRGKVYGILYQVKNTITEEFIQTHFPKGIISLKSQRNIDYQ
FT                   PLNQLLVEQKFQDADTLTRHLLCELAGEGAVQRKWVYFTEVEQFPATDLQTINALWLLH
FT                   SEGKFGFSVQRKLWLSVGKDFTKLWPKIGWKKDNNWTQYPNQFTWDLDAPVGHLPLLNQ
FT                   LRGVRVTASLFSHPAWSQENS"
FT   gene            complement(488166..489608)
FT                   /locus_tag="cce_0489"
FT   CDS_pept        complement(488166..489608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0489"
FT                   /product="hypothetical protein"
FT                   /note="contains a MscS mechanosensitive ion channel and a
FT                   cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49840"
FT                   /db_xref="GOA:B1WP58"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP58"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49840.1"
FT                   /translation="MPAYWSLFKQWFHSTFSTPLFNIGGEAISILWMLKAILLLILVSI
FT                   LARSIKRFLKHYLLALLKINEGTREVIGTLSSLGIATLGYILVLQSLGLDLASFAVIVG
FT                   GFGVGIGFGLQEITRNLVSGLTLLGESKLKVGDLIEYKGHLGYIQEISLRSTVIRTLKG
FT                   SQLVVPNTDLTSQVVENWNYENCHRRIEISVGVAYGSDLLLVTELLLEAAFIEKEVLAY
FT                   PSPKVVFLEYGDNALIFQLWVWVETIERCLLIKSSLNFIIEYKFRQRGISIPFPQRDLW
FT                   LRNPELLLSSPSQKIQESENNFKPDKSQIPTLKDSLQSFPCFQHLNELELRKLIEIGGR
FT                   RYLKTDEIFIRQGEYGNHFCIVLSGEIKAIYETQKVSRLLFSFTEGQYFGELPLLLEIP
FT                   YPTTMIAATETHLFLLEKPCFENLLNQYPHLSQEIASELAKRQDIVENYQQTLQEMGLI
FT                   DEKSLKDPVTWIRQRLSQIFRL"
FT   gene            complement(489688..490656)
FT                   /gene="gshB"
FT                   /locus_tag="cce_0490"
FT   CDS_pept        complement(489688..490656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="cce_0490"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49841"
FT                   /db_xref="GOA:B1WP59"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP59"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49841.1"
FT                   /translation="MKFAFIIDPIANLNPVHDSTVAIMEAAQNLGHEVWITEVHQLSVI
FT                   DGKAWAVLSQVQLTSVTLQNGKWVSVSQWYQVSPGELRSLEDMDAVWMRKDPPVTIRYL
FT                   YATYILELIDPTKTVVINSPQGLREANEKMYTLQFYSVMPETVVSLDKKVIRQFVEEKQ
FT                   QAVLKPLGGKAGEGILFLEPGDRNFNSIIEVSTYHGQEPVMVQRFLPEAKNGDKRIILL
FT                   DGKPIGAVNRVPTGQEFRGNMAVGGRVEKTQLTPREEHICEVVGPRLRKNGLYFVGIDV
FT                   IGGYLTEVNVTSPTGIREIDLLDGTNLGIEVVEWLTQVCSK"
FT   gene            complement(490656..490925)
FT                   /gene="grxC1"
FT                   /locus_tag="cce_0491"
FT   CDS_pept        complement(490656..490925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC1"
FT                   /locus_tag="cce_0491"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49842"
FT                   /db_xref="GOA:B1WP60"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP60"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49842.1"
FT                   /translation="MAANVEIYTWSTCPFCLRAKALLVKKGVDFTEYCIDGDEDARDEM
FT                   AQRANGKRSVPQIFINDRHVGGCDELYDLDSTGELDSLLENSAA"
FT   gene            491027..491929
FT                   /locus_tag="cce_0492"
FT   CDS_pept        491027..491929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0492"
FT                   /product="hypothetical protein"
FT                   /note="contains rfrA pentapeptide repeat and TPR_1
FT                   tetratricopeptide repeat domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49843"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP61"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49843.1"
FT                   /translation="MLSYHEAIARVIRPITPTLFIKQLLSSPETVVYILPIKAMIKITS
FT                   ISLTALLTGFGLVLPVRAENLAHLSQLLSTKQCQLCDLTGSGLVMADLSGASLIGANLA
FT                   GANLSQANLAGADLRGANLTGASLYGANLTGANLSSAILAGTDLRDSYLTNANLTGTNL
FT                   ANAYVQGAKGISQTAGTPELFYGWGLIETKEGNYQEAIAHHNKALILDSEFAPAYLARG
FT                   YALLRLGNENGAVLNAKMASQLYEKQENTQGKELAESFVENIEAMQEARRKGGGTPGLD
FT                   NIVRGVASLALRFLLQGGF"
FT   gene            492058..492933
FT                   /gene="ptpS"
FT                   /locus_tag="cce_0493"
FT   CDS_pept        492058..492933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpS"
FT                   /locus_tag="cce_0493"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49844"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP62"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49844.1"
FT                   /translation="MQCVINRRAQFSASHRYWIPEWDEAKNKQVFGACSHFPGHGHNYV
FT                   LFVSLWGEIDQYGMVENLSTVKQVIKGEVTSQLDYAYLNDVWEEFQTTLPTTENLARVI
FT                   WQRLADHLPIVKIQLFEHPQLWAEYQGNAMKATLTIQTHFSAAHRLALPHLSLEENTEI
FT                   YGKCARTHGHGHNYHLEVSVSGEIDPRTGMIVDLGKLQTIVEDYVVEPFDHNFLNKDIP
FT                   YFAEVVPTAENIALYIAQLLEKPIKDLGVQLEKVKLIESPNNSCEIYCGASAESFKTPS
FT                   QQAPQLVTLH"
FT   gene            493141..493551
FT                   /locus_tag="cce_0494"
FT   CDS_pept        493141..493551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0494"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49845"
FT                   /db_xref="GOA:B1WP63"
FT                   /db_xref="InterPro:IPR025564"
FT                   /db_xref="InterPro:IPR033344"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP63"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49845.1"
FT                   /translation="MESKVQEQTTPKDLSSEAPGTLTKSSSMGDQPWQEWVAPVVDILA
FT                   KVPEYVGEFFSEYKQPLTTVGLLLLAIISVKIIVAVLGAIDDIPLLAPLLEMVGLGYTA
FT                   WFVWRYLWKASNRKELLAEFDAIKNQMFGDNA"
FT   gene            493730..494203
FT                   /locus_tag="cce_0495"
FT   CDS_pept        493730..494203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49846"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP64"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49846.1"
FT                   /translation="MLRRKKMMKKSLGLCSLIVMGAGLGELALSPERAQASELCNYRNE
FT                   IIRVSGAYINGDDTWVTQGWWLVEPGECMVYPDNWYTYVQVDRHQTVERTYLLELEDEE
FT                   IQTVELCVLQDRYTFYNGETFEVCDKHHYGFTDNSMQTFYLIGARRELIEYTQ"
FT   gene            complement(494588..494968)
FT                   /locus_tag="cce_0496"
FT   CDS_pept        complement(494588..494968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49847"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP65"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49847.1"
FT                   /translation="MKPLRLVNYLWPAFISMMILSAIVASLPEVLANEPSVTNVETVEP
FT                   LEASTGEWQDLQGLEAKEGQQWSWDLEESDGIISENIEYEISPDRINNPDVIDVEKENE
FT                   DWENSNRGDPKSSGGLIPFAEF"
FT   gene            complement(495271..497115)
FT                   /locus_tag="cce_0497"
FT   CDS_pept        complement(495271..497115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0497"
FT                   /product="ATP-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49848"
FT                   /db_xref="GOA:B1WP66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP66"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49848.1"
FT                   /translation="MAISPDAQLKESVKDLRTSDRRLILKLIPYLRRYPRLLLLSVSLL
FT                   LPLSIAGAIQPLIIGQAVSLLRQEKTWGFLQQFSLEKGLQFLIILLLVTIIIRLVCSST
FT                   QGFIVQKLGQNITAAIRDDLFTHVTSLGISFFNRTPVGRLITRLTSDVEALGDVFASGA
FT                   IGVISDTIYILFIIVTMFTVQAQLALMLVLMMLPITVLIIYFQRQYRKANYKSREKLSE
FT                   LNSMLQENLAGINVVQLFRREQFNSELFRAINSDYRQATNKTIFHDSAVSATLEWISLV
FT                   AIASVLWLGGMFIIDDTITFGTLSAFILYAQRLFNPLRQFADKFTMFQAGFTAIERITE
FT                   LMKEPIEIKESDKNIQFLDSRKYQDKVGEICFDHVWFGYKPDEFVLKDLNFTISPGEKV
FT                   ALVGPTGAGKSSIIRLLSRLYEPTKGRILIDGVDIRDISKKELRQYVGMILQESFLFAG
FT                   DVKRNITLGENYSLEAVQQAAKLTNVHHLIEDLPQGYHTQLRERGTNLSGGQKQLLAFA
FT                   RVAIRNPHILVLDEATASLDVQTEALIQEALQKLLINRTAVIIAHRLSTIRDVDKIFVL
FT                   KEGMIIESGSHQQLLREKGLYHSLYQLQMMGYEESPTY"
FT   gene            complement(497306..497431)
FT                   /locus_tag="cce_0498"
FT   CDS_pept        complement(497306..497431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49849"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP67"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49849.1"
FT                   /translation="MGIAHHKFNLDVKKAEIDGFRTQLNRHLTTNLYQHLEEGRI"
FT   gene            complement(497441..498448)
FT                   /locus_tag="cce_0499"
FT   CDS_pept        complement(497441..498448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0499"
FT                   /product="cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49850"
FT                   /db_xref="GOA:B1WP68"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WP68"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49850.1"
FT                   /translation="MDLITLQNFLDNSSFLLLFLTMLIYWAGAAFPNVTWLPTLGTTGV
FT                   AIANLCMATLLGARWLEAGYFPLSNLYESLFFLAWGVTAIHLVAEQMSRSALVGVVTTP
FT                   VAMGITAFAALSLPPEMQTSAPLVPALKSNWLMMHVSVMMLSYATLMVGSVLAIAFLVV
FT                   TRNRDIELKGSSVGTGGYRDKLGRSLLNNNHKQTTVNLTQSNGSGGTAILESVAVKPET
FT                   VTLSPQRLNLADTLDNISYRIIGLGFPLLTIGIIAGAVWANEAWGSYWSWDPKETWALI
FT                   TWLVFAAYLHARITKGWQGRKPAILAASGFVVVWVCYLGVNLLGKGLHSYGWFF"
FT   gene            complement(498485..499057)
FT                   /locus_tag="cce_0500"
FT   CDS_pept        complement(498485..499057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49851"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP69"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49851.1"
FT                   /translation="MGLTLSITSVFPGLAQTAIDETILVANDPNSRINLRSQPSVNSAS
FT                   LGYSLPGDQVSLLDFNKGSGGQPRVPWIKVKFAKSGAIGWIRGDFVKTDITILTANDPN
FT                   SRINLRKGPSIASDSLGYGLVGDRIKVLAFPARSPSCTVCGQGWEYVTMSNRTGSSRTP
FT                   WIKVQFLESQAIGWIRGDFVVVPLTYC"
FT   gene            499038..499160
FT                   /locus_tag="cce_0501"
FT   CDS_pept        499038..499160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49852"
FT                   /db_xref="GOA:B1WP70"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP70"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49852.1"
FT                   /translation="MDRVNPKQQFNNNLNQTLVIVFFVFMTVPGYTREKWVIVG"
FT   gene            499193..500638
FT                   /gene="pyrFE"
FT                   /locus_tag="cce_0502"
FT   CDS_pept        499193..500638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrFE"
FT                   /locus_tag="cce_0502"
FT                   /product="bifunctional orotidine-5'-phosphate
FT                   decarboxylase/orotate phosphoribosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49853"
FT                   /db_xref="GOA:B1WP71"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP71"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49853.1"
FT                   /translation="MNFFEKLTQRITNYNTLLILGLDPNPEMMPQDEDSYQGQQSLIIA
FT                   LESWLKWIIEQTSGLVCAYKPTLGFYEALGSEGLDLLLKVIQAIPDDIPIILDAKHGDI
FT                   NTSTIFAKTIFEQWNVDAVTVSPYAGQDHIAPFLVYPDRGVFVLCHTSNPSAVILQEYP
FT                   TDEAPFYLEVIKEARTWATPEQLFLELGTTNLAVIKKTRSLAPERLLLLRSIWSKGNDI
FT                   NDILKAALTPMGDGVLIPIPQDFLKSSDLQEQVKNLNEDINQYRQTIIQNPQNCDLWSP
FT                   NVCLLNSHPHQDLILQLYDIGCLLFGEYVQASGATFSYYIDLRKIISKPQLFHQVLSAY
FT                   ADILKSLNFDRIAGIPYGSLPTATGLSLMLHHPMIYPRKEVKAHGTRRLIEGNFKAGEK
FT                   VVIVDDILITGKSVKEGAEKLTSSGLVVKDIVVFIDHEQGVKDKLKKEGYQAYSVLTIS
FT                   EITETLYEAGRINEQQYKSFFKH"
FT   gene            500697..501761
FT                   /gene="ruvB"
FT                   /locus_tag="cce_0503"
FT   CDS_pept        500697..501761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="cce_0503"
FT                   /product="Holliday junction DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49854"
FT                   /db_xref="GOA:B1WP72"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WP72"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49854.1"
FT                   /translation="MAIKRNQGSNPKPEKKERLTKAETHQEQDNLEESIRPHSFDEYIG
FT                   QKDLKDVLSIVIEAAKTRNEPMDHLLLYGPPGLGKTTISLILASAMGVNCKITAAPALE
FT                   RPRDITGLLVSLKPGDILFIDEIHRLNRLTEELLYPAMEDYRLEITIGKGQAARTRSIP
FT                   LPKFTLVGATTKVGSLTSPLRDRFGLIQRLKFYEPEELALIIKRTAKLLNTSITEQGAA
FT                   EIGRRSRGTPRIANRLLRRVRDYIQVKKFDSITQELAAEALDIYQVDPQGLDWTDRLIL
FT                   DTMITQFNGGPVGLEAVAAATGEDAKTIEEVYEPYLLQIGYLNRTPRGRVVTTVAYQHL
FT                   GKTGEEQLSIFSEQ"
FT   gene            501875..502333
FT                   /locus_tag="cce_0504"
FT   CDS_pept        501875..502333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49855"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP73"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49855.1"
FT                   /translation="MKITSNIIISAPHIVIPQTYWNPLLGEVLRDADLITEGQLQIALR
FT                   DKQEYKHQKIGEILALRGWIKQETVDFFAEEWANCLQQGAKYPIGQYLRQAALLDQKDI
FT                   ENILDLQQHLKIRFGEIAVSQGLLTRKTLNFFLNNLLCQAAEDTLFVA"
FT   gene            complement(502426..503628)
FT                   /locus_tag="cce_0505"
FT   CDS_pept        complement(502426..503628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0505"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49856"
FT                   /db_xref="GOA:B1WP74"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP74"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49856.1"
FT                   /translation="MVNKNSENDHLSSSLKLMKLKQSFWSDVRSRLEHWCKKTIVAMIV
FT                   VTLSINLCGATWSQFGTDSVLISVLAQGNAITDPEAILRYALPIENEPIRKVQDAIEDI
FT                   SNHLRGKRWPPIAKDVKTASFVLTLRSDEILEGVPGDRQFQAETILEDIKTGVRELQEA
FT                   VENKDKEQVWIKRRNVLDNIGEIETLMVEGFPFEIPEEYADLPQLKGRATVEIETTKGN
FT                   LTIVVDGYNAPVNGGNFVDLVQRGFYDGLSFIDLEDSFAIQTGDPPGKEEGFIDPETGE
FT                   YRAIPLEVRVKEDEEPIYGATLEEMGIYLPDLVLPFNAYGAVALARPSLDPNGGSSQFF
FT                   FFKFDSELTPPGFNLMDGRYSVFGYLVDGKEVLENLTKKDKIISAQVIDGLDNLVKPKN
FT                   S"
FT   gene            503745..504158
FT                   /locus_tag="cce_0506"
FT   CDS_pept        503745..504158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0506"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49857"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP75"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49857.1"
FT                   /translation="MARGLFWLSLLVVFFILAWSGWNEYQKLEAYRQWAEDFDQAKYDI
FT                   YAIIGVKGKEITWGKPGRSIPNTLPKFLLTDVDKIELLVNDKSVDLGNLPNKGKPIIQF
FT                   NFINKDQSSINIPFTEIDLAAKWVKYLDNLRNV"
FT   gene            504181..505749
FT                   /locus_tag="cce_0507"
FT   CDS_pept        504181..505749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0507"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49858"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP76"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49858.1"
FT                   /translation="MLSMSLKLIISLVSLTWLFLGCTTSKQGINQTENNCPSPPVSPPK
FT                   FRVNNEGDFFEKLKTLNIEVSEGIITFQTQDYDFIFCNKNKTFIIKKGNYKPEEKPVTN
FT                   YEEAIQELNDPSYKIINWQDKTYQYRVILEPNPFPDFEVEPEKVILELIIPEAEQPQKH
FT                   TLYTLKQVKQQKAGIQLGVPKITATVINNNQFYWSVSSEQGEGNGGIATIVSYEPEVDK
FT                   INIIQPSQLAKQQINDLKISNNDTDTILWLATQTSGEGNPYLPGMGLVSYNANRKSLKS
FT                   YYARNSNLVGMIPHKLNIEKENLWVATGNGLCQIKWQTIEQVSSWKCWEFQLEATLPNE
FT                   GLKVYQSLLNPNPQITLNADENQETVEVLWWSPQNYETEKGRYEIVYDSGFSVTLEDKG
FT                   VMNWKEWYDNQYQVNPWEAMVYWPGKDWLWNGNRFIRPFDGVSLNYFGGGPGGISSWNN
FT                   SQQQRPEIYAIRGDLDLIELTKDSTSVKYYSGWVDDDVLQPYLMIVPTEKPKNIQPNPL
FT                   KKVSQ"
FT   gene            506024..507733
FT                   /locus_tag="cce_0508"
FT   CDS_pept        506024..507733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0508"
FT                   /product="putative phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49859"
FT                   /db_xref="GOA:B1WP77"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP77"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49859.1"
FT                   /translation="MMVNLGTQKTSFFHPSQTNLLLSTQASYSGNATLEKDSEEAIIRP
FT                   SYGLENLGIHNIGRVYRNLPVAQLVEHALIRGEGTLVDNGALLVETGQYTGRSPNDRFI
FT                   VKESSSEAEIDWNQHNVAISEAKFNQLYQKVIAYLQGRDIYIFDGYVGADTNYRCGVRI
FT                   VNELASQNLFVHQLFIRPSPEELNHHQADFTVIAVPGLQGDPQRDDIRSEAFIVVHLQK
FT                   RLVIIGGSRYSGEIKKSVFLMMNYFMTKRDVLPMHGAANIDKRGHTNLFFGLSGTGKTT
FT                   LSADPDCRLIGDDEHGWSESGLFNFEGGCYAKTIRLSQEHEPQIWAAIKFGTLLENVIV
FT                   DPETQIPDYDDGRLTENTRAAYPLRYIPNCSTSAMGSHPKTIFFLTADAFGVLPPIAKL
FT                   TKEQAMYHFLAGYTSKLAGTERDITAPQATFSACFGQCFFPLSPTVYAEMLGKRLDQHH
FT                   ETNVFLINTGWSGGPYGVGHRIAIKHTRAMVTAALNGQLDQVKYHPHPIFKVLVPEKVT
FT                   GVPHRILDPQNTWDDAEAYQQQALELAYRFEANFQQFKDVPADIMSAGPVVG"
FT   gene            complement(507819..509267)
FT                   /gene="cysS1"
FT                   /locus_tag="cce_0509"
FT   CDS_pept        complement(507819..509267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS1"
FT                   /locus_tag="cce_0509"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49860"
FT                   /db_xref="GOA:B1WP78"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP78"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49860.1"
FT                   /translation="MTLTVYNTLTRNKEPFTTIEEGKVKMYCCGITVYDYCHLGHARTC
FT                   IVWDVVRRYLQWRGYDVTYIQNFTDIDDKILNRARQEKTTMEAVSERFIEAYFEDMECL
FT                   NVAKADAYPRATHTLNGIQRLVSELEAKGYAYASEGDVYYNVHQFKPYGKLSGRKLEDL
FT                   QAGASGRVAVEDAEASKKKDPADFAVWKSAKPGEPAWDSPWGKGRPGWHIECSAMVRER
FT                   LGETIDIHVGGSDLIFPHHENEIAQSEAATGKPLARYWLHNGMVKVGGEKMSKSLGNFT
FT                   TIRELLEKFDPMAVRLFILQAHYRKPVDFTDEALEAATKGWQTLSEGLLFGFQQGSKLG
FT                   FKENRSELLPEFIQRFQDTVDDDFNFAGGLAVLFEIAKELRKEGNLLVHQGKTETPSEL
FT                   LQKQWQTLIALATVLGLEADSNPVNSEKSDGLDDAAIEAFIEKRKEARKNKNFAESDRI
FT                   RDELKEQGVILVDQPGGVTIWHRG"
FT   gene            509643..510569
FT                   /gene="thrB"
FT                   /locus_tag="cce_0510"
FT   CDS_pept        509643..510569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="cce_0510"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49861"
FT                   /db_xref="GOA:B1WP79"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WP79"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49861.1"
FT                   /translation="MFFMSTVTVTVPATTANIGPGFDCIGAALTLYNQFTFTEQPEADT
FT                   DLRITVTGTEAHRVSGDRTNLLYQAFTHLYDHLNKTPPKIAIDIKLGVPLARGLGSSAT
FT                   AIIGGLVGANELAGQPLSTAEIMELAIAIEGHPDNVVPALLGNCQLSVGEAENWEICQI
FT                   PWHSDIIPVVAIPDFELSTEEARAVLPKTLSYGDAIFNIARMGLLIRALESGNEQWLNK
FT                   AMADKLHQPYRQGLIEGYEFVQASALKAGAYGMVISGAGPTLLALTHPEKIQSVEKAMK
FT                   NAWTQLEIVADVRSLSIDTQGANVNAH"
FT   gene            510643..511392
FT                   /locus_tag="cce_0511"
FT   CDS_pept        510643..511392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49862"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP80"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49862.1"
FT                   /translation="MVKVNNDMIQQELFKQYKKEIERLNCESPKSLNLWNAIYFFIPWY
FT                   RSVQPGANPLDDEIPWISFAAIAFLKKKLNKKMRVYEYGVGGSTIFFAKRVKEVISCEH
FT                   DPHWGKKVIKRLKKLNYKNYNIEIREPILNSEGLDRNPSDVNSYISSSPDLKNYSFQDY
FT                   VESIEQYPDEYFDVVLIDGRARPSCLKHTLNKIKKNGYIILDNAERQNYSEACAMVDNK
FT                   NYPRWDFYSPGPYNLYFWKTCIWKKSN"
FT   gene            511409..513235
FT                   /locus_tag="cce_0512"
FT   CDS_pept        511409..513235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0512"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49863"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP81"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49863.1"
FT                   /translation="MTASYYDRSFALNNLDLKLKEYLDFGRGFFIEAGGNDGIAQSNTL
FT                   YFEKHWKWKGILIEPIPELAEKCKINRPNCIVENCALVPFDYDKSDIDMYYCNLVSMVK
FT                   GAQKTEEAELQHIQRGCEVQQIKSYELKVPARTLTSILDQYGVKNIDLLSLDVEGFELN
FT                   ALKGLDFERYQPNFLLIEARFRQEIDDFLAPLYEPIANLSHHDVLYKSKKKIKEENNFQ
FT                   LYTPVVFIIFKRPDVTQAVFNKIAQAKPPKLLVIADGPRSTEEAHLCEETRSIINQVDW
FT                   ECEVLTNYSDNNLGCKKRVSSGLDWVFSEVEEAIILEDDCLPSISFFQFCQTLLNYYRN
FT                   DERIWLISGNNFQGGQIRTDYSYYFSRYPHNWGWATWRRAWKHFDLEMKFWTQCKELKL
FT                   LETIFEDPYEQDYWLDILEKTHNNLIDSWAYIWGYTCWINNGLTILPEVNLVSNIGFGE
FT                   DATHTKDINNPLANISVSNIINIEHPPYLCRHLEADAYSFNHIFGGQQMKQLIKQLQEE
FT                   LNQAHNTIQKLSEENSQTKTQLQNRQTELEQNDIKIKQTQNQLILINSQLQQMQTQLQQ
FT                   AQAQIIAMESSKFWKLRTQWLKLKKKLRLSVK"
FT   gene            513354..514331
FT                   /locus_tag="cce_0513"
FT   CDS_pept        513354..514331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0513"
FT                   /product="unknown"
FT                   /note="contains a macrocin-O-methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49864"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP82"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49864.1"
FT                   /translation="MTNHFEKLQQEIDQQTEIIQQAENVILELQDKLLLAQELISARET
FT                   SKFWKLRQKWFHFKKKLGLVQDEQQINWREQLALPSPLELPKMVVNMPEVYFSSEKYDS
FT                   AQEYIQPDLDPSPVDLHFQYLQSQVKPFTLVGTERMQSLYNLSQRIEIEKIPGDVIECG
FT                   VCNGGTAAILAHFATRSFNYNRTVWLFDSFAGMPKTTEEDEEEAKKYIGKDVGDFNNVL
FT                   TILNLVNSDMTKVKIIEGWFENTFPKVHIPEIALLNIDADWYASVKFCLETFYDFVVPG
FT                   GFISFDDYGHWPGCRKAVDEFFKERQLSYKLHEVDYTARWIQKV"
FT   gene            514392..515075
FT                   /locus_tag="cce_0514"
FT   CDS_pept        514392..515075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49865"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP83"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49865.1"
FT                   /translation="MPTIDWLKQEFDYGYDSGDVLSLVPNETRIQEEKRIGGSYREVFL
FT                   KAILPNLKPDSKVLELGPGKGSWSKAILNYIPDGELQVLDFQDVKPWLKPATYGRRLTC
FT                   HIVEDNSFSKLADNYFDFFWSFGVLCHNNVENIAEILKNSLPKLKPGSLAIHQYADWNK
FT                   LDTYGWEKGGVPLFFQQQSDDQIWWPRNNRATMESIAQQAGWSVIVADLGLLQRDSMIV
FT                   LRRLE"
FT   gene            515109..517733
FT                   /locus_tag="cce_0515"
FT   CDS_pept        515109..517733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0515"
FT                   /product="probable glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49866"
FT                   /db_xref="GOA:B1WP84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP84"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49866.1"
FT                   /translation="MKYLNLGCGSHFHPDWTNVDFVSTQEGIIAHDLRQGIPFEDASFD
FT                   VVYHSHVLEHFSQREGKRFLEECHRVLRPYGLIRVVVPDLEQIAKLYLKALEKASQGSL
FT                   EWAANYHWILLEMFDQVARHQSGGEMAAYLADETIPNESFVIKRIGAEGENLIKLLRPL
FT                   KSQLQPPLSFNPETDDLEETALKIGKFRLGGEVHQWMYDRYSLQRLLTKTGFSDFKVCQ
FT                   ANESNIPDFKQFGLDVQPDGRVRKPDSLFVEAIKSRPNQWQQAYIPTMENTQTLKILQL
FT                   NTVDIAGGAARAAYRLHKGLQQAKQHSLMLVNKKYSTDETVCLVQSLPDAETSQQIGAT
FT                   TLQTFYINENRTNISNTLFSFPYPGWDVSQVEEVQEADIIQLHWVAMFQSPQTVKQLSS
FT                   LGKPMVWTLHDMWAFTGGCHYAAGCEGYQSSCENCPQLKEDTFGLAQAILQDKLDILSG
FT                   LNLTIVTPSHWLADCVRKSALFKHQRIEVIPNGIETDIFIPIPKAKAKESLGIKPNTFT
FT                   LLIGADNGNEKRKGFEEMLKALSVCLEDEKFSQAVQQEQVKLLCFGLPNDELNSLDIPV
FT                   VSLGQINSDEKLAEVYSSADIFVLPSLEDNLPNTMLESMSCGTPVIGFEVGGLPDVVKE
FT                   NVTGNLVPLENSSALAQVILSYFRSPQKVEDIGKNCRQLLEENYSLSVQAQAYLKLYQD
FT                   LLAHQTPLSYADSKQRLSSEASLSSLDTTLEGIYVPIETEFNSISGSIFESVLRYALSQ
FT                   KLAEAQDQVKNLLVEKHNHIQLIGELREEVKELTVQLQLSQIEKESLQQIIDQRDLTIE
FT                   DIKEQLHRSENNRLDLLQKIDQLQENLNISQATIEGMESSKFWQLRMRLVALKQFLKLK
FT                   RTD"
FT   gene            complement(518054..521140)
FT                   /locus_tag="cce_0516"
FT   CDS_pept        complement(518054..521140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0516"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49867"
FT                   /db_xref="GOA:B1WP85"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP85"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49867.1"
FT                   /translation="MTTNTTKSELNFIIDPEIKNDDFYQAIQEIARYSHIKTVLEIGSS
FT                   SGQGSTEAFVKGLRENPNQPTLFCMEVSQTRFNALKNYYLNDSFVKCYNVSSIAINQFP
FT                   DEATVTQFYDSYQTPLNEYPLDRVLGWLRQDIDYVKDAEVAENGIEIIKQENNIQQFDL
FT                   VLIDGSEFTGAVELDQVYGAKIILLDDICTYKNWQSHHRLLSDPNYKLIQHNPTLRNGY
FT                   SIFIRVDSLSIYQPPVTPLEEQPIHFFTIVLNGQPFIEYHINVLRQLPFKWHWHIIEGV
FT                   AELRHDTAWSLAAGGEILEKIHNQGCSVDGTTEYLDNLQQQYPDNITIYRKQKGQFWDG
FT                   KREMVNAPLTNIKEDCLLWQIDVDELWTVEQIIQAKELFNKHPEKTSAYFWCWYFVGEK
FT                   LIISSRYCYTQNPHQEWLRVWRFQPGDSWEAHEPPRLVRSQPDGQIQDVAKINPFLHKE
FT                   TEKYGLLFQHFAYVTPDQLDFKESYYGYENALQEWKDLQEATDFPVFLKDYLSWVSDNT
FT                   IAEPADICGIVPLMQRNTNDQTWHFLTSQEIQEKTMSLKKPFPQIVIDGVFFQFANSGI
FT                   AQVWKSLLECWSENGFYQHIIVLDRAGTAPRIPNIRYRPVPAFDYTQTDVDSRMLQEIC
FT                   DEKGADLFISTYYTIPLSTPSVFMGYDMIPEVMGVDLDNVGWREKHYGIMHASSYITIS
FT                   ENTAYDLTKFFPHISPDNVTVAHCGLKSVFSPASDQEIDNFKQKYNIDKPYVLLVGERM
FT                   GVNSYKNAIYLFRTFSKLVNKKEFSIVCVGGKSELEPELVQLSQDVTTHVLPLEDEELK
FT                   RAYSGALVYICTSKYEGFGLPILEAMACGCPVITSCHSSIPEVAGDAALYVEQSNECDL
FT                   MDALYKVQNPEIRQQLIKAGFEQIQQFSWSKMADIMADVFLKTANKIKQEKTELTPPIW
FT                   NALRKQQSLVKQANNLVEQTQQELANIRHQVQQYQQALEECRQQSQNSTYYSGEITRLQ
FT                   QQLEVASTEIEAMKTSKFWKLRGKWFSVKQKLGLPIDDV"
FT   gene            complement(521181..522068)
FT                   /locus_tag="cce_0517"
FT   CDS_pept        complement(521181..522068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0517"
FT                   /product="unknown"
FT                   /note="contains a glycosyl transferase, family 2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49868"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP86"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49868.1"
FT                   /translation="MLNSNKIRISVITVCRNAENFIEKVIQSVVNQDYSNLEYIIIDGD
FT                   SQDNTISIIEKYLGKIAKFISEPDEGIYSAMNKAIRYSTGDFLCFINADDYFVDNRVIS
FT                   DVANYIIEHPSSEFIYGDLEVRYPSGRLINVNPPPPEKVLDELVCGCLPHQASFSKADL
FT                   FFSKVGFFNENYQISSDYEWFLRLASHETVKLSYYPRLISSYYLGGLSSQIKISVPESY
FT                   RIQNQHPLYQTPYWMKRRILKYQEFVINLREWLAATEESRDYFQEQYSMLEEKYQTLEK
FT                   ENHKLQEQLKKSIS"
FT   gene            522311..523285
FT                   /locus_tag="cce_0518"
FT   CDS_pept        522311..523285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0518"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49869"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP87"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49869.1"
FT                   /translation="MIVRSVFMDCSSIIKQIEDDRNICAGDDPRRLEHFGFKVYSQSDE
FT                   DGIIEEIFNRIGIKSKIFVDFGAERGEENNSRYLLEKGWTGLWIEASPDYAQYLRSLHE
FT                   EAIREGRLKFIEAAVTAENINELMSRAGITGEIDFLSVDIDGNDYHVYDAISVIQPRVV
FT                   CLEHNHCYPPPKEWVMPYDPNHRWTAGSSYYGASIASFEKLARSKGMILVGCGLYSPNG
FT                   FYVREDLVNDNFSGPFNCERFFNRLDYEKIVSFPRKELKQTEEIEVPQTQEITEEDYKT
FT                   KWIEAEKQLKEAQEEIEAMKTSKFWKLRSLWFKFKKNLGLSTQ"
FT   gene            523358..524797
FT                   /locus_tag="cce_0519"
FT   CDS_pept        523358..524797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0519"
FT                   /product="hypothetical protein"
FT                   /note="contains glycosyl transferase, family 2 and
FT                   Methyltransferase type 12 domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49870"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP88"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49870.1"
FT                   /translation="MKSTTAKQKNNHKTNQNYLFPPEIWRKRNLLYYQDIERFYRFYVN
FT                   SNSKVLEVGSGTGYLLASVNPEYGLGIDINEQAIEYARYRFPDLDFILEDGEHYNSNQK
FT                   FDYILFANTVSYLHDLHKTFSNLASCCHPNTRLILTFHNPAWEIILRLATLLKQRTPID
FT                   NLNWLSYEDIRNILNLNGFEVICHHKQMLLPRRIFGLSWLLNKIIAPLPLINQLCLTES
FT                   IIARPKINQTDTVKQHQTLTCSVIIPARNEAGNIESCVTRMPPLGKHTEIIFIEGHSKD
FT                   NTWEEIQRVQAKYGHQWDIKICQQTGKGKGDAVRQGFAMATGDILMILDSDLTVRPEDL
FT                   THFFDALASGACEFANGCRLVYPVHPQAMPWLNRMANRFFAWLLSYLLGIKIKDSLCGT
FT                   KVLFRHHYQQIAENRSYFGDFDPFGDFDLLFGAAKLGLQMKDVPVRYDPRTYGSSNIQH
FT                   FKEGIVLLKMCLFAAKKIKFR"
FT   gene            524877..525605
FT                   /locus_tag="cce_0520"
FT   CDS_pept        524877..525605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0520"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49871"
FT                   /db_xref="GOA:B1WP89"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP89"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49871.1"
FT                   /translation="MTEIILQEHRLTWEKKPILRALYRTWYQEMTAQLSPGETLELGGG
FT                   SGNFKEFAPNVTSSDIVPLPWIDVVADAQDMPFQDQSFDNIVMFDVLHHIENVTLFFNE
FT                   ALRILRPGGRIIMMEPYISPISWLIYHFLHPEPVNFKQDPLIFVEPSPNRQPFDANQAF
FT                   ATTLFERKFSQFRDKYPQFLKVYHRRLSFFIYPLSGGFEKPSLVPMFLYKPLLNLEKML
FT                   SFMSRLLAFRILVVLEKREV"
FT   gene            525609..526463
FT                   /locus_tag="cce_0521"
FT   CDS_pept        525609..526463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0521"
FT                   /product="hypothetical protein"
FT                   /note="contains a methyltransferase FkbM domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49872"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP90"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49872.1"
FT                   /translation="MKFSTEGKIKIARLLSRLIVTIRSWFGLSPVTRVKRRGIKWFLDL
FT                   REGIDLAIYLNVYEPETLNSFKSLIKPGDVVLDIGANIGAMTLPLAQAVGETGQVISFE
FT                   PTIWAYEKLQRNLVLNPQLINRVQAEQIMLLDRGENPPALVYSSWDLTAEVDNNPSIHP
FT                   LHQGKLMTTDGVKGISLDEYCEQQRIEQIDLIKLDVDGYELTVLNGAKKTLRQYRPKII
FT                   MEMALYVQEEREQIDELLITLQEADYQLVQLTNSQPIAMNQTALEKLCHKAGGINVLAI
FT                   PKP"
FT   gene            526476..527291
FT                   /locus_tag="cce_0522"
FT   CDS_pept        526476..527291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0522"
FT                   /product="hypothetical protein"
FT                   /note="contains a methyltransferase FkbM domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49873"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP91"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49873.1"
FT                   /translation="MSIIQQVLLWIYALFKKTGLLETAWFKKIFYWAYFFYKKHIEDPF
FT                   FGLTQQYPELFIGGHILDVGANIGYTATLFSQVITPGFQVYAFEPEIKNIDSLREILNI
FT                   YHLIGKVIPIQAAVGAKKGTIELWHNESHHADHRILTDTYKASGVAVQEVSQVALLSID
FT                   EFVRDELNNAAIKFIKIDVQGYEFPVCLGMEKTLQANPDAVVVLEYMPSAITELGFMPQ
FT                   EILVFFQERDYFMYVLTQRGKLLKADLAIIEQEIKKKTYIDLVFTHQLI"
FT   gene            527304..529193
FT                   /locus_tag="cce_0523"
FT   CDS_pept        527304..529193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49874"
FT                   /db_xref="GOA:B1WP92"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP92"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49874.1"
FT                   /translation="MNLQTLSLPLKISNQSLYLIISLGIGITFYFLILLFGLPELLNQF
FT                   FLETNNLTIFIITIFAVLYFAYLPNGWIGILTSFTATLVLFSLQLSQQWQSLLPSSIGN
FT                   GYIFSGLLPLNDANIYYTSALRLLQGETFTDTGSLRPLSHGAIATILGLTQENLQITLA
FT                   IIVLITAISCFFLAREIKKYQGTIGSAIILTLMFAFIRPYIGSVATENLGLAVGALATA
FT                   AMWRGLHSQKLKICLFGLFLLTIALNIRAGVFFILPLFLAWSVWFFKEKSQLSSPFVFG
FT                   GISVILLGFILNSLVFKLVALPGIQPNGNFAHVLYGMTVGGNWTSILTDHPEIHNSQQR
FT                   YQIAFEALLNNPLALPRGFLRAWDQFFLQDFAFSFLRSNSINFSLQILSLVAIFYCLHQ
FT                   WRTAMGSFMLMGLFGVLLSLPFAPPWDAGTRIYAATIPFFALFPTVGLTYLCRKFKLSV
FT                   LTKTSQIDESPQLLINFSMGLIIFMIVGTMITKIVSHTPKFSEIICPQSLETAYFFNSA
FT                   GSSINVVANNVQKKSYIPIAKVKDFKESFVIYKSDKNFKQFFDYMDELQPNRSLISKIN
FT                   LANNQGIWVITDTNIIPKDKGIIGVCGKSIKLPHDHWFHGKLFFADSMKLVSK"
FT   gene            529212..532817
FT                   /locus_tag="cce_0524"
FT   CDS_pept        529212..532817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0524"
FT                   /product="unknown"
FT                   /note="contains a glycosyl transferase, group 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP93"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49875.1"
FT                   /translation="MKTFIIIDHSLCNLQGHHYECSLSVAESAARQGYEPIIVANKAFP
FT                   KTLYPNNIKVIPAFEVDWFDNPVSSKEKNKILDFFDFLENHPLEKLSEKINHKFQFYFR
FT                   YWELTQPKLKALLEKIKGSTSRLLNWIQQDIDLLRSIPFSNTLWGIFKIIWGLVRYILA
FT                   TFLRKVNKALIKLLTPKNESFKDTLSNIFKEIKLTSEDEVFIHTIGIKQVEDVYHYLAS
FT                   ADLSKMPRFHILLRRDIDDPLVVYAPGMGLKAIFDNCYNSQLWPDKIQFYTDTDDLIQR
FT                   YNSLSNVKLYKIPIPFRQEKLTQIVEKADKNKPVHLVYLGDARPEKGYHYLPNIVEYLW
FT                   TDYIQPGKIKVTIQSNFSIEGGEGLIPQARLALERYPDSKVKLIKTAMSADDYYQLLAE
FT                   ADALILPYDTNSYRFRTSGVLTEALAAGKPVIVPQNSWLGKQVDSSRASLYENSDEIPK
FT                   KVIEIVENLDRFSESARKFSKRWLEQNSPDSLVKTLLDGKDNNYVDYIEENKVESDINH
FT                   KKVINNIPKLLPKILLVIESDFLLDQEADNNSFSNYLEYLGLCGYEVYGLFFTNKQERK
FT                   GENYEPFYHQVYPVIDRLFQEFSVNLKERWIIDYGSPDLIPDNFSLKEYIKEVLNNKNS
FT                   FKRNLIERYNLSIPSDLSQLLQTNQFDVIFLNSIVSYSIIDRFNIKQSSIICEVPEIAS
FT                   YQYAVNNHRDIEQEDYQLECQLLNQCDALIFHHQYELEKIKETINKPQAYVISGNENSN
FT                   QTDYYQTMDQVFKALLNDRAIPLKATGEKVAILYPWGDILERKSGASKRVGLLIDYLKL
FT                   QSYQVRLFTTGDAKDFREDGVHYTYYQQSYQDYCLINDLYKDAYQSWFDALNFETEQNN
FT                   QTSENSKLSDHWLPWIYYQYRFDSGFIDYVKKIAEWADTVILEYPFWALTVGEICHQLQ
FT                   TQLLITAHDILAQQLDLETLIGKIALAEEIKALKQADHLICVSETDQNFLKQYQLSSTV
FT                   IPNPINLEQDTSDDLLLEVALPKINSPFCLFVGSQHQPNIEAVKIIQQIAKDFLTDYPD
FT                   IACQFVIVGSCCEPEEKNNFIALGKVSDQELSALYYRASLILSPILSGTGTSLKIVEAM
FT                   AYGKLVLGTNVAFRGYSVESGEQCLICDRLDDYSHIITQWLNNSQKRENIEKNAQEFAK
FT                   NYDYRNLYYSYKQLIEKSDKLIRELPEISQRQQQH"
FT   gene            533050..536061
FT                   /locus_tag="cce_0525"
FT   CDS_pept        533050..536061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0525"
FT                   /product="unknown"
FT                   /note="contains a glycosyl transferase, family 2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49876"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP94"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49876.1"
FT                   /translation="MKVLIADFDLFSKVGGGQTFYRSIIKKNPQIQFYYIAEKEPLNSP
FT                   RPTNATAIPYKEQFLISDFKNFFEVTPPKWVERAFAMASNIAASAEGQQFDIIDVPDYE
FT                   QWGIFLRPALKQYGIKFNRIALSMHGKISKTLRLDWFDWGQANIPLDLQEKMQYKVADI
FT                   RYGISKSYLDEWREDIEELESYYYNPLHFFDLPRPTQCLPSTESPTLNFIGRTEKRKGP
FT                   DIFIDLVWWLPETSYSKAQIIGPHSYNYNNTKSSQTYLQEMIQHRQSHLRLCPPMKREE
FT                   LTELFASKSLTFLPSRYDTLNLVALESLFSGCPTAVGNGAGVCRFLEETFPEVPFITIN
FT                   IDDIYACLPQLETVLDNYEDYRQHLVDQLSKANLEVSDPNLEDIYNSSSASHLEIQDEL
FT                   AQWYSQLLSYWESGQKGLSLSKIPAVKAVKKQIKAQIKPTYKQLKKTLAETKSKLKQPL
FT                   EETKTAQTLKSPQLFERYKYTFNASELNQKDLGNKVKECWKLASAFGSEEQGWRDKLKN
FT                   GYRIDRVRAWREIARLEELRGNELVAATYKLRGLRLLDGDRFGDLPYVLRVLQDKGFTR
FT                   EVEVIDAMYGKTGQREEKCYNFIEKARQDNLHNQAWDYEIFDDRRHKSEYRVSVIVSLY
FT                   NAAEKLPLFLNTLQHQTLMRSGEGEIILVDSGSPGDEYKVFKQLAEELKLPILYVRSQA
FT                   RETIQTAWNRGISLAKSPYLSFLGVDETILPDALETLADELDKNPDIDWVIGHSLVTNV
FT                   DKKGNWVNDIMPYDRTPYHQDLVYLETCYLSWVGALYRRSIHDRFGYYDGTFRGAGDTE
FT                   FKSRLLPHIKSKVIDRTLGVFWNYPDERTTQSPAAEIEDMRAWYVHRTLAGVRYAFAHR
FT                   TPEELEQLIYLCLAYRKSYCGHTSSDLEYAYNLSLYLKEIHPQSKALQYLKGIETLLQA
FT                   YRSLDWMPKLSRFSPLAKVLQTRNLAKQIQEEHLATWKEEKSLGLKPDYRIFNDNRHEQ
FT                   HAFLWLTKVEKSES"
FT   gene            536058..537218
FT                   /locus_tag="cce_0526"
FT   CDS_pept        536058..537218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0526"
FT                   /product="unknown"
FT                   /note="contains a methyltransferase FkbM domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49877"
FT                   /db_xref="GOA:B1WP95"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP95"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49877.1"
FT                   /translation="MKQLKEWLKAKLSKALAPEIDQQLGLNQKLEEVRLYGISPWYQGN
FT                   FWEPPVQLALRDLCRPGDVVFDVGANFGGLTTVMSRMVGPKGVVCSFEASPRIVDKCQR
FT                   NIVLSGCSNVQLFHAAVYYKSYSKVPIYLGSHLNDSIYAEQSTGTQGYEVSTIALDDFV
FT                   EYTKLVPNLVKMDIEGAEFDAIKGMAKTIESAKPHLILETQPEDTRCLDFLLEKGYISI
FT                   DLNTYQTIENAQDYPPGVGIRNNLYIHQDRLSQVPYNPPFGFQEVTTLEASDFQGKDNG
FT                   SIGLKTPLILDKGRYLIDVAFTAKGMDNDLTCGVKIGKQPIFRYHAYSNLLASSYRDWV
FT                   IHLSETSKIDLYFDFLNETFDDTLLVQGAKITEITDFKNANTNLYF"
FT   gene            537257..539083
FT                   /locus_tag="cce_0527"
FT   CDS_pept        537257..539083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0527"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49878"
FT                   /db_xref="GOA:B1WP96"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP96"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49878.1"
FT                   /translation="MLIPLVSFLLGFVLLGLSFLSYTNHPSLKRFPSVYQLTIQPLLMA
FT                   GISCIAITLMLGMVGYFGYIAATPLRTIRIALGIIGIFLLSISFLRKINFKMNRQLNLL
FT                   NPPGNHLLSMGSVVKITMVLTILSTLVLTSIFLISFFDANYGGDAFMYHIPFAARIWGI
FT                   ISPEQFTFEKNIEHRFLGFPLLANWLQGFFWNTFQRPEATNLLCYFSLLTFIAYLTFYI
FT                   KIPFYLASLSLLAIPMVHMHAARSYIDLPGNVCISILILTTYFLYTNKVKFNKQTAIII
FT                   FISSATAANMKFQLIPVVFLILCFILPKIILPLWKAYRHDQDRLTKLSKTLFVCFLASF
FT                   IIFLTPIKNTIIYANPFYPVKVEIAGIVLNHNEAPPDFMHENIRKLPRHLRWGRSVLEI
FT                   DVFDSRRPWPWTLGMDFISWDEERFGLGGYFGGYVIFNLLLFVYLCWQNFDLESRVAAI
FT                   IMGLMTLFTPLLPQAYELRYYMYWMMVFVSLNCYLTCRLAKQKPSQKLINPRNLGLVAA
FT                   VFMVIFITKTRYFFTIPEFASFDEQVKRTDIIDQDILRSIKDGEKVCIVGKAPHPFLYT
FT                   SYFHPPYEYSVKAEFDVPEFVEEGCKGRRILR"
FT   gene            539146..540705
FT                   /locus_tag="cce_0528"
FT   CDS_pept        539146..540705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49879"
FT                   /db_xref="GOA:B1WP97"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP97"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49879.1"
FT                   /translation="MLKIEKSSGFYLVIILILTFLLRVVFLGSIPNGFFTDEASNAYDA
FT                   YSILHTLKDQYGEFLPWYFKSANDYREGLYMYLMVPFIKVFGLNPFGARITSAVIGTLT
FT                   VFIVYHLAKELFNQKIGLLSALFLAILPWHIHFSRITFRAILVPCLFCLSLFLFLKSFK
FT                   NPKWLIVSSILFSLSIYTYNSARVFIPLFLLGLASIYWEHLWKHRYYTFWAFIAFCILF
FT                   IPQLIYQLSPEGMARANTVGIQTDFNKIISDYFSYFSPNFLFFEGDPSPRHKINNMAGL
FT                   YAFQIPLLLIGLLLLLKEKSSSKWVLYLWLILYPIPAAFISPESAVRTLGSTPLFAIIS
FT                   GYAVAEITDFLKGIWKQIITFLLIVIMFANLVIYCQRYVFEYPRWHTDVWLSTLGETIS
FT                   YADRTSNECIIYSSNVYGTYAYILIPFFTKMPPSQYHQYGVDIVENKLDMGRWKIQDLN
FT                   NMDELNTNCLYLLSGDPNANKPKGKDGEILEAKGYQEKFIHSFKDINNVEFYRLVEIEK
FT                   KS"
FT   gene            complement(540672..541556)
FT                   /locus_tag="cce_0529"
FT   CDS_pept        complement(540672..541556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0529"
FT                   /product="putative alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49880"
FT                   /db_xref="GOA:B1WP98"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP98"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49880.1"
FT                   /translation="MLNNFQKLTITTSEVKINLVKGGKGYPLLLLHGYPQTHVMWHKIA
FT                   PNLAQEFTVIIPDLRGYGDSDKPIGMTDHYNYSKRVMAQDQIEVMAQLGYDQFYLVGHD
FT                   RGGRVAHRLTLDYPNKVKKLALLDIAPTYQMYSETDQEFAKVYYHWFFLIQPFPFPETL
FT                   INQNPDFFLTHCLQSWSKTDRPFSSEAMAEYLRCFRDPNTVHGTCEDYRASATIDLEHD
FT                   RTDMDKKIECPLLVLWGNKGVIEKTYDVITSWQKRATNVQGKAVNCGHFLPEESPEETY
FT                   QYLHDFFSISTKR"
FT   gene            541643..542119
FT                   /locus_tag="cce_0530"
FT   CDS_pept        541643..542119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0530"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49881"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B1WP99"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49881.1"
FT                   /translation="MIIMAIEIERKFLVINDNWRSLGIGKVYKQGYIATADKITTIRVR
FT                   IIGNEAYLTIKSKTEGISRQEFEYPIPLEDAEIMLNTLCDRPLIEKVRYTINQEKLIWE
FT                   IDEFKGDNEGLILAEIELKSEDQVINFPDWVGEEVSHDPKYYNVNLVKHPYKIW"
FT   gene            542249..543670
FT                   /locus_tag="cce_0531"
FT   CDS_pept        542249..543670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49882"
FT                   /db_xref="GOA:B1WPA0"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49882.1"
FT                   /translation="MVEKSQQKQKLLQELVGKDQGKNQINLLPKKIADPINKNLQNRYQ
FT                   GLIEQEELDGLNVWESNEIIKQLDAEKPISKIDVDRMVVDNPTQKIIGILPSNNLNLSA
FT                   ESPSLGSIIVSPIPVALLTLVSGVILLQKKDTIAQFFFDKDGIVEQIMEKLGLAKPKVS
FT                   ETAIFLHNRTLENAKLLAKSAQAVDKNKFSKHEFLLFAKIKFCLQYNQGEYEGLDHSIQ
FT                   LFKSAVKAQKSYVIISQIESMCQGIKQKEFYDYVNRKLQKFDDSETFNEQINEKLTEIL
FT                   PKIKTEEGKNKLQTYAEEIAHLSEDICSLQLFSWFNQQQLTEFSVLKSIIEIIESLDET
FT                   DVINLKALTCLVMVHYDNFEALGQMIGVTGKKSSPDTYARMIQYIALEERHKKSYGQFE
FT                   QLINVMRQWYPLYQGIKGIRDEYPEKDYRKPKDFLQEIPGIELYHKYRNYLTDQKTGHI
FT                   YIDFGEETESEIEDN"
FT   gene            complement(543672..543956)
FT                   /locus_tag="cce_0532"
FT   CDS_pept        complement(543672..543956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0532"
FT                   /product="hypothetical protein"
FT                   /note="contains a thioredoxin fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49883"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49883.1"
FT                   /translation="MQLYNFNQMSSVLLGGSLGDRSILVCQGRCCRKDGSKKILTALES
FT                   QTSGDIKVMPCGCLGQCGNGPNIIILPEEKLYQRVSPKDVSVLFLTHQN"
FT   gene            544199..544294
FT                   /locus_tag="cce_0533"
FT   CDS_pept        544199..544294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49884"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49884.1"
FT                   /translation="MAASTAILAGLLLEELGEGLLYFQAEQDLIN"
FT   gene            544370..545983
FT                   /locus_tag="cce_0534"
FT   CDS_pept        544370..545983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0534"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49885"
FT                   /db_xref="InterPro:IPR017601"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49885.1"
FT                   /translation="MDQDITNKIRQQDTEEKQALTLLLERYLSDQDQLFVQKTQMGTTQ
FT                   GYLSSVSLEWLARRVHFALELPLFRRKYDPETNNIIRDSETVEELQQRPLDWSRQSHLA
FT                   QYLAVLNNHKFPPILVVISQDWVNDPTASEWDFEHRAKVSVDNFTSLDKNDSIGLLNIG
FT                   ENYSIFALDGQHRLMGIQGLMELLKTGKLEVYNKVKKATGNPITLDELIEEYDLDPIAL
FT                   QSLAKEKIGVEIIPAVIKGETYEEARRRVRSVFVHVNRMAMSLSKGQLVLLNEDDGFAI
FT                   VSRRLAITHPLLKDRDEKDWNPRVNWDSATISNKSTVLSTLQALQDMTEGYLKYKFPHW
FT                   KSKDKKNLIALRPDDKEIEEGLKLLSELFDGLASLPSYRQLEHGIKTYELRRFNHENGG
FT                   GEGNFLFRPVGQIALAQALGFLVFHKNFNSKSIINKLIYFDEIGGFSYMDTSQSVWYGV
FT                   LYDPMKKRIQVSGKKLASRLLIYLLGGLKDDLEKAEIRRELAEARTIKDAATNEEKTID
FT                   FQGNFVNPKQVGLPNILVDN"
FT   gene            546034..546396
FT                   /locus_tag="cce_0535"
FT   CDS_pept        546034..546396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0535"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49886"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49886.1"
FT                   /translation="MNPDTIFQLLQQSFRVGVGFTAAILETLQDPQKRNKTLSELQQEI
FT                   AQKIEEWAKKGEITEKEAREFVDQWLNSQSSPNSPQGYPSSTNTKANVNQEIQQLTEKI
FT                   ITLRQELEDLREKKKS"
FT   gene            complement(546493..546735)
FT                   /locus_tag="cce_0536"
FT   CDS_pept        complement(546493..546735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0536"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49887"
FT                   /db_xref="InterPro:IPR025477"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49887.1"
FT                   /translation="MNLSTHFPVSFSRYSIDFIQQEARHLVDRGVISRQQPISSLCDYI
FT                   PPREWIWVEHELEKFEYLLRDRIGDLISSETWSND"
FT   gene            complement(547036..547290)
FT                   /locus_tag="cce_0537"
FT   CDS_pept        complement(547036..547290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0537"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49888"
FT                   /db_xref="InterPro:IPR025477"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49888.1"
FT                   /translation="MSSITLPSPPSSAPSTTYTINMIKDEVRHLVESGVVSRQQPLYVL
FT                   CEFIPPREWVCIETELERCEYLLRDQIGDLMACETWEND"
FT   gene            complement(547448..548167)
FT                   /gene="cbiL"
FT                   /gene_synonym="cobI"
FT                   /locus_tag="cce_0538"
FT   CDS_pept        complement(547448..548167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiL"
FT                   /gene_synonym="cobI"
FT                   /locus_tag="cce_0538"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49889"
FT                   /db_xref="GOA:B1WPA7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49889.1"
FT                   /translation="MRAKRLGSLYGVSVGTGDPELITIKGQRLLQETSIIAFPMGVNGK
FT                   QGLAEKIITPWITPQQKKLPLYFPYLQDEQQLKQAWKDATETVWEYLYQGLDVAFACEG
FT                   DISLYSTFTYLAQTLREDHPQVTIQTIPGVCSPVATASVLGIPLTLGSQKLAIIPALYN
FT                   MAELDQLLSWADVIVLLKVSSVYSQVWHRLERLNLLDHAFIVERANQPEEKIYRNLRDH
FT                   PTLDLSYFSLMIITGHC"
FT   gene            548468..550471
FT                   /locus_tag="cce_0539"
FT   CDS_pept        548468..550471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0539"
FT                   /product="hypothetical protein"
FT                   /note="contains EAL and PAS fold-3 domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49890"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49890.1"
FT                   /translation="MRKSMNNSPENIREAFSEQRVNYYHQLALDNLMDVISFHTVEGIY
FT                   LYISPSCQSFLGYEPQVFIGQSAEVLCHPEDCDVIRTFYQQLKQQWNSDPITYRIRHAV
FT                   GHYVWLETSAKVIPNQKTGEIQEILCISREVTKQKQNQEHFKNYQQPHIFILDNLPDLI
FT                   TTHSKEGIFQYVSQVSYQLLGYIPQALIGRTLASFCHGQDQVLIKQFYQELEQKKSLAS
FT                   VIYRMSHQEGYYLWIETLGKVILHPQTGEIQEILCVSRNITKRKQIEEALIQAERQYYK
FT                   IFEKSNQGIFQLSPEGYFIDVNPALAQLYGYNNPQDLLESIHKRTNPVYVEGKNHDSLL
FT                   DILKTDGEIINFQSQIYCKNGEIIDIEETIWAVYDQCEQILYYQGTVQKVINPQIKGDT
FT                   LTRIQLETDLRQAIKNKQLSLYYQPIVELDTGHLSGFEALIRWQHPIKGPISPIEFIPI
FT                   AEESGLINTLGWWVLEQACYQLQTWQNLNTQAAKLVMNVNVSAQQLKQETWVERLNHLL
FT                   EKMGVEGKQLKLEITESCLLETVQNETQRVRQLKNLGLGLCIDDFGTGYSSLSRLHEFP
FT                   IDTLKIDRSFISKLGISDKVIVPMIINLAHTLGMNVVAEGIETREQFNQLQGLNCELGQ
FT                   GFFFAKPMTGEQATHWVMQEIRSRQEFGVNTP"
FT   gene            550541..551899
FT                   /locus_tag="cce_0540"
FT   CDS_pept        550541..551899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0540"
FT                   /product="Fmu, rRNA SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49891"
FT                   /db_xref="GOA:B1WPA9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPA9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49891.1"
FT                   /translation="MQPTTKKTNARQLTLDILRQIDRKNSYTDIALDRAFNQTHLNPSD
FT                   RSLCTELVYGIIRHQRTLDTLIDQLGKKKAKQQPPDLRRILHIGLYQLRYLDNIPPSAA
FT                   VNTSVNLAKEYKLNRLSGVVNGILRQYLRSSETDGDPLILPPNPIEKIAIQYSFPDWMI
FT                   ETWVQQWGEATTEQLCHWFNQTPTIDIRINPLKTTLETLQTQLTEAGINATPFPPLPCT
FT                   LRLQGKIGSIQTLPGFHQGHWTIQDSSAQLVSYLLDPQPGETIIDACAAPGGKTTHMAE
FT                   LMGDQGTIIACDRTPSRLKKVQQNAQRLQLNSIQTILGDSRHLPQLINTADRVLVDVPC
FT                   SGLGTLHRHPDIRWRQTPEKIQELSRLQQEILTQAAQWVKPQGTLVYATCTLNPTENQQ
FT                   IIESFLTHHPQWNLKPPSVHWLFSPFMTSSKWIQILPHEHHTDGFFMVKLKKG"
FT   gene            551965..552387
FT                   /locus_tag="cce_0541"
FT   CDS_pept        551965..552387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0541"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49892"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49892.1"
FT                   /translation="MDTQTQKKQLLKILIGAAWIDGIIQVEERDYLKRMAQSHGLSEDV
FT                   DLKSLLSELKPVQPNQCYQWLEEYLGDNPTIHDYQELLETLSALIYSDGDVQMQEAQLL
FT                   TKLQLLDPAQESPKSAFDKILKAIQKVYKKAINQKL"
FT   gene            552530..553237
FT                   /locus_tag="cce_0542"
FT   CDS_pept        552530..553237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49893"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49893.1"
FT                   /translation="MKTLEDGSSNIRLAVLIDAENVSANIIEALLQEVAKYGTANVKRI
FT                   YGDWTSNQLNSWKGKLNKLALQPIQQFRYTTGKNATDSALIIDAMDLLYTGNFDGFCLV
FT                   SSDSDFTRLASRIRESGLIVYGFGEKIKTPEAFVVACNKFIYTDILAHQQPSGNEKITT
FT                   NKKLLELLKSAYDSVADEEEWVHLGPFGSQLTKLSPSFDSRNYGYKKLSELVQSVDIFT
FT                   IKKTRFHLMIKLK"
FT   gene            553248..553760
FT                   /locus_tag="cce_0543"
FT   CDS_pept        553248..553760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0543"
FT                   /product="putative GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49894"
FT                   /db_xref="GOA:B1WPB2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49894.1"
FT                   /translation="MEKIRSATIEDLEEIVNIYNASIPSRLATGDLEKIQVESRLKWFQ
FT                   ERDHKHYPIWVMEKDNQVLGWISLQHFYGRPAYKSTAEISLYIAENHRGQGIGKKLLGY
FT                   VIEESPKLGLTNLLGFIFAHNQPSLNLFKKYNFQQWGYLPKVAQLDNIERDLIIMGLHL
FT                   DYKKDKI"
FT   gene            553774..554940
FT                   /gene="corA"
FT                   /locus_tag="cce_0544"
FT   CDS_pept        553774..554940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="cce_0544"
FT                   /product="magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49895"
FT                   /db_xref="GOA:B1WPB3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49895.1"
FT                   /translation="MTQSPITEPQILNPDELEKEEESDYFDYFFDEPGSEPGTLNIEPD
FT                   AKPSRIVLIDYDESHAIRKVDVTPKALTPYLGTNTISWMDVQGLGSERVLKQIGDIFKL
FT                   HPLLLEDVVNVPQRPKLEDYNEQLVVIVQMVRPNANEEGFESEQVSFVLGNRYLVTFQE
FT                   EEIEDCFDIVRERIRANQGKVRQQGADYLMYLLLDSIIDGYFPVLEDYGDRIEDIEDEL
FT                   AIAPNTNQLKEIYVIRRELLALRRAIWPLRNVTNMLVRGESSLISSEAQIYFRDCYDHV
FT                   IQILDIVETYRELASSLMDAYLSSMSNKMNEVMQVLTVVSTIFIPLTFIAGVYGMNFEY
FT                   MPELKTRWGYFGSLGLMAAIAGGLIYFFWRRGWFEPFARPNIPLSKKD"
FT   gene            554998..555295
FT                   /gene="rnpB"
FT                   /locus_tag="cce_RNA009"
FT   ncRNA           554998..555295
FT                   /gene="rnpB"
FT                   /locus_tag="cce_RNA009"
FT                   /product="RNase P"
FT                   /note="Rfam score 181.69"
FT                   /inference="nucleotide motif:Rfam:RF00010"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(555439..555867)
FT                   /locus_tag="cce_0545"
FT   CDS_pept        complement(555439..555867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0545"
FT                   /product="putative Nitrogenase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49896"
FT                   /db_xref="InterPro:IPR006503"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYC3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49896.1"
FT                   /translation="MANVTFYEKPGCKNNTKQKNLLIAAGHNLEAKSLLTEPWTAEKLR
FT                   PFFGDLPVSLWFNKSAPRIKSGEVIPDSLSEEKALELMIADPLLIRRPLIQVEAVYRVG
FT                   FDPETIDAWIGLNPENPITDDLETCPRSHESKPCATVQ"
FT   gene            complement(555867..556463)
FT                   /locus_tag="cce_0546"
FT   CDS_pept        complement(555867..556463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0546"
FT                   /product="hypothetical protein"
FT                   /note="contains a thioredoxin fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49897"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49897.1"
FT                   /translation="MSSVNSSQTIPFQLQGKFVGFVYKSNGQSKALILAVGERELKIKI
FT                   DKSLRDTKSLNVLPGEWISIAGEQEFKGNFTKLKLKAYEITRLSCNVECDQEKENDATV
FT                   NPRGKTCPKKGKILLCGKSDCAKRGGRKLHQMLEQTLCNLGLQDHVTIEKTSCQKRCGK
FT                   APNLILMPGKAKHSKANPKNIAELLEEHYITSLNK"
FT   gene            complement(556790..556990)
FT                   /locus_tag="cce_0547"
FT   CDS_pept        complement(556790..556990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0547"
FT                   /product="nifT/fixU"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49898"
FT                   /db_xref="GOA:A1KYC5"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYC5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49898.1"
FT                   /translation="MKVILSREDAGNLSVYVPKKDLEEAVVNETIEGDGKILTLANGWE
FT                   LQFPNLNDDTKLPQTLDAKRL"
FT   gene            complement(557082..557426)
FT                   /gene="nifZ"
FT                   /locus_tag="cce_0548"
FT   CDS_pept        complement(557082..557426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifZ"
FT                   /locus_tag="cce_0548"
FT                   /product="iron-sulfur cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49899"
FT                   /db_xref="GOA:B1WPB7"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49899.1"
FT                   /translation="MGLYNPGEIELNDPPAFEMEAKVRLRRMIRNDGTFPGKEVGETLA
FT                   KKGDVGYVVGIGTYLQSYYIYAVHFLEKGYVVGCRRKELIPADETFIDDGDDEDMEEFV
FT                   EEPSLQESQV"
FT   gene            complement(557413..558546)
FT                   /gene="nifV"
FT                   /locus_tag="cce_0549"
FT   CDS_pept        complement(557413..558546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifV"
FT                   /locus_tag="cce_0549"
FT                   /product="homocitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49900"
FT                   /db_xref="GOA:B1WPB8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49900.1"
FT                   /translation="MNHVHVNDTTLRDGEQAAGIVFSAIEKIAIACLMDAIGIPELEVG
FT                   IPAMGGSEAEAITAIVQKGLKTALLGWNRAVRSDIEASIACGLRRVHISVPVSDIQIKA
FT                   KFKGKTNLVWDRLRDSINFALDHDLFVSVGAEDASRADESFLVEVAQFAESLGASRFRF
FT                   CDTVGILNPLTTAQKVGKLVKSIKMPIEMHTHNDFGLATANALAGLQAGAVSVNTTVNG
FT                   LGERAGNAALEEMIMALKRLYQVDLGMETSRLRELSQLVVKASGIPLPPWKAIVGDNVF
FT                   AHESGIHAHGVLQNPQTYEPFSPDEVGWKRRLVVGKHSGRHLLTNLLSQHGISLNHEES
FT                   QVVLDSVRHLSVQMKRSLTVEELIDVVTNRSMSHGIV"
FT   gene            complement(558575..558814)
FT                   /locus_tag="cce_0550"
FT   CDS_pept        complement(558575..558814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49901"
FT                   /db_xref="InterPro:IPR021336"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPB9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49901.1"
FT                   /translation="MITERFSAVMENNSISTEFSQFLQQEMALSRDDLAVVINNQRQPG
FT                   DPIPMLLWQYGLISVTQLQRIWDWLDAQVYFQFP"
FT   gene            complement(559007..559105)
FT                   /locus_tag="cce_0551"
FT   CDS_pept        complement(559007..559105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49902"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPC0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49902.1"
FT                   /translation="MGYPKWRTRRAQGNAHQEKQQWDCDVLPYLLA"
FT   gene            complement(559148..559432)
FT                   /locus_tag="cce_0552"
FT   CDS_pept        complement(559148..559432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49903"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPC1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49903.1"
FT                   /translation="MMQPYHSDALISQVEKVSRCDRWSVYQRLQELTIPCWCPEDGSLW
FT                   VEIEHGLHAILLRSAIYGAIAPRQELVDWLERCWDTVDSESIKSYQNRQ"
FT   gene            complement(559449..560159)
FT                   /gene="cysE2"
FT                   /locus_tag="cce_0553"
FT   CDS_pept        complement(559449..560159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE2"
FT                   /locus_tag="cce_0553"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49904"
FT                   /db_xref="GOA:B1WPC2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPC2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49904.1"
FT                   /translation="MFGSLPVRERRGSPSESSISEPRTSRPNLLSFLRKDFQIIFERDP
FT                   AARNWLEVVCCYPGLHALAIHRLSHELWHRNLPFFPRFLSHIARFLTGIEIHPGATLGQ
FT                   GVFIDHGMGVVIGETAIIGDYCLIYQNVTLGGTGKESGKRHPTLGNSVIVGAGAKVLGN
FT                   IEIGNHVRIGAGSIVLSDVPHDCTVVGVPGRIISRSGRGCPLEHGKLPDVEGQVIRSLL
FT                   DRIEELEQKIQKLP"
FT   gene            561118..562590
FT                   /gene="nifB"
FT                   /locus_tag="cce_0554"
FT   CDS_pept        561118..562590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifB"
FT                   /locus_tag="cce_0554"
FT                   /product="nitrogenase cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49905"
FT                   /db_xref="GOA:A1KYD1"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYD1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49905.1"
FT                   /translation="MLQSTGLINTDASTANPTTAPGTSFIPKAKGDCACPSSGDSTQTI
FT                   DAKIQERIAKHPCYSEDAHHHYARMHVAVAPACNIQCNYCNRKYDCANESRPGVVSEVL
FT                   TPEEAAHKALVIGGKIPQMTVLGIAGPGDPLANPKQTFRTFELVADKAPDIKLCLSSNG
FT                   LMLPEYVDRIKELNIDHVTLTINMIDPEIGEKIYPWVRYNRKRYKGIEGVKILHEKQME
FT                   SLDALKEADILCKVNSVMIPGINDEHLAEVNEVIRSKGAFLHNIMPLISAPEHGTHFGL
FT                   TGQRGPTPKELKALQDKCSGNMKMMRHCRQCRADAVGLLGEDRSQEFTKDKFLEMAPEY
FT                   DVAQRQEVHANIEKFTAEFKATKAQQKAQKKANAPKILVAVATKGNRLVNQHFGHAKEF
FT                   QIFEVDGTDVTFVAHRKVDHYCQSGYGEEATLDNIIKSISDCKGVLASKIGHCPQEELR
FT                   KAGLEPYEAYDVIDNVAINFYKDYMQKQALGA"
FT   gene            562594..562794
FT                   /locus_tag="cce_0555"
FT   CDS_pept        562594..562794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49906"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPC4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49906.1"
FT                   /translation="MIDTLSYRPQSSLVSSTRSSQTTVINPSGSNSTQTENNCNTCVDD
FT                   YSIPPCTGFSKDYSCFPSLNN"
FT   gene            562813..563175
FT                   /locus_tag="cce_0556"
FT   CDS_pept        562813..563175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0556"
FT                   /product="4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49907"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYD2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49907.1"
FT                   /translation="MSYTITNECINCSRCRSACPTGAITIQDNVFLIDATLCNDCQGYY
FT                   GTPQCASVCPTNSACLPSYQVTGGSENQMADYWDIWFNRYHNLVSNLKGKQTSPYWEQW
FT                   FDAYSQEISTLMTANS"
FT   gene            563273..564475
FT                   /gene="nifS"
FT                   /locus_tag="cce_0557"
FT   CDS_pept        563273..564475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifS"
FT                   /locus_tag="cce_0557"
FT                   /product="nitrogenase cofactor synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49908"
FT                   /db_xref="GOA:A1KYD3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYD3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49908.1"
FT                   /translation="MRDCIYLDNNATTQIDEEVLGAMMPYLTLYYGNPSSMHTFGGQVG
FT                   KAVKTAREQVASLLGAEPSEIIFTSCGTEGDNAAIRAALTAQPNKRHIITTEVEHPAVL
FT                   NLCRHLEKQGYTVTYLGVDSQGRLDLDEVQASITGGTALVTIMYANNETGVVFPIEQVG
FT                   ALAKEYGALFHVDAVQAVGKIPLDMSSSTIDMLTLSGHKVHGPKGIGALYVRKGTRFRP
FT                   FMVGGHQERGRRAGTENVPGIVALGKACELAESHLANISHERQLRDYLETSILTLIPDT
FT                   VVNGSTKERLPNTTNIGFKYIEGEAILLSMNQYGICASSGSACTSGSLEPSHVLRAMGL
FT                   PYSVLHGSIRFSLSRYTTQDEIDRVIEVLPDTIARLRSLSPFSSDDATWLQEQEKATLA
FT                   K"
FT   gene            564649..565530
FT                   /gene="nifU"
FT                   /locus_tag="cce_0558"
FT   CDS_pept        564649..565530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="cce_0558"
FT                   /product="iron-sulfur cluster assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49909"
FT                   /db_xref="GOA:B1WPC7"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR010238"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPC7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49909.1"
FT                   /translation="MWEYTDKVMDLFYNPRNQGTITEKGEGQAITTGEVGSIACGDALR
FT                   LHLKVDEKTEIILDARFQTFGCASAIASSSALTELLVGKTLDEALSLTNKEIADFLGGL
FT                   PEEKMHCSVMGQEALEAAIFNYRGIPLDNHEDDEGALICRCFGVTDSRIRRIVLENNLT
FT                   TAEQVTNYVKAGGGCGSCLADIDDMIADILQEKATAVAVATEVVKAKSETKPLTNLQKI
FT                   TLIQQVLEEEIRPFLAKDGGDLELIDIEGDLVKVTLQGACGSCASSTATLKGGIEARLK
FT                   ERVSPELTVIAV"
FT   gene            565791..566774
FT                   /gene="nifH"
FT                   /locus_tag="cce_0559"
FT   CDS_pept        565791..566774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH"
FT                   /locus_tag="cce_0559"
FT                   /product="nitrogenase iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49910"
FT                   /db_xref="GOA:O07641"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07641"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49910.1"
FT                   /translation="MGRNSQGFLTTIRIIVTSATDQPSNFIHSLSNKRESTMRQIAFYG
FT                   KGGIGKSTTSQNTIAALAETNRIMIVGCDPKADSTRLMLHTKAQTTILHLAAERGTVED
FT                   IELEEVLLEGYQGVKCVESGGPEPGVGCAGRGIITAINFLEEEGAYEDLDFVSYDVLGD
FT                   VVCGGFAMPIREGKAQEIYIVTSGEMMAMYAANNIARGILKYAHTGGVRLGGLICNSRN
FT                   VNCEAELIEELARRLGTQMIHFVPRSKQVQEAELRRMTVIEYSPDHPQAQEYRELSRKI
FT                   ENNTNLVIPTPITMEELEELLVDFGILGGEDEYEKALQADKAATKA"
FT   gene            566929..568371
FT                   /gene="nifD"
FT                   /locus_tag="cce_0560"
FT   CDS_pept        566929..568371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifD"
FT                   /locus_tag="cce_0560"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49911"
FT                   /db_xref="GOA:O07642"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07642"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49911.1"
FT                   /translation="MATVEDNKKLIADVLSTYPEKAAKKRAKHLGVYEEGEADCGVKSN
FT                   KQSLPGVMTARGCAYAGSKGVVWGPIKDMVHISHGPVGCGYYSWSGRRNYYIGTTGVDS
FT                   FGTMQFTSDFQERDIVFGGDKKLAKIIDEIEELFPLNGGVSVQSECPVGLIGDDIESVA
FT                   RTKSKETGKSVVPVRCEGFRGVSQSLGHHIANDMIRDWVFPTADKENAEKGFEGTPYDV
FT                   AIIGDYNIGGDAWSSRILLEEIGLRVVAQWSGDGTLTEMKATPNVKLNLIHCYRSMNYI
FT                   SRHMEEKYGIPWLEYNFFGPSKIAASLREIASRFDEKIQAKAEEVIEKYRKQSEEIIAK
FT                   YRPRLEGKTVMMMVGGLRPRHVVPAFKDLGMEIIGTGYEFAHGDDYKRTTGYVEDATLI
FT                   YDDVTGYEFEEFVKELKPDLVAAGIKEKYVFQKMALPFRQMHSWDYSGPYHGYDGFAIF
FT                   ARDMDLALNSPTWGLIGTPWNK"
FT   gene            568553..570088
FT                   /gene="nifK"
FT                   /locus_tag="cce_0561"
FT   CDS_pept        568553..570088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK"
FT                   /locus_tag="cce_0561"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49912"
FT                   /db_xref="GOA:O07643"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/Swiss-Prot:O07643"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49912.1"
FT                   /translation="MAQNVNNIKDHVDLFHQPEYQELFENKKQFEGMPTAEKVQEVAEW
FT                   TKSWEYREKNFAREALTVNPAKACQPLGALLAAIGFEGTLPFVHGSQGCVAYFRTHLTR
FT                   HFKEPVSAVSSSMTENAAVFGGLKNMVDGLQNSYALYKPKMIAVCTTCMAEVIGDDLGA
FT                   FLGNARQDGVIPDDLPVPFAHTPSFVGSHITGYDSMMKSILSTLTEGKKKETTNGKINF
FT                   IAGFETYIGNVRAIKNIISAFDLEGTLLSDTEMYLDSPNLGEFKMYHEGTSLEDAADSI
FT                   NAEATVTLQTYTTPKTREYIEKKWGQKTYTYRPWGVKGTDEFLMGLSELTGKPIPKEFE
FT                   IARGRAVDAMTDTQAWVHGKRAAVYGDPDLVMGLLQFMLEMGIEPVHVLVNNSTKEFEE
FT                   EAKALLAASPYGQQATVWGGKDLWHMRSLLFTEPVDFLVGNSYAKYLQRDTKTPLIRIG
FT                   YPIFDRHHLHRYSTIGYEGAINLLNWIANGLMDELDRKTDTPSVTDISFDLVR"
FT   gene            570299..570607
FT                   /locus_tag="cce_0562"
FT   CDS_pept        570299..570607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0562"
FT                   /product="hypothetical protein"
FT                   /note="contains a Mo-dependent nitrogenase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49913"
FT                   /db_xref="InterPro:IPR009717"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYD8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49913.1"
FT                   /translation="MVMTSPTPYSTGKKFQLDPLFPLKRWLNNIEVTSASFAHLICRVI
FT                   PCSCPFERKITVLGHTMLRIPPLCKLNPFYHEFVALRLKALSYLADVCGENVDHYIC"
FT   gene            570669..572087
FT                   /gene="nifE"
FT                   /locus_tag="cce_0563"
FT   CDS_pept        570669..572087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /locus_tag="cce_0563"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49914"
FT                   /db_xref="GOA:A1KYD9"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYD9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49914.1"
FT                   /translation="MKLTKSKINDLLTQPGCEHNHNKEGQGKNKSCTQTANPGSAQGGC
FT                   AFDGASIALVPITDAAHLVHGPIGCSGNSWNSRGSLSSGPMTYKMGFTTDLSENDIIFG
FT                   GEKKLYKAIAQLIKKYNPAAVFVYSTCVTALIGDDLDAVCKAATNKYETPIIPVHSPGF
FT                   VGSKNLGNRLGGEALLDHVVGTKEPEYTTAYDINLIGEYNVAGEMWGVLPLFKKAGIRV
FT                   LAKITGDARYEEVCSAHRAKLNVMICSKALINMASAMKERYNIPYIEESFYGVQDMNRC
FT                   LRNIAQFFGDQVLIERVEEIIEEETAKLDIALAPYRERLKGKRMVLYTGGVKSWSIVSA
FT                   AQDLGMEVVATSTKKSTEEDKGRIKKLLGKDGIMLEKGSPEELLRVVQKTKADLLVAGG
FT                   RNQYTALKAKIPFLDINQERHHPYAGYIGLVEMARELSEAVYSPIWTQVRKPSPWEIWQ
FT                   QEHESLLNLEAEGE"
FT   gene            572192..573556
FT                   /gene="nifN"
FT                   /locus_tag="cce_0564"
FT   CDS_pept        572192..573556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifN"
FT                   /locus_tag="cce_0564"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49915"
FT                   /db_xref="GOA:B1WPD3"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPD3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49915.1"
FT                   /translation="MTTILNPNKSLSVNPLKMSQPLGAALAFLGLRKMMPLFHGSQGCT
FT                   AFAKVVLVRHFRESIPLSTTAMTEVSTILGGEDNVEQAILTILEKYQPQIIGLLTTGLT
FT                   ETRGDDMKRILKTFRDKHPELDSFPVVSVSTPDYKGSLQDGYTAAVESIVAADYGNVPD
FT                   DEPPTVGMKPQVTVLCASHLSPGDVEELKTVIEGFGISPIMVPDLSRSLDGHLEDDYHT
FT                   VTTGGTSLTQLKQLNRSCLTLAIGESMRKAATILQERFGTKYKVFPRLAGLDAVDSFLW
FT                   ELSQILTSRCDHHFPIVPNVPAHLQRQRRQLQDVILDTHFYFGGKKVALALEPDLLYQT
FT                   AWLLTEMGANIQAAVTTTKSPILEDLPIDSVTIGDLEDLEELAVGSDLIITNSHGTSLA
FT                   KRLKAPLYRMGYPIFDQLGLGQRCLVGYRGTMKFLFDVGNILLEEEAKHSPVALH"
FT   gene            573611..574024
FT                   /gene="nifX"
FT                   /locus_tag="cce_0565"
FT   CDS_pept        573611..574024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifX"
FT                   /locus_tag="cce_0565"
FT                   /product="probable nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49916"
FT                   /db_xref="GOA:A1KYE1"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR013480"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49916.1"
FT                   /translation="MKVAFTTSDNVHVNAHFGWAKNIDLYDVSPDGFNFVNTLEFGGDL
FT                   KEDGNEDKLVPKLEALDGCTLLYVSAIGGSAAARLIRQNVTPIKARTDQDKIDEILGEL
FT                   VKTLKGNPPPWLRKVLQKEAGLEPTPNFLAEDE"
FT   gene            574160..574675
FT                   /locus_tag="cce_0566"
FT   CDS_pept        574160..574675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0566"
FT                   /product="DUF269-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49917"
FT                   /db_xref="InterPro:IPR004952"
FT                   /db_xref="PDB:3NJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPD5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49917.1"
FT                   /translation="MFIDNGNALIVIVIMTTTTNSETNTLLVEQSPFLQSLVQQIRAYD
FT                   HYGVYRTWTDELVIAPYVIPKKKRREISLEGDIDPTTKLRILCYFRAIAALIEKETGLL
FT                   CQVVVDLNHEGFGWALVWGGKLMVVSRSLRDAHRFGFDTLEKLNDQGTKLANAGIELVN
FT                   KFPEVARL"
FT   gene            574758..574994
FT                   /locus_tag="cce_0567"
FT   CDS_pept        574758..574994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0567"
FT                   /product="DUF683-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49918"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="PDB:3CSX"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49918.1"
FT                   /translation="MTVATDNNPTPEAVADLKKKVRKLNSKAGQMKMDLHDLAEGLPTD
FT                   YENLVETAEKTYEIFRELDQLKKKLNIWEETLK"
FT   gene            574991..575341
FT                   /gene="nifW"
FT                   /locus_tag="cce_0568"
FT   CDS_pept        574991..575341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifW"
FT                   /locus_tag="cce_0568"
FT                   /product="nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49919"
FT                   /db_xref="GOA:A1KYE4"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49919.1"
FT                   /translation="MTITADTPRTLAEFTKLIDTEDYLNFFGISYDPTFVNVNRLHILK
FT                   QFSLLIAQVDKAFPDLSESEKLEKYQLAFSEAYELFKTSSPLETKLFKVFKDVPSNVVL
FT                   LDDLTKEAGIMQ"
FT   gene            575470..576285
FT                   /gene="hesA"
FT                   /locus_tag="cce_0569"
FT   CDS_pept        575470..576285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hesA"
FT                   /locus_tag="cce_0569"
FT                   /product="putative molybdenum cofactor
FT                   biosynthesis/nitrogen fixation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49920"
FT                   /db_xref="GOA:A1KYE5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49920.1"
FT                   /translation="MNFTPTELERYSRQIQLPGFGEEGQKRLKDSTAVVTGVGGLGGTV
FT                   ALYLAVAGVGKIILVRGGELRLDDLNRQILMTNSWVGQPRVYKARETLLNINPDIEVEA
FT                   VNEFVTADNIDALVQQADIAFDCAFDFKERTLLNNACVRWGVPMVEAAMSGMDAYLTTI
FT                   IPGETPCLSCIFPETPEWDRWGFGVLGAVSGSLACLAALEGIKLLTGLGEPLTGQLLTM
FT                   ELGTATFAKRRPYHDPNCPVCGNFTKQRLSGYVTNKKVGVRSQESGVRS"
FT   gene            576357..576716
FT                   /gene="hesB"
FT                   /gene_synonym="yadR"
FT                   /gene_synonym="yfhF"
FT                   /locus_tag="cce_0570"
FT   CDS_pept        576357..576716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hesB"
FT                   /gene_synonym="yadR"
FT                   /gene_synonym="yfhF"
FT                   /locus_tag="cce_0570"
FT                   /product="Fe-S cluster biosynthesis, putative nitrogen
FT                   fixation related protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49921"
FT                   /db_xref="GOA:A1KYE6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49921.1"
FT                   /translation="MTVTLTEKAALKLRTVLYGNSNNITGIRVGVKDGGCNGYEYALNL
FT                   VKEANNEDVRFEQDNVPIYVDPKSVSLLDGVVIDFVDSLTQSGFTFTNPNATDTCGCGK
FT                   SFSTANCSGQATSCS"
FT   gene            576816..577157
FT                   /locus_tag="cce_0571"
FT   CDS_pept        576816..577157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0571"
FT                   /product="2Fe-2S ferredoxin, putative nitrogen fixation
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49922"
FT                   /db_xref="GOA:B1WPE0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPE0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49922.1"
FT                   /translation="MTATYQVRLMKTFKQKNKETGKKEEIAEIDVTLEVPEDVYIFDAA
FT                   EEEGLDLPSSCRSGACSSCVGRIVEGEVDQEDQSFLDDEQVEKGWVLLCVAYPRSNCTI
FT                   KTHQEAYLA"
FT   gene            577248..577676
FT                   /locus_tag="cce_0572"
FT   CDS_pept        577248..577676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49923"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49923.1"
FT                   /translation="MNTINQDNNVLSLRYSMNLKWRTFVYKTAFWMMGEIVLNILGLDD
FT                   VANYGEFLFGHELELSKKNHRTVKLSCLKPKFCDKVNENCPVDEVALQFSDSPLENCIT
FT                   NHKIFFKKCTKIKHYCIKASLFSDLSYNLKWEDYHRDS"
FT   gene            577666..578019
FT                   /locus_tag="cce_0573"
FT   CDS_pept        577666..578019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49924"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYE9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49924.1"
FT                   /translation="MIREKLVNEYRHLVNASYPYINSLLNNCYIKIIDGYLNPVSPAYY
FT                   YLGIYYAGRNGKEITLYKYELKNIAKTFGMIDVVFINAKRIIRDPASTLKQENPRLWLE
FT                   LYWISSKVTTNLD"
FT   gene            578232..578858
FT                   /locus_tag="cce_0574"
FT   CDS_pept        578232..578858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0574"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49925"
FT                   /db_xref="GOA:A1KYF0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49925.1"
FT                   /translation="MKCNQCPDSCQKNPQTSNRLWQSFLPKRFQGKSPEVVSQGTIALV
FT                   GSPNVGKSLLFNVLTGAYTTVSNYPGTTVEASRNYITIAGKTITIIDTPGMYSLIPMTE
FT                   EERFSRELLFKESLDLAVHVIDAKNLSRMLNLTFQLMETQVPIVLAVNMIDEAEKLGIW
FT                   VNEKQLEASLGIPVVTLSAAQQRGIKSLTAKMANYVHIPALSYSY"
FT   gene            578824..580287
FT                   /gene="feoB2"
FT                   /locus_tag="cce_0575"
FT   CDS_pept        578824..580287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB2"
FT                   /locus_tag="cce_0575"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49926"
FT                   /db_xref="GOA:A1KYF1"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49926.1"
FT                   /translation="MSTFLRYPTAIEEGITKIECLLQSDHNVVKAAIEPLVSRRSLALL
FT                   LLQKDPLLWDKVRQSEPKFEAIERVIESVQSQFSDPLMLVIAKTRHQAAKKIEESAIIK
FT                   IKKKSTESEEFFHRLTVNPVTGFPLLFLIVYVGIYQFVGGFGSGVLVNNFEGVFTQQIN
FT                   PLIDAIASRLLPWTILQDLVANEQGILTLGMRYVIAIIFPITTTFFLFFSILEDSGYLP
FT                   RISLLIDHLFKMIGLSGRSIIPLILGLSCGSTGSLVTQTIESKRERFIVSLLLALVIPC
FT                   SAQLGIFIGLLSQNFTALIIWVMCITFIFAIIGALTTKALPGSLSYFYMEIPPLRLPHF
FT                   RSILTKTYSRVRWYLSEVIPWFILASVLIWLGKLTGLLLLLTKAIEPIMLKLELPPEAS
FT                   IMFIYGFFRRDYGAAGMFDLHHSGVLMGRQLVVSAVTLTLFIPCLSQFLFMVRERGLKT
FT                   TIALSSLVIVFAFSMGYCLNKLLLILEII"
FT   gene            580287..580541
FT                   /gene="feoA2"
FT                   /locus_tag="cce_0576"
FT   CDS_pept        580287..580541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA2"
FT                   /locus_tag="cce_0576"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49927"
FT                   /db_xref="GOA:B1WPE5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPE5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49927.1"
FT                   /translation="MMFTQTFTIESSALNLMKEKEKGVITQFRKSDETLLRKLIAIGIM
FT                   PGLSITLEQKIPSYVVKVEGTRIALDRSIAKAIYVRKTK"
FT   gene            580665..581477
FT                   /locus_tag="cce_0577"
FT   CDS_pept        580665..581477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0577"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49928"
FT                   /db_xref="GOA:B1WPE6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPE6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49928.1"
FT                   /translation="MKLATKQNHSQFAFIVSIPIAILGGLMGLGGAEFRLPILAGPLGY
FT                   SASQVVPLNLAISLITILISLLVRGKILSLSTVMPYSQVIIFLIVGAMIMAFIGASWAK
FT                   HLSNEKLERIILVFLIIIGCALMIEGFLPESLPALVPSIPGLQIVVALGCGLIIGLVSS
FT                   LLGVAGGELIIPTLIFAFGVDIKIAGTSSLLISLPTVIVGLLRYHHQGSFVDKQPLQDT
FT                   VLPMGLGSLIGAIIGGLLVGIIPSNLLKIALGIILNIAALKVFLHSKA"
FT   gene            581507..583462
FT                   /locus_tag="cce_0578"
FT   CDS_pept        581507..583462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0578"
FT                   /product="putative molybdate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49929"
FT                   /db_xref="GOA:A1KYF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49929.1"
FT                   /translation="MTLDWSPVWISLKTAALATLIAFFLGAIAARTMFKYRGKAKGLID
FT                   GIFTAPLVLPPTVVGFFLLLLLGKYGPIGRLLRAFDVTIIFTWYAAVIAATVVAFPLMY
FT                   KTALGAFQQIDTTLLSSARTLGATEWQVFWKVLLPLARPGLIAGVLLAFARALGEFGAT
FT                   LMLAGSIPGRTQTIPIAIFFAAESGDMAEAMLWVSVMLGLSLTIVVAVNYWSDRRPEKR
FT                   IRKRAKEGHLSLVDESLLPWDHPVTPLTWEYSRTNVLPNPIELIVDIQKQLPGIKINVS
FT                   FSTNQLPLGLLGGSGAGKSFILRCIAGLETPDQGCIILNGRVLFDSRRGINVPIRDRRV
FT                   GFLFQNYALFPHLTVAQNIAFGLPKGLSSVAIRQRVEKQLIAIQLQGLGDRYPQELSGG
FT                   QQQRVALARALASEPDILLLDEPFSALDTYLRDQLEKLLRLSLTHFPGATLFVSHNLEE
FT                   AYRICPNLLILDEGQIIAQGPKQEIFDYPHDFRVAQLTGCKNFSRTLVASENEITALDW
FT                   GCTLKIYEPIPPHLAHLGIRAHQLTFPDIDGIKDGYSDNIFPCWLTSQSETQHRTTLYL
FT                   KLNSAPTSPFDYHLQAEVFKDKWNELKEHPQPWRIQLHPLRLMLLQNSSGSISLEYKPS
FT                   HSSRMTRDDRSNQHPS"
FT   gene            583434..583778
FT                   /gene="fdxB"
FT                   /locus_tag="cce_0579"
FT   CDS_pept        583434..583778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxB"
FT                   /locus_tag="cce_0579"
FT                   /product="4Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49930"
FT                   /db_xref="InterPro:IPR014283"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPE8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49930.1"
FT                   /translation="MIDQINTHPNTRRTLIMASLTGLTFGKLEWIPKFVEAINKDTCLG
FT                   CGRCFKVCGQNVLALMGVNEDGEFVDEDEDDDDIERQVMTIGNKANCIGCEACARICPK
FT                   NCYTHAPLPV"
FT   gene            583877..584113
FT                   /gene="vapB"
FT                   /locus_tag="cce_0580"
FT   CDS_pept        583877..584113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB"
FT                   /locus_tag="cce_0580"
FT                   /product="putative virulence associated protein B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49931"
FT                   /db_xref="GOA:A1KYF6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49931.1"
FT                   /translation="MKQKTAKLFMNGRSQAVRLPQEFRFEGKEVYIHRVGNKVILSPKP
FT                   TTWEDFFEKTPLPSEDFMEQRIDFPPQTREELF"
FT   gene            584114..584509
FT                   /gene="vapC2"
FT                   /locus_tag="cce_0581"
FT   CDS_pept        584114..584509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC2"
FT                   /locus_tag="cce_0581"
FT                   /product="putative virulence associated protein C"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49932"
FT                   /db_xref="GOA:A1KYF7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49932.1"
FT                   /translation="MYMLDTNICIYIIKKRPSTVLTRFQTISSENLYISVMTVAELQYG
FT                   VDKSNAKRKNQEILDDFISRLQVLPWEETAVQYYSKIRNYLEAKGTFIGNMDMLIAAHC
FT                   QSKNYILVTNNIREFERIPDLKVENWI"
FT   gene            584633..584869
FT                   /locus_tag="cce_0582"
FT   CDS_pept        584633..584869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49933"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49933.1"
FT                   /translation="MIEALNKVMTKLEQLPESEQERIAQIILNEVEKQELTVLSSASFS
FT                   LENQPFLGMWKDRKEMQNSSQWVRQLRREQWQV"
FT   gene            584871..585257
FT                   /locus_tag="cce_0583"
FT   CDS_pept        584871..585257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0583"
FT                   /product="hypothetical protein"
FT                   /note="contains a PilT protein, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49934"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYF9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49934.1"
FT                   /translation="MVYILIDTNILIDVANEDLTAITRLVDEAKKAVLSVSIITVVELI
FT                   VGCRNKSELQKLNHFLSQFHYLTLNQEISDLGIQLMQEYYLSHGLMIPDSLIAATAIDY
FT                   NIALLSKNQRDYCFIPSLNLLHYP"
FT   gene            585406..585882
FT                   /locus_tag="cce_0584"
FT   CDS_pept        585406..585882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49935"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYG0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49935.1"
FT                   /translation="MNQLSWYDASEDVKELLVLATDNWENSSISEQYINQALEKAGDNM
FT                   DVLVGAYRFFFYKNKPELALQIAKKVVKIIEEKESLPLEWEQLQPILMKRQQEPNIRLY
FT                   LNAYASQGYIFAKMGQIETAKLITERVQEIDEHRESCATTVFEVLTKNPDDNDD"
FT   gene            585967..586167
FT                   /locus_tag="cce_0585"
FT   CDS_pept        585967..586167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0585"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF433"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49936"
FT                   /db_xref="GOA:B1WPF4"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPF4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49936.1"
FT                   /translation="MNICHGKPSIRGLRYPVEFILELLSSGMSIEDISGDYDDLERDDI
FT                   LAALLFTTRLTQIKSIHQISP"
FT   gene            586330..586581
FT                   /locus_tag="cce_0586"
FT   CDS_pept        586330..586581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0586"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49937"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYG2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49937.1"
FT                   /translation="MTVSRQEQYFTLIDQLMRCPNGEEPNLLTANSELIDQGFIESLVQ
FT                   VSTMMAHENNPDGAKFLIHVARELAKELGLYPEAPANS"
FT   gene            586645..587304
FT                   /locus_tag="cce_0587"
FT   CDS_pept        586645..587304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0587"
FT                   /product="hypothetical protein"
FT                   /note="contains a phosphoribosyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49938"
FT                   /db_xref="GOA:A1KYG3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYG3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49938.1"
FT                   /translation="MLKNIVSIFLQESCPLCERATSEEICNYCQKQLKSCQFKKPHKFW
FT                   QGDLPVFVWGTYDGKLKQAIAALKYDKHPKIGELLGVWLADTWLNYALIHPKLSPLMIP
FT                   IPLHKTKEKIRGFNQSEVIARGFCQVTKYPLNTNGLIRVRQTKAMFGLTVKEKEENIKE
FT                   AFQLGKSLQHTTLSRPVLLMDDIYTTGTTIKEATRILQNQGIKVLGVVAVCTPRHL"
FT   gene            587372..588235
FT                   /locus_tag="cce_0588"
FT   CDS_pept        587372..588235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0588"
FT                   /product="unknown"
FT                   /note="contains TPR_1 tetratricopeptide repeat domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49939"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPF7"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49939.1"
FT                   /translation="MFLTHLKTMIKLKKIYMILLIGSVISVANITLNLTESLSQETPNT
FT                   TEENVSEESEETPSLTAVQWYNKGVDEIDAGNYQAAIEAFTESIKLDETDADAYYNRGY
FT                   SYLVLEQFEEAINDYNKAIELNAEFAYAYGNRCYAYYQLKNYEQSIKDCSQAIELEANY
FT                   ADFYIYLGNAKDDLKMHQAAILAYNQAIAINENNPKAYYNRALAYNRLGQSLQAVEDYT
FT                   KAIQFNPNFADAYHNRGVTRFKLKEIEKAIADLEKAAELFNAQGNTDNAQHAMNTLEQL
FT                   QTEESL"
FT   gene            complement(588326..588661)
FT                   /locus_tag="cce_0589"
FT   CDS_pept        complement(588326..588661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0589"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49940"
FT                   /db_xref="GOA:A1KYG5"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYG5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49940.1"
FT                   /translation="MKRLLSLILLLFAFFCFSFVSPALAGDAAAGKGIFTANCASCHMG
FT                   GGNVVAGASKGLTKDALENNKMLSEEAIIAQVTKGKAAMPAFLGRLTDTQIEDVAAYVL
FT                   SQAEAGW"
FT   gene            588900..589259
FT                   /gene="petE"
FT                   /locus_tag="cce_0590"
FT   CDS_pept        588900..589259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petE"
FT                   /locus_tag="cce_0590"
FT                   /product="plastocyanin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49941"
FT                   /db_xref="GOA:A1KYG6"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002387"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYG6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49941.1"
FT                   /translation="MSKKLGLLVATVALVISSFFIAVSPAAAATVEVKMGSDSGMLAFQ
FT                   PEKIEISPGDTVKWVNNKLAPHNVVFEGADDHNHKSLVFSPGESFEETFNEPGEYTYYC
FT                   EPHRGAGMVGKVIVK"
FT   gene            complement(589320..589988)
FT                   /locus_tag="cce_0591"
FT   CDS_pept        complement(589320..589988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0591"
FT                   /product="KHG-KDPG bifunctional aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49942"
FT                   /db_xref="GOA:B1WPG0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPG0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49942.1"
FT                   /translation="MVIVDSALKPSQSWQKLLQQHRAIAVIRTDSIEEGINMAKAVAAG
FT                   GMKIVEITWNSHQPANIIQQLKQDLPECIIGTGTILTLEDLEKAIAAGIQFCFTPHVHQ
FT                   TLMKTAIDHHIPIIPGALSPTEIITAWQGGASCVKVFPVQAIGGIAYIKGLQGPLGSIP
FT                   LIPTGGVTLDNAAYFIEAGAIAVGLSSQLFPHHALKHQEWNLITQQAELLMKRLSAFRQ
FT                   "
FT   gene            complement(589998..590237)
FT                   /locus_tag="cce_0592"
FT   CDS_pept        complement(589998..590237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49943"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYG8"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49943.1"
FT                   /translation="MSNVQVSICVDDAHLSKIEQIAQKLQSSGMTVTQTLANIGIINGS
FT                   ISSEQLNHVAQIEGVETIERQQTYQLNPPSSHIQ"
FT   gene            complement(590457..591839)
FT                   /locus_tag="cce_0593"
FT   CDS_pept        complement(590457..591839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0593"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49944"
FT                   /db_xref="GOA:B1WPG2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B1WPG2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49944.1"
FT                   /translation="MRLMVGDTWYSRKLNRRENSLMTYSSLNRPIQTTGRYIIVLPEED
FT                   LSSGISAITNSTGVRESDMSVLSNLGIAVVTLDPDRLQSLSSAVAGSEPVLSVEPEQIM
FT                   YALSGNRISESTAHYLQGYKDAITHLVDNLTAETVTSPQKVTAAAFSDGVATWGLQATN
FT                   VINSKYSGAGIKVAVLDTGLDLKHPDFVGRAITSESFIKGEAVQDLNGHGTHCIGTACG
FT                   PFNPPAPASPMRYGIAYNAEIFAGKVLSNQGSGPDGGILEGISWAIANNCDIISMSLGA
FT                   RTFPGDPFPRSYERIAQRALRRGTLIIAATGNESSRPGFISPVGRPANCPSIMGVAAVH
FT                   PDLGVSFYSNGAINPNGGEVNIAGPGGNAGQPPLPEIYSTYSTDTIPQMTPFGIDPNPP
FT                   SRYKAISGTSMATPHVAGIAALYAESTGKRGMDLWNVLIANAKTLPLPVTDVGVGLVQA
FT                   PI"
FT   gene            complement(592286..593413)
FT                   /gene="proB"
FT                   /locus_tag="cce_0594"
FT   CDS_pept        complement(592286..593413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="cce_0594"
FT                   /product="glutamate 5-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49945"
FT                   /db_xref="GOA:A1KYH0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYH0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49945.1"
FT                   /translation="MNHSQTIVIKIGTSSLAQPETGKLALSTIAALVETLTELRQLGYD
FT                   VVLVSSGAVGVGCSRLKLTERPKKIATKQAIAAVGQGRLIRVYDDLFTALNQPIAQILL
FT                   TRRELMERSCYVNAKNTFDALFELGVIPIVNENDTVAIEELKFGDNDTLSALVASLINA
FT                   NWLFILTDVDRLYSADPRTFPDAKPIKVVNSLQLDQLQVKAGNKGSQWGTGGMSTKLTA
FT                   ARLATSVGVTTVITHGKKPENLLKIINGEDIGTKFEAQLKNDNARKRWIAYGLLPRGKL
FT                   YLDKGAVKAISQKGKSLLAAGILKVEGSFDSADAVQLCDETGQEIARGIVNYNQEEINK
FT                   IKGNHSNQIPELLGYDGGGTIVHRDNLVINGTFKN"
FT   gene            complement(593444..594487)
FT                   /gene="glk"
FT                   /locus_tag="cce_0595"
FT   CDS_pept        complement(593444..594487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="cce_0595"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49946"
FT                   /db_xref="GOA:A1KYH1"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYH1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49946.1"
FT                   /translation="MTVLLAGDIGGTKTILRLVNSEQPKNGENLPQQTTLYEKSYPSQN
FT                   YDDLVPIVQEFLKEAKQELEQEITIKNGCFGIAGPVVNNTSELTNLSWSLTGDRLEKQL
FT                   SLERVNLINDFAAIGYGILGLEKDDLYILQDMEPKPNTPMAVLGAGTGLGECFLTPLES
FT                   GIYEVFSSEGSHGDFAPRNELEFELLTYIQDNYNLPRVSIERIVSGMGISAIYQFLRHK
FT                   YPEKESEKFKEIYQAWESKQKVDLSAEVSKAAMENNDALCQQTMELFISAYGAEAGNLA
FT                   LKILPYGGLYVAGGIAAKILPLLKKGSFIEAFKAKGRMSSLLAQMPVYVILNPKVGLIG
FT                   AALRAAR"
FT   gene            complement(594537..595406)
FT                   /locus_tag="cce_0596"
FT   CDS_pept        complement(594537..595406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0596"
FT                   /product="mrr restriction system protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49947"
FT                   /db_xref="GOA:B1WQ25"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ25"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49947.1"
FT                   /translation="MNGYTCFAVECIYSFFNLTHEERKQLLPSGKQAIFDNRVGWAKTY
FT                   FKKADLLESTKWGYFKITQKGKKVLNDNSIQEIDAKFLKQFPEFIDFTNNTKKQHNHLL
FT                   SSESDQQLEEIEDNETPQEQLGKIYLKIREELKKELLENIKQYSPNFFEKLVIDLLIAM
FT                   GYGGSRKEAGEAVGQVNDGGIDGIIKEDRLGLDIIYIQAKRWENTVGRPEIQKFAGALL
FT                   GKQAKQGIFITTSNFSKEAIEYITMIDSEIILIDGERLSALLIDYNVGVSLVESYAIKK
FT                   IDNDYFTE"
FT   gene            595850..597715
FT                   /locus_tag="cce_0597"
FT   CDS_pept        595850..597715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0597"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF1400"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49948"
FT                   /db_xref="GOA:B1WQ26"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR010802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ26"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49948.1"
FT                   /translation="MRNSKVVNFRYFLFFAPMKFLKLLSPFVFNVVGGLSPILLSLVVG
FT                   VSPTLSAENVVLKAGLLHHTIPVEDLQKLVESKEIPHSLKAYNFLLTSEVKQILSQNFN
FT                   IEPLIAEQFLNDLLKSDDGNRLLKQISQALPDSNASELKEALKLLLKQTNHLSIVNFLR
FT                   VYPQETVTIDVSKVAMLGLKMNGSFLHSRLINSQLDEGFKDSSNTEILPKFDPTASGEQ
FT                   TVSIETTVLYDRSRDRYIPLDIYTAKKTHGPLVIMSHGFASDRRFLRYLARHLASYGIT
FT                   VVSVEHPGSDINALIKTATGIKLSQILPSAEFIDRPQDISFVLNQLTLINKKYPQFKGK
FT                   FNTKKVSMIGHSFGGYTALALGGASLDLKTLRRFCQETSPLGRSPADWLQCAAGELPYP
FT                   QRTFKDNRIKQIMVFNPIIGELFGDNLSQIKVPTLMLSASDDGITPTIAHQLKPFKQLS
FT                   GEKYIVMAMGGTHMSISDMNSINSAMGQSTLVREVMGINAEPVRQLVRGVSLAFIHQLT
FT                   PKKSEYEMFLTPTYIESLSEKNLNFRLGKKLPMSVQTWINITNIETPKVSLSSIKSKFA
FT                   PLQNIQHYFVNARQLFLQPQYSTEKLNDLFTGLLHTHDDKLDKWS"
FT   gene            complement(597804..599078)
FT                   /locus_tag="cce_0598"
FT   CDS_pept        complement(597804..599078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0598"
FT                   /product="unknown"
FT                   /note="contains an S-layer homology (SLH) domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49949"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR022222"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ27"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49949.1"
FT                   /translation="MKISRLPLKLATLATVTLGSFIPSNLPVKASTFSETALDQSKVIA
FT                   IARPYGDDKYDLLVIEQIPDKRDCWAESGSNPVLVDPLLLNYDFTGICRRSTDSNGYSI
FT                   RLDGNDLGLDYLLRLVRRDGELVLVGTPRTPGYSEIVIGSTKGMADGFMKIHLYPGWQF
FT                   TKRTYEEKVLGHFYFSGSQAAIAAGGDIPDTPPATTTPVRETPKISFVDVNNNIYQAQI
FT                   AEAVEMGLVSGFNDNTFRPDQPVTREQLISMAVDAIGTVYKVDLDATPERDVVAFKDVD
FT                   SSRWSAKKIKWAQWKFLNLGNPNNTLQPSEPITRAELMDTMRRMAIHLRNQLDLPQELQ
FT                   QTQEPLVFSDTSSSWADGVIKEMSAYCGVATPVNEQGTEFAPDEQATRDYTAAAMVRVL
FT                   ECVKAEAEQAAQQNEEAETVTENQQ"
FT   gene            complement(599287..599820)
FT                   /locus_tag="cce_0599"
FT   CDS_pept        complement(599287..599820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49950"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYH5"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49950.1"
FT                   /translation="MADFGYTFSRKRLNLPQYSGNLDRLKQLSDRIIEILANVSLSTEI
FT                   ARGDILISPVITDLVHYTNAQLRIEYSLKVSEQLQGYLDYFLYTDRSLIIIEAKKGDLE
FT                   YGFNQLAVQLIALDQWKNNKNQSNLLGAVTIGNIWQFGQLDPDKKHIEQGLETYRVPED
FT                   LDPLMRILVQALNP"
FT   gene            complement(599943..601565)
FT                   /gene="ppx"
FT                   /locus_tag="cce_0600"
FT   CDS_pept        complement(599943..601565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="cce_0600"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49951"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ29"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49951.1"
FT                   /translation="MANSNPLQNNMVSEQTCTLAAIDIGTNSIHMVIVEIDKTLPAFTI
FT                   ISREKDTVRLGERDPKTGNLTEAAIARSLASLRRCKDLADSFNVEHIIAAATSATREAP
FT                   NGLDFIWQVEEKIGITINLISGYEEARRIYLGVLSGMDFQEKPHVIIDIGGGSTEIVLA
FT                   DAQEPRFLSSTKVGAVRLTNEFISSDPIDETELTYLRAYVRGMLERPIDEVKRKLKLGE
FT                   SPQAVGTSGTIETLVSIHAIQTLGELPSPLQGYQMSRKDLKDMVKKFVSLTYEERVDLS
FT                   GMSEKRAEIIVAGAVILLEAMTMLDLESITICERALREGMIVDWMLTHGLIEDRLSFQT
FT                   AVRQRSVYKIARKYQVDLGYGEKVATFAVSLFDQLFGVLHDWEKTERELLWSAAILHNC
FT                   GVYISHSSHHKHSYYLIRHAELLGFTEIEIETIANIARYHRKSTPKKKHDAYSKLPDQY
FT                   RKRIKQLSAMLRVAVALDRRQIGAIKDIHCKYDEEYKKLHLHLIPSNPQDDCALELWNL
FT                   DYKKVVFEDLFDVKIVATVESKG"
FT   gene            602300..603424
FT                   /gene="sigE"
FT                   /locus_tag="cce_0601"
FT   CDS_pept        602300..603424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigE"
FT                   /locus_tag="cce_0601"
FT                   /product="group 2 sigma-70 RNA polymerase sigma factor E"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49952"
FT                   /db_xref="GOA:B1WQ30"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ30"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49952.1"
FT                   /translation="MNTTQMMQTESNNEFNPSQIETVEFEQTEHELQSVEVEISSLSDE
FT                   LGNQYPEGYRKTVSDDTVGAFFKEMSRYPLLNAEEEVELAHHVQFLVQAEETRQQLQEA
FT                   LQHSPSKAEWAKAMGFETQKQFEHRLHRGRTAKRKMIRSNLRLVVSIAKRYLNRGVPFL
FT                   DLIQEGAIGLNRAAEKFDPNKGYKFSTYAYWWIRQAITRTIANDARTIRLPIHVVEKLN
FT                   KLKKAQRVLKQKLQRNPNEKELADELEVSPSQLRQLLQLRRQSLSLNHRVGKGEDTELV
FT                   DLLEDQDLQLPEELMNEGMLRYEVSAVLSDVLTQREKDVISLRYGLCTSQPHTLEEVGG
FT                   IFNLSRERVRQIQSKAMRKLRRPQVARRLKGWLH"
FT   gene            complement(603612..603887)
FT                   /locus_tag="cce_0602"
FT   CDS_pept        complement(603612..603887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0602"
FT                   /product="probable CAB/ELIP/HLIP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49953"
FT                   /db_xref="GOA:B1WQ31"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ31"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49953.1"
FT                   /translation="MQYFVTFCYISKCRHSIKNKFMTSRSYVTEEQGRLNNYAIEPKMY
FT                   VDQKKQFGFNKYAEKLNGRLAMIGFISLLAFESLTGQGLVTWLTNL"
FT   gene            604365..606203
FT                   /gene="ndhF3"
FT                   /locus_tag="cce_0603"
FT   CDS_pept        604365..606203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF3"
FT                   /locus_tag="cce_0603"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49954"
FT                   /db_xref="GOA:A1KYH9"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010217"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYH9"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49954.1"
FT                   /translation="MIEALSQTIWLVPLYALMGGILAIPWSPGIIRETGPRPSGYVNIL
FT                   MTLIALIHSLVTLIETWGKPASYLSFSWLHAADLNITFDIEISTITLSALVLITALNLL
FT                   AQIYAIGYMEMDWGWARFYSLLALFEAGMCTLVLCNSLFFSYVVLEILTLGTYLLIGLW
FT                   FNQSLVVTGARDAFLTKRVGDLILLMGVVALLPLAGTWNYNELAIWAQTATISPTTATL
FT                   LCLALIAGPLAKCAQFPLHLWLDEAMEGPMPATILRNTVVVSTGAWVLIKLQPVLALSG
FT                   IASNFMICVGAVTAIGASLIAIAQIDIKRSLSYSVSAYMGLVFIAVGTQQDTVALKLLL
FT                   TYAIAMSLLVMSVGGVVLNTITQDLTQYGGLWSRRPLSGICFLVGAASLVAFPPLGCFW
FT                   TLTEMADNLWLSYPQLVVVMLLVNGLTAFSLTREFSLIFGGKIKQMTVRSPEGLWALVL
FT                   PMMVTMGFALHVPILLYQWQLLPIWQALNVTVAGSLTLTSLIGAGTAAYLYLNDDISKP
FT                   IQLPSKALQDFFAYDLYTEKFYRTTIVFVVGLVSQVIYWFDRYLVDGVINLVGLATIFG
FT                   GETLKYNASGQTQFYFLSIFLGVILFVGMIFSNFII"
FT   gene            606243..607745
FT                   /gene="ndhD3"
FT                   /locus_tag="cce_0604"
FT   CDS_pept        606243..607745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhD3"
FT                   /locus_tag="cce_0604"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49955"
FT                   /db_xref="GOA:A1KYI0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYI0"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49955.1"
FT                   /translation="MLSFLLWFPILGSIIIGLVPGKLESSRLRQITAILAFIIFGATVW
FT                   LLTQFDLSDPSWQFSEYLPWSDFIGLSYSLGVDGLSLPLIALNSLLTIIAIYSIGENVE
FT                   RPRLYYALTLLINAGITGALAAQNLLLFVIFYELELIPFYLMIAIWGGEKRGYASTKFL
FT                   LYTAVSGLLVLAAFLGIGFLNGASSFDYDIITTEGLALNTKLILLTVLLIGFGIKIPLV
FT                   PLHTWLPDAYTEASPAVTILLGGILAKLGTYGLIRFGLQLFPDAWAIVAPGLAIIGTVS
FT                   VLYGALSAIAQKDIKRMVAYSSIGHMGYILVAAAAGTQLSTLGAVAQMISHGLILALLF
FT                   HLVGIVERKVGTRDLDVLNGLMNPIRGLPLTSALLITAGMASAGIPGLVGFAAEFIVFQ
FT                   GSFATFPIPTLLCIVASGLTAVYFVILLNRTCFGKLDNEKAYYPPVLPSETVPALVLTL
FT                   IILVLGVQPNWLLKWIEPTTDLFVVKVHPIEQVAVNSTTIRP"
FT   gene            607840..609141
FT                   /gene="cupA"
FT                   /locus_tag="cce_0605"
FT   CDS_pept        607840..609141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cupA"
FT                   /locus_tag="cce_0605"
FT                   /product="protein involved in constitutive low affinity CO2
FT                   uptake"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49956"
FT                   /db_xref="InterPro:IPR010220"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYI1"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49956.1"
FT                   /translation="MTQATLNPTAKIPPSTHQFADIIHRLEAGGSMLPDTPENLMQIIG
FT                   IYKAYAVPMDFYWRDLLYIAERVFLEPLPFFKYFLPQDYLDLHNHYAGDDADLRIWRGI
FT                   ASAHPELLEFMEKGKTGKMPKLFHHLNHDRINMEFAEACMRAMLWHGRDMGLGKFDAYL
FT                   DSDEYKANADKAIKAYFKNNPAMLGLYKLFPEMFIEQVRQLSYYSNLGLFWEVMAPVFF
FT                   EMSDIYDEGGFKGVPDAMNFLINGIFAIAGRPIYHHVYIGDECYEIIPKSKGFMWLYEA
FT                   ALPYVEAVFYRTAPFRGTKSYNAQAKQVPADQKDFHYGILYADVFPVGTAGIPPTLLMD
FT                   DMYHFLPDYLKEYYQKHCRGEKDMLIQLGITFQRSMYNVTSAVIQALRTALLYPLDDEN
FT                   PKHLLKNRQFFESQMDRFLRPEARLRDIQSQSYR"
FT   gene            609473..611107
FT                   /gene="pgm"
FT                   /locus_tag="cce_0606"
FT   CDS_pept        609473..611107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="cce_0606"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49957"
FT                   /db_xref="GOA:A1KYI2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYI2"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49957.1"
FT                   /translation="MTIRTVTTTPFDDQKPGTSGLRKAVPTFQKPHYLENFIQSIFDSL
FT                   DGCEGQTLVVGGDGRYYNRQAIQVILKMAAANNIGRILVGCGGIFSTPAASAVIRKYNA
FT                   FGGIILSASHNPGGPNGDFGVKYNVSNGGPAPEKVTNAIYECTKTINEYKILDAADINL
FT                   DRPGSFKLGTMDVEVIDSVTPYVELMQQLFDFDKIKSMVSSDNFRMCMDSLHAVTGPYA
FT                   RALFEQYLGAKEGTVQNGTPLEDFGGGHPDPNLVYAHDLVDIMFGDNAPDFGAASDGDG
FT                   DRNMILGKNFFVTPSDSLAVLTANATLVPGYEGGIAGVARSMPTSAAADRVAAKLGIDC
FT                   YETPTGWKFFGNLLDAGKATLCGEESFGTGSNHIREKDGLWAVLFWLNILAVKGESVEK
FT                   IVRDHWQEYGRNFYSRHDYEEVESGPANELMNRLRSMVGDMKGKTYGNYEVAYSDDFAY
FT                   TDPVDGSVSEKQGIRIGFTDGSRIVFRLSGTGTKGATLRVYLESYEPDGSKHDVDTQEA
FT                   LSSLIELAEEIAQIKKFTGRDKPTVIT"
FT   gene            611421..611696
FT                   /locus_tag="cce_0607"
FT   CDS_pept        611421..611696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0607"
FT                   /product="putative ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49958"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYI4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49958.1"
FT                   /translation="MIDSSVNTIEEFDLSREERVIEIQNLIETLRIADEIANKGYLITS
FT                   SELADLMDINASAVTSRGDHWSWRNWVVSRVRREGNQILWQLEKID"
FT   gene            611928..613565
FT                   /locus_tag="cce_0608"
FT   CDS_pept        611928..613565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0608"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49959"
FT                   /db_xref="GOA:B1WQ37"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ37"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49959.1"
FT                   /translation="MASSYFQTAPIRIFNSNFIPTLVSAGLHGLALFLLVPYVTNLPTS
FT                   ESEETNTGPINVPLIELNPSEQSRLPDQNSGLSSMPEFPNSTLEDLPLLDSPSLESSLP
FT                   NNFNNLPSPPALPPLPPLNPYNDYSRIPVELPPQRSFPSPPQATIRLPSPPPSPSLKDP
FT                   TPKTPPIPDTESSELANPRQNIDFGDPTPAKPNNPLFQGDRPTSQNPLGNMAVNQPPSS
FT                   SNANNNISRQDEIAKNLLEDTLKGADNLTYNPQGTKREEARRRDLEWMQQTGVTLKPSQ
FT                   MMTIKATYPKAACNLKLEGSAIYNVLVNNNGQLSKPPFMTRSSGYGILNNRGLQEVKSR
FT                   SFPQSTRVKVTFQYDPQICGTGVAEGERNSQPQASPSSTPKTPAEPVPAPQMPQNQTPK
FT                   APTEPKTPNPSPQNSESPTPKPPTPQTPQNQTPKAPTEPKTPNPSPENSESPTPKPAAE
FT                   PVSAPQTPQNQTPKAPTEPKTPNPSPENSENSTPKPAAEPVSAPQTPQNQTPKAPTEPK
FT                   SPPDVNKTSNSPSETKLEGAVAPPAGRK"
FT   gene            complement(613652..614335)
FT                   /locus_tag="cce_0609"
FT   CDS_pept        complement(613652..614335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0609"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49960"
FT                   /db_xref="UniProtKB/TrEMBL:A1KYI6"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49960.1"
FT                   /translation="MARRNSSPNVSINRQSNGTSSHREADFDIQQELARLQEIIYESFH
FT                   IPVSRWTIIDEDKVLEQLEFIGTKIPEAIKKALRVLEQEQEILANAEAYAQRIIQQAQQ
FT                   EAEEILDESGIVQRAQHEADQIRQQVQAECEAIQAQTMAEIEQQRQLANGEMQQLYQKS
FT                   LAEAQQIQDGADEYADAVLTRLEQELGEMLGVVRNGRQQLYNHSAQRQTNTPGKQVSGG
FT                   KKKRS"
FT   gene            614616..614798
FT                   /locus_tag="cce_0610"
FT   CDS_pept        614616..614798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0610"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49961"
FT                   /db_xref="GOA:B1WQ39"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ39"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49961.1"
FT                   /translation="MNHQNEYFHLTTIGLSLATLPLLAGLVIMKTMNQDLQAWGEESEE
FT                   IFRGDRLPLLKFPHD"
FT   gene            615609..619331
FT                   /gene="chlH2"
FT                   /locus_tag="cce_0611"
FT   CDS_pept        615609..619331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlH2"
FT                   /locus_tag="cce_0611"
FT                   /product="magnesium chelatase, subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49962"
FT                   /db_xref="GOA:B1WQ40"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="InterPro:IPR022571"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ40"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49962.1"
FT                   /translation="MSRIVVITGFESFNLDLYRQAAQLAQSRCEGLDIQIFSDRSLSQE
FT                   PEIIENPLKDADVFFASLIFDYDQVIWLKERVENIPIRLVFESALELMSLTRLGKFVIG
FT                   EKPKGMPKPIKFILSKFSSGREEDKLAGYLSFLKTGPKLLKFIPAKKVQDLRNWLIIYG
FT                   YWNAGGTENFAAMCWTIAEKYLDIKVGDIPEPIETPNMGLLHPDYDGYFTSPRDYLNWH
FT                   QQEKSLENSLVAILLYRKHVITKQPYIPQLIRFFEQQGLTPVPIFINGVEGHVIVRDWL
FT                   TTTYETQQRNLGNIEIRSLVKDALEVDAIVSTIGFPLVGGPAGSMEAGRQVEVAKRILT
FT                   AKNIPYIVAAPLLIQDIYSWTRQGIGGLQSVVLYSLPELDGAIDTVPLGGLVGNDIYII
FT                   PERVKRLTGRLKKWINLRKTETKDRKIAIILYGFPPGYGATGTAALLNVPRSLLNLLQE
FT                   LEKQGYNIGELPEDGEIIINQVKAADEAIVNPNDDSNSTTTVNVRKLEEWLGYLLTTRI
FT                   EKQWKSLTETGIKTYGDEYQIGGIQLGNVWIGVQPPLGISGDPMRLMFEKDLTPHPQYA
FT                   AFYKWLQHNFCADAIIHFGMHGTVEWLPGSPLGNTGYSWSDILLGDIPNLYIYAANNPS
FT                   ESILAKRRGYGVLISHNVPPYGRAGLYKELMALRELIAEYREDPNKNEILREGIIQKIV
FT                   DSGLAADCKFEEGKKLGIDFTVENAKLFSKNALNEYFFKVYEYLQIVEQRLFSSGLHTL
FT                   GETPKQEQLDSYLEAYFGEKLTDRERKAITSESPELQYILESANGKSETIQEAIYIRDL
FT                   LKQTSEELTNLLRGLNGEYIPPAPGGDLLRDGTGVLPTGRNIHALDPYRMPSPAAYERG
FT                   REIAKKTIQQHLDEQGNYPETIAVLLWGLDAIKTKGESLGILLELVGAEPIKEGTGRIV
FT                   RYELKPLEQLEHPRIDILANLSGIFRDTFVNIIELLDDLFQRAAEAEEDPKKNFIRKHY
FT                   LQLKEQGIENASARLFSNPAGDFGSLVNDQVVDGNWESGDELANTWEKRNSFSYGRKDK
FT                   GQARPEILNQLLKTSERIVQEIDSVEYGLTDIQEYYGNTGGLKLAAEKQSGKKVTASFV
FT                   ESFSNDTNPRKLEDLLRLEYRTKLLNPKWAEAMVNQGSGGAYEVSQRMTALIGWGGTTD
FT                   FKDNWVYDQAAQTYALDPEMAEKLRKANPEAFRNIVGRMIEANGRGFWDADEETLEKLR
FT                   SLYDLTEEELEGVTN"
FT   gene            complement(619374..619811)
FT                   /locus_tag="cce_0612"
FT   CDS_pept        complement(619374..619811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49963"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ41"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49963.1"
FT                   /translation="MKLIFADSSILIAGSASSTGASRVVLTMAEIGLFKLLISEQVLEE
FT                   CQRNINKKLPKAIPVFNEIIDNTNLEILPNPSLEEFLAYIDIIEPKDAPILAAALLVKA
FT                   DRLLSLNTKDFTQEVAQKTGIIIQTPSQFVQDIRSIITQEL"
FT   gene            complement(619811..620077)
FT                   /locus_tag="cce_0613"
FT   CDS_pept        complement(619811..620077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0613"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49964"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ42"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49964.1"
FT                   /translation="MKSFTVRLHQDGTIMVPKVIQDALNLRKGDYLNFLEIEGLIILTS
FT                   KNPKVPQLIEKITTIREEEDVTLEELLEGLEHERKMIYQEKYE"
FT   gene            complement(620129..620407)
FT                   /locus_tag="cce_0614"
FT   CDS_pept        complement(620129..620407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49965"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ43"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49965.1"
FT                   /translation="MLRSSSENITKCFRVRFKTLELDIESEGRISEAFSALEEHIDERF
FT                   DQVDKRIDRVDGRLDHMEHQFNRLQGKLEVILDAITGINDLSEDETE"
FT   gene            620395..620514
FT                   /locus_tag="cce_0615"
FT   CDS_pept        620395..620514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49966"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ44"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49966.1"
FT                   /translation="MIEANGRGFWNADEETLEKLRNLYELTDGELEGVSNVVN"
FT   gene            620603..621355
FT                   /locus_tag="cce_0616"
FT   CDS_pept        620603..621355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0616"
FT                   /product="unknown"
FT                   /note="contains a methyltransferase type 12 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49967"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ45"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49967.1"
FT                   /translation="MLPKLSTGDFNVAYEKVVLNNDFFEKDNYYIQQKPRYFNSLKQVI
FT                   TIPLSNSSKVLEIGGGQIVLLLNEMYGIQGAVADVNEKYQNSLAQFGINFRSCDLLHDD
FT                   LPERDTYDLVVLCEVIEHMPVPPYIILEKIKQWIKPGGWIFLTTPNLYRLRNLVRLALG
FT                   MRVFDTFFIPEKGQGIGHPIEYSKEQFQWQLEKAGFHSVQIDLQQLDNSGASLGTQIGR
FT                   MLLSPLLLRPLWRDKLVAIAQKPLLKTV"
FT   gene            621387..622655
FT                   /locus_tag="cce_0617"
FT   CDS_pept        621387..622655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0617"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49968"
FT                   /db_xref="GOA:B1WQ46"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ46"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49968.1"
FT                   /translation="MNNKRKKALLIIEQCNPDWSSVPLVGYNFYYEISQLCDVTLVTHI
FT                   RNKAALQKHQEHQDIIYIDESQFSKNYHKFIAALTSIGRKNWPLYIALSYPIYEEFNKQ
FT                   VYQKFKDKVLGKEYDIVHVITPMMPRYPAKIIRACVNTPFILGPVNGGVPFPPGFQKVA
FT                   RQEFAYFNFLRAIGRKLIPGYVETYQKADKILAGSTYTLNLIKDLFKIPKERLELFYEN
FT                   GISKNFFHQKKTNTNNSVINLLFVGRLVPYKGADMLIDAIHNLSDDLRNKIKLTIVGDG
FT                   SEKVKLENQVKNLGLEKVVSFTGWIKQEETVEYYKQADIFCFPSIREFGGAVVLEAMAC
FT                   GLPCIVANNGGIGEYVTPETGFSIEPKSREYLVKELTAKIQTLVENKDLREKMSAKCYQ
FT                   RAREFEWSKKAKKIVELYQQLLK"
FT   gene            622699..623298
FT                   /locus_tag="cce_0618"
FT   CDS_pept        622699..623298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0618"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49969"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ47"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49969.1"
FT                   /translation="MITTLSTENLPLVLQLSPAIAITDEQFFALCQLNRDYCLERNAKG
FT                   ELLIMSPTDLETGNRNAKLTQQLANWTDEDVSGIGFDSSTGFKLPNGANRSPDAAWMTL
FT                   EKWNSLTEDQKIRFAPVCPDFVVEIRSPSDQLQSLQDKLQEYIDNGVKLGWLIDRKNRL
FT                   VYIYRPQTEVECLENPDTVNGDPILSGFQLQMDKIW"
FT   gene            623314..624390
FT                   /gene="rfbB1"
FT                   /locus_tag="cce_0619"
FT   CDS_pept        623314..624390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB1"
FT                   /locus_tag="cce_0619"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49970"
FT                   /db_xref="GOA:B1WQ48"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ48"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49970.1"
FT                   /translation="MSLSKEQKSILITGGAGFIGSNFVHHWSNHYPDDNVIVLDALTYA
FT                   GNRQNLVDLEDRQNFKFIQGDICDRPLIDKLLKEENITTLAHFAAESHVDRSILGPDAF
FT                   IQTNVIGTFTLLESFRHYWNEQGKPEDYRFLHVSTDEVYGSLEADDPAFSETTPYAPNS
FT                   PYSASKAGSDHLARAYFHTYNVPTIITNCSNNYGPYHFPEKLIPLMCINILLGKPLPVY
FT                   GDGQNIRDWLYVGDHCSALETVINKGKPGETYNIGGNNEVKNIDLVTLLCNLMDELAPD
FT                   LPVKPAKELITFVKDRPGHDRRYAIDATKIKTELGWTPQETVENGLRKTIEWYLNNQDW
FT                   WQHLLSKEYQDYYQKVYG"
FT   gene            624442..624837
FT                   /locus_tag="cce_0620"
FT   CDS_pept        624442..624837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0620"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF29"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49971"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ49"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49971.1"
FT                   /translation="MKLILCNGLDEQANLLLKGKYEQLDVINLVEEIQALGRSEVRETF
FT                   NLLKQIIAHKLKLEYSQLIYPRKHWQDEIDEFYEQLGLFLTKTVRNKLDLYKIYQAAKK
FT                   KVLKQYDVNLLNKCPYSWDDLLAELDD"
FT   gene            624925..625314
FT                   /locus_tag="cce_0621"
FT   CDS_pept        624925..625314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0621"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49972"
FT                   /db_xref="GOA:B1WQ50"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ50"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49972.1"
FT                   /translation="MYIMNEPSRVTYSLEEMFSRLEQKIDKLENKLDTKIDTLENKLDT
FT                   KIDTLENKLENNQKEVNQKLDKQSEEIATIKATLQAQQQLIQKIPDLAEKVGELKNWRQ
FT                   IVIIALTATISASITWLIRGGNLKP"
FT   gene            complement(625335..625877)
FT                   /locus_tag="cce_0622"
FT   CDS_pept        complement(625335..625877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49973"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ51"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49973.1"
FT                   /translation="MFKTILGIISSTIFLSSPLLALNTGNNLTLFNKSPRLLDAVTTLS
FT                   RIRVEGATYYFTVHLPTDVGESLQQLTIQQTQGLETIYFYLDDTIAFEGRPVNRDGHLN
FT                   IARVKRNLDNNTIAVIFDPPIPPGKTFTIAMKPKSNPEMSGDYQFAITAYPAGENAQGL
FT                   YLGLGRFNFNQKGDRFP"
FT   gene            complement(626020..628167)
FT                   /gene="pnp"
FT                   /locus_tag="cce_0623"
FT   CDS_pept        complement(626020..628167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="cce_0623"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49974"
FT                   /db_xref="GOA:B1WQ52"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1WQ52"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49974.1"
FT                   /translation="MQEFDKSISFDGRDIRLKLGLLAPQAGGAVLIQSGDTAVLVTATT
FT                   TKGREGIDFLPLTVDYEERLYAAGRIPGGFLRREGRPPERAILISRLIDRPLRPLFPNW
FT                   WRNDIQIIATTLSMDEEVPPDVLAVTGSSIAVIQAQIPFYGPMAAVRVGLIGDDFIINP
FT                   TYREVENGDLDLVVAGSPDGVVMVEAGANQLPEQDIIEAIDFGYEAVRDLIGAQYEIME
FT                   ELGMEIAKAEPPSVDEALEKFISDRAADSIKKVLVQYDLGKAERDSALDNIKETAIEEA
FT                   IAELPEDDPIKVTTSEDPKAVGNLYKGLTKKLMRSQIVDEGIRVDGRKLDEVRPISCRV
FT                   GLLPPRVHGSALFTRGLTQVFSLATLGTPGDAQDLGDDLHPEDEKRYLHHYNFPPFSVG
FT                   ETKPLRSPGRREIGHGALAERAILPVLPPQDEFPYVVRVVSEVVSSNGSTSMGSVCGST
FT                   LALMDAGVPIIKPVSGAAMGLIREGKEVRILTDIQGIEDFLGDMDFKVAGTDTGITALQ
FT                   MDMKITGLSMDVVAKAIEQALPARLHILDKMLAVIDQPRPELSPFAPRLLTMKIDPEQI
FT                   GLVIGPGGKTIKSITEQTGSKIDIADDGTVTIAAIQAKKAERARDLIFNMTRKLNEGEV
FT                   YLGRVTRIIPIGAFVEVLPGKEGMIHISQLAERRVGKVEEEVAVGDEVVVKVREIDNKG
FT                   RLNLTRLGIHPDEAAAVRKTF"
FT   gene            628303..629712
FT                   /locus_tag="cce_0624"
FT   CDS_pept        628303..629712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0624"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49975"
FT                   /db_xref="GOA:B1WQ53"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ53"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49975.1"
FT                   /translation="MRQVSCVEPTQQEFKTVMDRNALKNQANVVIIGGGFGGLYTAQDL
FT                   KNASVQVTLIDKRNFHLFQPLLYQVATGVLSPADISSPLRLVLRQHKNTKVLLDHAIDL
FT                   DPEKKEVILDHHEPIPYDMLVLATGVSHHYFGNDQWEPLAPGLKTIEDAIEIRRRIFMA
FT                   FEAAEKETDPVKRQAWLTFVIVGGGPTGVEMAGAIAEIAHGALAGDFRSIDPKEAKILL
FT                   IEGLDRILPPYPPELSAKAAEDLCHLGVTVQTQSMVTDINDHVVTVRQGEQIKQITSRT
FT                   ILWAAGVKASRMGKVLAERTGVELDRAGRVVVEPDLSIPGYSDIFVIGDLANFPHQGER
FT                   PLPGVAPVAMQQGAYVAKLIQKRLQGESLPPFVYDDYGNMAVIGQNKAVVNLGFAKLSG
FT                   FLAWFIWVWAHIYYLIEFDNKLVVMIQWGWNYFTRGRGARLITGVGEGKRKDQPKEIAQ
FT                   EITKTVTPITR"
FT   gene            629933..630634
FT                   /locus_tag="cce_0625"
FT   CDS_pept        629933..630634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0625"
FT                   /product="unknown"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49976"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ54"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49976.1"
FT                   /translation="MSLTAEQLAALMPDATQVESDEPEMESSLHYFQLALLVSCLEWLW
FT                   REQNDFFIGANLTIYFNRQQLKNKDFRGPDFFLVKQTEKRPRKSWVTWEEGGKYPDLII
FT                   ELLSESTENVDKTIKKDLYQNRFRTPDYFWFSPDTLEFSGFRLVQGKYEEIDPNEFGWL
FT                   WSESLGLYLGIYEQQLRYFTLEGQLVPTPEEDAQQQRKQVEQVQQQANQQQRRAEQLAA
FT                   QLRALGIEPEA"
FT   gene            630696..631226
FT                   /locus_tag="cce_0626"
FT   CDS_pept        630696..631226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0626"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49977"
FT                   /db_xref="GOA:B1WQ55"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ55"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49977.1"
FT                   /translation="MIKILTPRLKLREWKEEDKEPFFKLNSDPRVMEFMPKLLSKEESD
FT                   NFVERIKTHFQTYQYGLFAVELIENQNFIGFIGLSIPKFDAFFTPCVEIGWRLAYDYWG
FT                   KGYASEGAKASLNYGFQELSLSEIVSFTFHDNVRSRQVMERIGMKYMGEFNHPALPKGH
FT                   PLEKHVLYKIMNK"
FT   gene            complement(631232..633982)
FT                   /locus_tag="cce_0627"
FT   CDS_pept        complement(631232..633982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0627"
FT                   /product="unknown"
FT                   /note="contains a TPR-like helical domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49978"
FT                   /db_xref="GOA:B1WQ56"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ56"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49978.1"
FT                   /translation="MILNLTQPRSTNISKMLFIIGSVVRFLLLLFLSLSLTFSWSILPG
FT                   NRVLGTAPVLIQEQQGREWYQQGDIDQAIATWLNILQDYRQQGDILSQGRVLSYLALAY
FT                   SQLGQWEQADHSIHSSLALLNSQSQDNKTLPILAEALNIQGTLLLAKGDPLAALYSWEK
FT                   STETYKKIKDNTGILRTNINQARSLQSLGLYTKACQKLANNLLGNMLKCYELNLDNISS
FT                   SLSQDLTSLEQAGWLTLAQILRQQGNLESSQGILNKILSQVSSSEVKASIFFNLGQNLE
FT                   LQNDIQGAKENYQQAIIIANNLEIKIKNKLAQLNLLINQQAWIEIQKLLIDIENDLLQF
FT                   PINQTKVDSQIYLANLLLKWSNIADSSDLLPPWKKIKNLLEKAQKEAESLNYDKGIIYA
FT                   LGDRGKLYEKLALTKTCQLDHITVSDVFDCSKTYKFTDINKINLNNQQLNEKAKQITEQ
FT                   ALIKSQSRQSSSITYILQWQLGRILYGLGFEKEAISAYLGAVTTLETLRDDLANNREYK
FT                   FSFQEKVEPIYRQLLSLLLPRNNQEIVSQETLEEARQQVEALQAAQLNDFFNDICVESE
FT                   PVDVAEIDDTAAIVYPIILSDRLAVLVSLPDQSLRVHITEISQEELEKQVKQFRYNIVI
FT                   RSQRAFFDDGKILYQWLVQPFVNQLQKNKIKTLVFVPDGIFRNAPMGALYDGKKYLIEN
FT                   YRVALSPGLSLLSPKPLQNQGLNTLFGGLTETFQQEGLVPLFYVKQELRAIQQQVPTTA
FT                   LLNEEFTLDNLQNILENQSFPIVHFATHGQFSSQFEQTYIVAWDSYINVLELEQLLKEN
FT                   DPRGNKPIELLILSACETASGDSRAALGLAGFAVRAGGRSTLATLWSVNDQATAVIMAQ
FT                   VYEQLSTNKLSKAEALRQAQLAMLKNRWYKHPFYWSAYTLVGNWL"
FT   gene            634133..634678
FT                   /gene="ilvN"
FT                   /locus_tag="cce_0628"
FT   CDS_pept        634133..634678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="cce_0628"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49979"
FT                   /db_xref="GOA:B1WQ57"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ57"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49979.1"
FT                   /translation="MILNTSKTMKHTLSVLVEDEAGVLTRIAGLFARRGFNIESLAVGP
FT                   AEQPGISRITMVVPGDDSTIEQLTKQLYKLINVLKVNDITQTPCVERELMLVKVSVTAT
FT                   NRAEVLEVAQVFRARIVDISDDTVTVEVVGDPGKMVAIVQMLNKFGIREVARTGKIALT
FT                   RESRVNTEYLKSLEAKIQ"
FT   gene            634936..635181
FT                   /locus_tag="cce_0629"
FT   CDS_pept        634936..635181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0629"
FT                   /product="putative CP12"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49980"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="InterPro:IPR039314"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ58"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49980.1"
FT                   /translation="MFKRLAIMSNIDDQIQQERENAKNVCSTEGSDSGNCAAAWDAVEE
FT                   LQAEASHQRQKQTPKTNFEQYCDDNPDAVECRVYDD"
FT   gene            635582..636667
FT                   /locus_tag="cce_0630"
FT   CDS_pept        635582..636667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0630"
FT                   /product="putative peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49981"
FT                   /db_xref="GOA:B1WQ59"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ59"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49981.1"
FT                   /translation="MSVLAAIAVLIILIVVHELGHFSAARLQGIHVTRFSIGFGPVLAK
FT                   YKGKETEYTLCAIPLGGFVGFPDDDPESNIAPDDPDLLRNRPIFDRAIVISAGVIANLI
FT                   FAYFLLVGQTATIGVQELQPGLSIPQVDENSAAMVAGIESGDVILSVDNQSLGDFPDAT
FT                   TLFIEKVKNSAGQPLDLKVEREDKIVDLTVIPEANEEGEGKIGVALLPNVQLNRSQNLL
FT                   EAFSYSAEAYQNVTMLTLQGFWQLISNFQENAKQVAGPVKIVEYGASIAENNLGNLFQF
FT                   GALISINLAIINTLPLPALDGGQLVFLLIEGLLGKPLPLKLQEGIMQTGLVLLLSLGIF
FT                   IIIRDTVNLAVVQDLIQQIGL"
FT   gene            636770..637339
FT                   /locus_tag="cce_0631"
FT   CDS_pept        636770..637339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0631"
FT                   /product="unknown"
FT                   /note="contains DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49982"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ60"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49982.1"
FT                   /translation="MQVTIPKNLSIEDYLKQEEKADFKSEYINGNIIPMAGGTVNHNQI
FT                   AVNITTELNYAFKKRDYRVYMGDVRLWIPEKNIFTYPDIMVIKGDPIYYENRKDTILNP
FT                   SLIIEVLSPSTKNYDKEGKFSAYRTIQGFSEYILVSQTKTYGGKFTKTDAKTWLFQEFY
FT                   EEDQTITIQLENISLQFDDIYHKVDF"
FT   gene            complement(637413..638363)
FT                   /locus_tag="cce_0632"
FT   CDS_pept        complement(637413..638363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0632"
FT                   /product="unknown"
FT                   /note="contains a methyltransferase type 11 domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49983"
FT                   /db_xref="GOA:B1WQ61"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ61"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49983.1"
FT                   /translation="MADKVKPDWTGDDFLSRFVNVMIKTKPIYRLMTHQARQVIIKTAE
FT                   KNGISWEGNCQTLEKSPAKSLLRQMTNPDVVYPDYYLVPFHAYEEGNLCWKASFEAIPA
FT                   TQSLGLRVWKNEDLTWQEAQKRLRSSFHAVLEPYSPPQVKDILDIGCSVGISTKELHRY
FT                   YSQRQNTPINTIGLDLSPYMLAVAKVTDEQQEISQWIHGLAEKTNFADNSFDIITIQFV
FT                   LHELPRHAAIAIFKEVLRLLRPGGVLGIVDNNPRSEVIQNLPPVLFTLMKSTEPHSDDY
FT                   YTFNVENALKELGFDYQTTVPSDHRHRTIVATKPL"
FT   gene            638574..639005
FT                   /locus_tag="cce_0633"
FT   CDS_pept        638574..639005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0633"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49984"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ62"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49984.1"
FT                   /translation="MEELFELKKMLLAGNIDDALLLVEELTEMSKDDKLNKIFSFSIIL
FT                   LLHLIKKRAEKRSTRSWETSIANSVRQIQRTNKRRKAKGNYLTSTELIETLEDAYASAL
FT                   RQAALEAFEGKYEAEELNEIVDKTAIIDEAIELIGFYRT"
FT   gene            complement(639015..640241)
FT                   /locus_tag="cce_0634"
FT   CDS_pept        complement(639015..640241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0634"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49985"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ63"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49985.1"
FT                   /translation="MPSNSQLNLMTNILQLEGFTVMDYQLIKGMGIVLSLEKVDKKTTC
FT                   IYCGSVTRKLHQNNELTIRDLSWGEQDVYLKINRRQMRCEKCQKKFTEELKDIKKKRTY
FT                   TERLKKKIVAEVLNGDIKNVAQRNGVSEQEIETMLKDIGQELGKKKPQKLRRLGIDEIA
FT                   VVKGQGKYYVVLVDLDKGVIIGLIEKRTEEEVSKYLEAWGEEVLRQIVEVSIDFWQPYK
FT                   KVAKKLMPQAEIVADRFHVMKQVTDELDAQRKKSKREAIALKDSPEKKQLLSGLNKSKY
FT                   ALLKNEEDLSDQQKEKLEEIYKTVPILSKMHLLKEKFRKVFDENIDWISGLFELADWCA
FT                   EAHTVYPKSFGTIRRWMGEIIAYFDERTNSGVVEGINNKLKLIKRRGYGFRNFDNFKLR
FT                   SFLTWHFSG"
FT   gene            complement(640370..642442)
FT                   /locus_tag="cce_0635"
FT   CDS_pept        complement(640370..642442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49986"
FT                   /db_xref="GOA:B1WQ64"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="InterPro:IPR039904"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ64"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49986.1"
FT                   /translation="MLFMTNQNISIQIHSDVEKFLRDCNDKILQKRIWECIEKIDRRQF
FT                   DGGLRAKKLNGIGQNIWEARINRGSRLVYTYGRQYMIVQDICLDHDDVVRQARRARTKN
FT                   DDIALLDRTDIEKIIGDLEQNYCSLDEEEKYNIEIAIEEDLNLPDDFLSSLDNTNYKVL
FT                   ETREQWEKAIIENSADLPYLLTLQEKELVEKTETLLISGSAGTGKTTIGLYRLLNWAKQ
FT                   RLNDEKEGKALYIAYNPVLVQEVKKQFERLIRLDEFKIDSQEIFDIIQFQTIEELCENR
FT                   INNSNSEFLNDREKLNYNKFEKKYEEKTYHKKGYPAYFIWEEIRGVIKGSHLETESPLL
FT                   SLEDYKNKGKNRSHVISCEERPEIHNLACWYQKTLSQEKDKKKTKKKDKKKRPIEYYDE
FT                   IDLTREALKIIRDNKFKQYNLVICDEVQDFAEIQIRLLVEMSKKDSQLIFAGDLNQMIS
FT                   PSGFRWEDLTVNLYNLDFECEKLNNLTLNFRNIKSLANLSHQLLKLRDRFLDERDTLAT
FT                   IEGRNSGELTGLIKHPFSKISNILQEIKAGEGIIVKTEEQKKELQAAFNSKRIFTVEEA
FT                   KGLEFDTVFLIDFFVEKQNLWDKKLNPKRQLKETEIPELALEFNLLYVAITRARRLLYI
FT                   CETSLSEVWQQPELSNFVKESDFAQVNLNRKNSTPEEWKEQGIVVLPNLSCKLKK"
FT   gene            complement(642580..643650)
FT                   /gene="psbA5"
FT                   /locus_tag="cce_0636"
FT   CDS_pept        complement(642580..643650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbA5"
FT                   /locus_tag="cce_0636"
FT                   /product="photosystem II D1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49987"
FT                   /db_xref="GOA:P51759"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005867"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51759"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49987.1"
FT                   /translation="MTTTLQQRESVSLWEQFCQWVTSTNNRIYVGWFGTLMIPTLLTAT
FT                   TCFIIAFIAAPPVDIDGIREPVAGSLLYGNNIVSGAVVPSSNAIGLHFYPIWEAASLDE
FT                   WLYNGGPYQLVIFHFLIGIFCYMGRQWELSYRLGMRPWICVAYSAPVSAATAVFLIYPI
FT                   GQGSFSDGMPLGISGTFNFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSS
FT                   LVRETTEIESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRALHFFLGAWPVI
FT                   GIWFTAMGVSTMAFNLNGFNFNQSILDSQGRVIGTWADVLNRAGIGMEVMHERNAHNFP
FT                   LDLASAEPVSAPVING"
FT   gene            complement(643860..644042)
FT                   /locus_tag="cce_0637"
FT   CDS_pept        complement(643860..644042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0637"
FT                   /product="putative MgtC family transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49988"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ66"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49988.1"
FT                   /translation="MQLRSLLSESLQDTPDRHSIKAQLITQKRDDAFLEQIVSRLSLES
FT                   GVVSASWQIIEQESP"
FT   gene            complement(644157..645980)
FT                   /locus_tag="cce_0638"
FT   CDS_pept        complement(644157..645980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0638"
FT                   /product="putative reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49989"
FT                   /db_xref="GOA:B1WQ67"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ67"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49989.1"
FT                   /translation="MNTESPMYKWNKIPWRKLERETFKLQKRIYRASSRGDVKTVRRLQ
FT                   KLLTKSWAAKCLAVRRVTQDNQGKKTAGVDGVKSLTPKQRLLLVNKLKLGTKVKPTRRV
FT                   WIPKPGRDEKRPLGIPTMKDRALQGLVKMALEPEWEAKFEPNSYGFRPGRSCHDAIGAI
FT                   FSAIRLKPKYVLDADIAKCFDKIDHERLLEKINTYPTLRKQIRAWLKADVMDGKKLFPT
FT                   SEGTPQGGVISPLLANIALHGMESRIKEMAKDIDWRNEKGHLISISARRKSISLIRYAD
FT                   DFVIIHENLTIVQRCREIISEWLIGMGLEIKPSKTRLIHTLQEYEGEKPGFNFLGFNIR
FT                   QFKSGKHTSGKNTNGKVLGFSTIITPSKESQKIHYAKIKEVIDRHKAQPQAILIKNLNP
FT                   IIKGWCNYFSIGCPSKVFHRMDYRIYWKLRRWAKRRHPNKGEYWIKKYWQTIGNKNWVF
FT                   ATRSDNNPYTLAEYGSFKSQKYAKVKGETSPYDGNLVYWSTRMGKHPEMPKRTASMLKK
FT                   QKGKCTHCGLFFKDGDIIELDHIIPKSKGGKDEYKNWQLLHRHCHDKKTRTDGSLKRSG
FT                   NKTDCNSVIPKQLSNIPSNYRWINDMLVTTY"
FT   gene            complement(646574..647041)
FT                   /locus_tag="cce_0639"
FT   CDS_pept        complement(646574..647041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49990"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNL4"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49990.1"
FT                   /translation="MPKAEDIIDVVIGKPGPTSDINICRQTLNKFKINQTFSADKAYIG
FT                   ETQIITPHKKTKKRELTEAQIKENKALSSNRIFVEHLIRVVKVFKVVQERFRLHKSRYK
FT                   SVLLTVCGLVRLRISSLILKIIESSQSGEVIDVIMSHSFMSKLELIPSTPY"
FT   gene            complement(647079..647618)
FT                   /locus_tag="cce_0640"
FT   CDS_pept        complement(647079..647618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49991"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="UniProtKB/TrEMBL:B1WNL3"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49991.1"
FT                   /translation="METYTWSYLKKYPKQTKRLLGIDDNQLEQLIALGKLLHQKKKEEN
FT                   EKTKIRINQPGAGSPSLLAEEEQIVLTLVYLRHNISFQLLGLLFQVSESTAHNIFTYWQ
FT                   TLFEGELPPSLLEQIKKFQEEKEIVLEMLTDYELIVDSAEQAIERPSDYQEQKKYYCGA
FT                   TPAIRNRLGNAHQETG"
FT   gene            647937..648545
FT                   /gene="clpP1"
FT                   /locus_tag="cce_0641"
FT   CDS_pept        647937..648545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP1"
FT                   /locus_tag="cce_0641"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49992"
FT                   /db_xref="GOA:B1WQ70"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ70"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49992.1"
FT                   /translation="MIPTVIETSGRGERAFDIYSRLLRERIVFLGQEVRDENSNLIVAQ
FT                   LLFLEAEDPDKDIYLYINSPGGSVSAGLGIFDTMNQIRPDVCTICIGLAASMGAFLLSA
FT                   GAKGKRMSLPNSRIMIHQPLGGAQGQATDIEIQAKEILYLKGLLNNHLANHTGQPLDKI
FT                   AEDTERDFFMSAEEAQEYGLIDQVINRRPSATNPPVTAG"
FT   gene            complement(648617..649729)
FT                   /locus_tag="cce_0642"
FT   CDS_pept        complement(648617..649729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0642"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF21 and CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49993"
FT                   /db_xref="GOA:B1WQ71"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ71"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49993.1"
FT                   /translation="MLSLNASFLTIAKPSPLLGQVWLDLTVIVLMLLLSAFFSGSETAI
FT                   TAFDNFKLRGLIDKQGDPSGVYRLVLENRRRFITSLLIGNNLVNNFSAILTSNLFAMWL
FT                   GSAGLGIATAVVTIIVLIFGEITPKSLAILNTRAFFRWCIRPIFLLSQLLSFLRIVQIF
FT                   EKITQKTIQVFQGKSEKIVQSGESLNDLQLMIEILGGKGKLDLYKHQLLNKALRLDELM
FT                   AKDVVKPRLEMTTISHESSLQELINLSLETGYSRIPVQGESKDHIVGIVHLKKALQTLQ
FT                   SVPKERRSQVKVTEAIDDPIYIPETKRAPSLLKEMLQQRFHIAIVVDEYGGTVGLVTLE
FT                   DILEELVGEIYDESDSPHSRQNLFIGDGFA"
FT   gene            complement(649764..649904)
FT                   /locus_tag="cce_0643"
FT   CDS_pept        complement(649764..649904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49994"
FT                   /db_xref="GOA:B1WQ72"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ72"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49994.1"
FT                   /translation="MSDLNRGIMKFEGADKPVLVAISAFLVLGAIIGLIIWALKAAYTV
FT                   G"
FT   gene            650339..651325
FT                   /gene="sigB"
FT                   /locus_tag="cce_0644"
FT   CDS_pept        650339..651325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="cce_0644"
FT                   /product="group 2 sigma-70 RNA polymerase sigma factor B"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49995"
FT                   /db_xref="GOA:B1WQ73"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR017848"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ73"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49995.1"
FT                   /translation="MPTANVNTKTKQPTYSADMVRTYLHEIGRVPLLTHEQEIIYGKQV
FT                   QKMMSLLETKEELAQSLGKEPSLQEWAKEVNLEEKALTKALEQGERAKRKMIEANLRLV
FT                   VAIAKKYQKRNMEFLDLIQEGSLGLERGVEKFDPTKGYKFSTYAYWWIRQAITRAIAQQ
FT                   ARTIRLPIHITEKLNKIKKTQRELSQTLGRSATPAEIAQELEIEPSQIREFLSIARQPI
FT                   SLDVRVGDNQDTELSELLEDQGVSPDIYITQELLRQDLSNLMAELTPQQRTVLTLRFGL
FT                   EDGKELSLAKIGKRLNISRERVRQLEHQALAQLRRRRGNVKEYLAAS"
FT   gene            complement(651380..652054)
FT                   /gene="devA"
FT                   /locus_tag="cce_0645"
FT   CDS_pept        complement(651380..652054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devA"
FT                   /locus_tag="cce_0645"
FT                   /product="ABC transporter ATP-binding protein, probable
FT                   glycolipid exporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49996"
FT                   /db_xref="GOA:B1WQ74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014324"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ74"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49996.1"
FT                   /translation="MKPVISIKNLNHFFGKDKLKKQVLFNINLEINPGEIIIMTGPSGS
FT                   GKTTLLSLIGALRSVQYGSLRTIDYELNGATEHRLVQVRRFMGYIFQAHNLLPFLTARQ
FT                   NVQMSLELHDNINAHEAIAKSETMLKMVGLGERINYYPDQLSGGQRQRVAIARALVSHP
FT                   KLVLADEPTAALDSKTGRDVVDIMETLTKEQGCTILLVTHDNRILDMADRIIHMEDGYL
FT                   KN"
FT   gene            complement(652051..653514)
FT                   /gene="devB"
FT                   /locus_tag="cce_0646"
FT   CDS_pept        complement(652051..653514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devB"
FT                   /locus_tag="cce_0646"
FT                   /product="ABC transporter membrane fusion protein, probable
FT                   glycolipid exporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49997"
FT                   /db_xref="GOA:B1WQ75"
FT                   /db_xref="InterPro:IPR014315"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ75"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49997.1"
FT                   /translation="MDFHRLNYTSEGIFGNANKGKDNLHPYRSQVNTMTQSDFPQPSSL
FT                   EGEITHGIPSHQGHQKQPWRSRLLFLTAVGLLSLGVTAVYSSIFIARQSTSSTPQSQQQ
FT                   PSLPTRIAALGYLEPQGEIIEVSAPAFLEGARVMDLQVKRGDRIQAGQIIAILDNHHRL
FT                   KASLEQAKTQVAVAQANLAKVQAGAKQGDIQAQNARFMGTKAELEGQIAMQRSTISNLE
FT                   SQLLGERSAQQASIERLKAELANKTTECQRYATLYDSGAVSAQERDRVCLEQEITEQQL
FT                   REAQANLQRIVNTLQDQIRAAKANLSRTIATLDTQIAENQARLNAVAEVRPVDLQVAQS
FT                   ELLAAEAAVKQAEANLDLSYVKAPRDGQILEVHTWPGEIVQNQGIVALGETAQMYVTAE
FT                   VYESDITRVQKGQPVTITTDGITEELQGTVEEVGLQVDRQRVLGTNPTADVDARVVEVK
FT                   VRLNPEDSQRVAHLTHLQVNVIIDTMKPQ"
FT   gene            653503..653685
FT                   /locus_tag="cce_0647"
FT   CDS_pept        653503..653685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49998"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ76"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49998.1"
FT                   /translation="MKVHPLKPAQDTQINSSGKMLKSCQDNLAMAYETEILFSLVATEA
FT                   GETALNCSHIWGSFF"
FT   gene            653693..654760
FT                   /gene="devC"
FT                   /locus_tag="cce_0648"
FT   CDS_pept        653693..654760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devC"
FT                   /locus_tag="cce_0648"
FT                   /product="ABC transporter permease protein, probable
FT                   glycolipid exporter"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACB49999"
FT                   /db_xref="GOA:B1WQ77"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR005891"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ77"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB49999.1"
FT                   /translation="MFMQLGFEGALYESNTRLHSSLDADLVMLNRRSKSLAYSYVFSRR
FT                   RLYQALAFEQVEGVSEFYVEYGIWKNDQTNEYRPIFVFGFDPDKPTFTLPEVNQHLEDL
FT                   KKPDRILFDRQAKPDYGPIAANYLKNKTSINELNDRQVETVGLFTLGPSFAADGNIITS
FT                   DTNFQQVFKLFRHHRIGFINLGLIRLKPGVNPQMVKNNLKAYLPQDVTILTKQEFINFE
FT                   KTYWRTTTPIGFMFRLGTTVGFIVGIVIVYQIIQTDVNDHLPQYATLKAIGYTNNYLLG
FT                   VVFHETIMLALLGYVPGVGISFALYQLSKAATLLPMRLTVTRMITVFFLTVVMCCVSGA
FT                   IAIRKLKDADPADIF"
FT   gene            654930..655808
FT                   /locus_tag="cce_0649"
FT   CDS_pept        654930..655808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACB50000"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ78"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB50000.1"
FT                   /translation="MNNKILSLLGVAVATTGMTVGATSTQASTLGPGTVSVQLDQGVFF
FT                   SNNIADFILDGTSVPNPGVAGDGSVSTPANPLDPDAEIYGIVPGNAATYPAFDNIGEIL
FT                   GKLAGRSFVGAPIKFNDIIFVQDPTDPDSPGIFVNNGQTYDLTGGGAIDGFTFAEFDTD
FT                   GDTGFGDSAGDFSYIATSFTRVVEPGATGGFNIIFDLEGFFRDGSGNFKDTPSNFALFN
FT                   GAAGVNPQTLPVLTLNEFVAGVGTPDVRFIASADGVINTSGREAPEPGTIIGLTAVAGL
FT                   GLAGRLKRKAK"
FT   gene            complement(655964..656260)
FT                   /locus_tag="cce_0650"
FT   CDS_pept        complement(655964..656260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0650"
FT                   /product="UPF YGGT-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACB50001"
FT                   /db_xref="GOA:B1WQ79"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ79"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB50001.1"
FT                   /translation="MMDLVNLANWGLGLFLGLMTFLFIFRIVLTWYPQVELNRLPWKLI
FT                   ALPTEPLLIPVRRVIPPLGGVDISPIIWVGICSLLREILVGQQGLVTMALNSH"
FT   gene            complement(656424..657005)
FT                   /locus_tag="cce_0651"
FT   CDS_pept        complement(656424..657005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0651"
FT                   /product="putative pyridoxamine 5-phosphate oxidase,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACB50002"
FT                   /db_xref="GOA:B1WQ80"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024015"
FT                   /db_xref="InterPro:IPR024624"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ80"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB50002.1"
FT                   /translation="MIDILAPWRTILSRSLHRNRSLPNARYLQLATVNLQGKPSNRTVV
FT                   FRGFLNNKSQLQIITDGRSEKINHISNNAASEICWYFPKTREQFRITGTLTIIDENYDN
FT                   QTARLTVWQNLSDSARQQFTWPEPGQALTYNQQDFFRETPPKDHPLANFILLLFNPEKV
FT                   DHLELRGNPHQRTLYYLDENKNWIIQAVNP"
FT   gene            657311..657733
FT                   /locus_tag="cce_0652"
FT   CDS_pept        657311..657733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACB50003"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ81"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB50003.1"
FT                   /translation="MSHSYRHYRQVKIINNGQQSSPKIDGFEEIVCDGKKQVYYWNEPT
FT                   DRSRWDDSELSFSSLIDPDYNWLDIDEFFNGVRYLNPHEVIIRDLTYPQTTIKHQNSKL
FT                   FQLKRSIQNGVNNLKKIAKRLPLAFRAAWRELTSDY"
FT   gene            658035..659375
FT                   /gene="pmbA"
FT                   /locus_tag="cce_0653"
FT   CDS_pept        658035..659375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="cce_0653"
FT                   /product="putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACB50004"
FT                   /db_xref="GOA:B1WQ82"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B1WQ82"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB50004.1"
FT                   /translation="MLNTETIANYAQNSAEKLGINKYDIYGSSIDETSVEVNHGEPKQV
FT                   QASNRSSVIVRVWNEKGRVGVTTTTDLDELGIQLALETAKEASTFGNTENPPEFSPEAK
FT                   ATIENAVDEIVEPVPVPTLIDTLIKAEKSLLNAHPAIQGVPYNGLSQEDIKRFYLNSDG
FT                   SLRQEARSYAVIYLYSRTEEEGKKPRGASAMKISRGLETLDVDGCLKEVTEKTISHINY
FT                   RTIPSGKYTVVFSPKAFLSLISAFSNLFNAQNILDKQSLSNLDSIGKEVASPLLCLSDD
FT                   ALHPDNIGAETFDGEGTPTRRVELIKDGVLTGLLHSAGTAKRMNVQPTGNANIGAKVTV
FT                   GSHFYHVFSNSETNPEYNLDEAENVILIDKLQALHAGVNTLQGSFSLPFDGWLVNKGEL
FT                   TSIDAATVAGDYLTLLKSIIAIDSEAEVTPGGVCPRIWVSDLSITGE"
FT   gene            659478..659795
FT                   /gene="petF2"
FT                   /locus_tag="cce_0654"
FT   CDS_pept        659478..659795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petF2"
FT                   /locus_tag="cce_0654"
FT                   /product="2Fe-2S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:cce_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACB50005"
FT                   /db_xref="GOA:B1WQ83"
FT                   /db_xre