(data stored in ACNUC7421 zone)

EMBL: CP000808

ID   CP000808; SV 1; circular; genomic DNA; STD; PRO; 39620 BP.
XX
AC   CP000808;
XX
PR   Project:PRJNA20319;
XX
DT   02-APR-2008 (Rel. 95, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Cyanothece sp. ATCC 51142 plasmid A, complete sequence.
XX
KW   .
XX
OS   Crocosphaera subtropica ATCC 51142
OC   Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
OC   Aphanothecaceae; Crocosphaera; Crocosphaera subtropica.
OG   Plasmid A
XX
RN   [1]
RP   1-39620
RX   DOI; 10.1073/pnas.0805418105.
RX   PUBMED; 18812508.
RA   Welsh E.A., Liberton M., Stockel J., Loh T., Elvitigala T., Wang C.,
RA   Wollam A., Fulton R.S., Clifton S.W., Jacobs J.M., Aurora R., Ghosh B.K.,
RA   Sherman L.A., Smith R.D., Wilson R.K., Pakrasi H.B.;
RT   "The genome of Cyanothece 51142, a unicellular diazotrophic cyanobacterium
RT   important in the marine nitrogen cycle";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(39):15094-15099(2008).
XX
RN   [2]
RP   1-39620
RA   Welsh E.A., Liberton M., Stockel J., Sato H., Loh T., Wang C., Wollam A.,
RA   Fulton R.S., Clifton S.W., Jacobs J.M., Aurora R., Sherman L.A.,
RA   Smith R.D., Wilson R.K., Pakrasi H.B.;
RT   ;
RL   Submitted (22-AUG-2007) to the INSDC.
RL   Department of Biology, Washington University in Saint Louis, One Brookings
RL   Drive, Campus Box 1137, Saint Louis, MO 63130, USA
XX
DR   MD5; 9176de774234fe3832b98b82df94d970.
DR   BioSample; SAMN02604312.
DR   EuropePMC; PMC2567498; 18812508.
DR   StrainInfo; 115227; 0.
XX
CC   Bacteria available from the ATCC Cell Biology Collection: ATCC
CC   51142.  Products annotated as 'unknown' have been observed in
CC   high-throughput proteomics experiments.  Products annotated as
CC   'conserved hypothetical protein' have orthologs in at least 6 other
CC   cyanobacterial genomes.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..39620
FT                   /organism="Crocosphaera subtropica ATCC 51142"
FT                   /plasmid="A"
FT                   /strain="ATCC 51142"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:43989"
FT                   /culture_collection="ATCC:51142"
FT   gene            complement(1..3621)
FT                   /locus_tag="cce_5218"
FT   CDS_pept        complement(1..3621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5218"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54564"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:B1X353"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54564.1"
FT                   /translation="MKFPQIDRNLVQRQLTLLGHNINKPVYLRFFYPSDDPRKEGDSGR
FT                   KADRLNWKQIEQYQKEGRGAYFVINGGGHKNSDVTQGYAIFIEHDDLEKDIQRELWKTL
FT                   DLPEPTFQVDTGGKSIHSYWVFDEPVAIEKWSQLQKDLLEYADGDRSIKNPARVMRLAG
FT                   GWHISHDENGNPVYNQTKIISASAKTYTYKELRAIIPEQKEELPLVEAANHRDFVNKFP
FT                   DNLSVSSLPRHPEQISVPVTAPVPLLQCCRKEVREWVTTGVPKGCKRNDTAINIGLELI
FT                   AVERYLQTIGQSYSDSATALFHEFCQRSGMTASEENERYQWCQKTNSDPSCPPEAIEAC
FT                   IRGWYWKEVVQPQRPRNNTQYKVQQQGTEATKNSSEKPKINLLEAIKEILRELPQDSLR
FT                   YMALISLAAQTGYNYREIELLARTVEREENIDEETAEAIASLSTNLNLYQQRLDISRYL
FT                   EKDFAGLMIDAANAMPTAPEYLFNTLLPVVAACGGTSSTVVANGTGGYEQPLIFWSGNV
FT                   AHSGQAKTPPQQVIIKPLIDLEAEAADKYNLLKREYEQDKSGDIPSPTRERFMMTNVTI
FT                   TTKMRIHGENPRGLLEYMDELSSDFRRLNQYKKGGMGDDKEQELSFFNGSSISYDRSDS
FT                   HLFLEKTALSKTGTIQWDTLSKLMDNSGFIESGYMARFLLCSIGNAPKRYLDLFQETNA
FT                   VPDLQHKLRWLYEQMRELPEQTYLLDHDSKVLFQAWNHTLVDFGIREYNHALSLVYPKI
FT                   ECYTLRLALWLHLVNSLLRGEKPHLVIDGETMKAAIEMGSFYLGQHRLIFTNTDSSNEL
FT                   EGILLKIHTKALDVYQQTEKGVSASWAKKNFNALKKMSTDQIRTKYFQVLAGNGYGKLE
FT                   GVGKSMKYIPFEQRFGFSELNSNNLEVDDSCQSSGNSMEVSIAEMPIQTCFKEKVAKID
FT                   DSTYSKIISNVVDNKSACRSASTTTTSPLSESTPPNHQLTNQSQSKLDDASFTKVEPSP
FT                   QSENQPPKTNADIEWLMKVLVDLENNSRYYTTEEQDALLSEVSAKTELHDQTLRAICPD
FT                   YGDRFISALTKATETAPPTLDELKSLLLACNTWVELKQVQKQHPEQAKAVYKALEPVEQ
FT                   KQIDAIAATEVNQDVYKYVGPQRKVDGVEIQPGTLVYLDPQSGNKNRPHLKVRLLQGIN
FT                   QGWQKVVEISKDALQAVEKAVNEGLETFEGQQGNLLDGRS"
FT   gene            complement(4626..4928)
FT                   /locus_tag="cce_5219"
FT   CDS_pept        complement(4626..4928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5219"
FT                   /product="hypothetical protein"
FT                   /note="contains a HNH endonuclease domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5219"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54565"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1X354"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54565.1"
FT                   /translation="MTSRYSKDWKTIADTIKSNAGWGCAKCGMQCIKPGEDVSKLTVKE
FT                   RKARTLQVHHSDFTPENNDPSNLIPLCTACHLSYHQGRRGNVSRLSVIPVLNDKR"
FT   gene            5059..5703
FT                   /locus_tag="cce_5220"
FT   CDS_pept        5059..5703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5220"
FT                   /product="unknown"
FT                   /note="contains a cobyrinic acid a,c-diamide synthase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5220"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54566"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X355"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54566.1"
FT                   /translation="MAIISLVNQKGGVSKSTTSVHLAYWLLTQQKQKVLLVDADGQRSS
FT                   SQWVEGMEDIKISHKVIQSPDDLLEQIPTLAADYDYVIIDGPASLSEATRAILFRSDLA
FT                   VIPVQPTGVDLRSASDAMRLVKQAQSVRGGLPLAVIFLSRAVKGTNLKKEAIALLSQIK
FT                   EAKLLKTVVHQKQAIADTSGQSATVWDFSGKPAKDSAREYEQLFKEVLSCL"
FT   gene            5694..6029
FT                   /locus_tag="cce_5221"
FT   CDS_pept        5694..6029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5221"
FT                   /product="unknown"
FT                   /note="contains a ribbon-helix-helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5221"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54567"
FT                   /db_xref="GOA:B1X356"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:B1X356"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54567.1"
FT                   /translation="MPIKKRKNLDDVLAQEFVYGDKETSEQQPIEPTEENQSVELVESK
FT                   EAVTTDKTSIMDKLQPIEQREATKRFTVDLPDSMHRKLSILSAKTGRTKADIVRMLLDD
FT                   ILKDIED"
FT   gene            complement(6096..6728)
FT                   /locus_tag="cce_5222"
FT   CDS_pept        complement(6096..6728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5222"
FT                   /product="unknown"
FT                   /note="contains CBS and CP12 domains"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5222"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54568"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003823"
FT                   /db_xref="UniProtKB/TrEMBL:B1X357"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54568.1"
FT                   /translation="MMMMKVADIMTKDVITIRSSATVSMAVKLMRDKKIHTLIVQRRHP
FT                   QDAYGIITDSDIVNEVIASGKNPKQVRVYEIMTKPCLVLNPDLGVEYAAKLFKNHGIRC
FT                   APVIKDELLGIVSIVDILNKSEFLNNPIEDQLQQEIEEKISQARKLCQEFSHDSQACQE
FT                   AWLLVEELEAEASFYQNKKPEKTALETYLEEHPSAAETLTLENWCSG"
FT   gene            6910..7050
FT                   /locus_tag="cce_5223"
FT   CDS_pept        6910..7050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5223"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54569"
FT                   /db_xref="GOA:B1X358"
FT                   /db_xref="UniProtKB/TrEMBL:B1X358"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54569.1"
FT                   /translation="MHPRKGKLAFFEEKKMITLLILSFIALITLTLIFEVIFYKEEHQS
FT                   L"
FT   gene            7061..7543
FT                   /locus_tag="cce_5224"
FT   CDS_pept        7061..7543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5224"
FT                   /product="DUF355-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5224"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54570"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:B1X359"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54570.1"
FT                   /translation="MELKLIPLEIPSGSNLILGQSHFIKTVEDLYEIMVGISSQVQFGL
FT                   AFCEASGARLIRVTGNNQELQEVAVKNAQALSAGHSFIIMLKEAFPINFLNSIKQCPEV
FT                   CRIYCATANPVEVVVAESEQGKGILGVIDGYSPLGVETEQDIIERQEILRKFGYKC"
FT   gene            7595..8269
FT                   /locus_tag="cce_5225"
FT   CDS_pept        7595..8269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5225"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54571"
FT                   /db_xref="UniProtKB/TrEMBL:B1X360"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54571.1"
FT                   /translation="MKVIPCSEQNLDNVQINTAVIQLNGKEVTIIQIVDKQGFPYSWLT
FT                   IAEGLVKDSSFRELWNQTLAEIPFNFQWKPVPIHPKFAKTYPFFAVLVPSSFPPSNPSA
FT                   YRKYLNKLSNEELITTFPNLSGDALLLIPKDTGDYGHIADFCRNADDKLIQTLWQSFGK
FT                   LTYQAILNEEILWCNTHGHGVPWMHIRFDETLKYAAFPPYGTIDETSQKEWYETIYLKV
FT                   FE"
FT   gene            complement(8353..9000)
FT                   /locus_tag="cce_5226"
FT   CDS_pept        complement(8353..9000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5226"
FT                   /product="putative RuvC-like Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5226"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54572"
FT                   /db_xref="GOA:B1X361"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1X361"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54572.1"
FT                   /translation="MYTPIMPNYHPLPHPHRTQWHHLPTKAIRVPECFVEEIKAYAISL
FT                   DQSAEKPSTSHPPRWLGIKPSISQLGWAILEGETTEDPQMVDFGLISTNSDDPLPCRLA
FT                   EIEADLQEIIKDYQPTQIAIEKTFINPEFPSTAKLLQVLGVLNLVAYRHGCLPLMVNPA
FT                   TWKSNLDNPKAEREDIADILEQMFYLNPLKRDAQVDAIAIAYSGWCGLGQHL"
FT   gene            8984..10297
FT                   /locus_tag="cce_5227"
FT   CDS_pept        8984..10297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5227"
FT                   /product="hypothetical protein"
FT                   /note="contains a plasmid pRiA4b ORF-3-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5227"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54573"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:B1X362"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54573.1"
FT                   /translation="MIGVYTQIKINRVVNNMDLDFLMVSGLMGDVPPVDPNLKQWLQQQ
FT                   TITQESPGRIFQDWQSFLDFIGTDGAEVTGKNDYFPMKLLPEINACLSQPIDIDLKRPQ
FT                   QKSYPYIHGLYLLVRLLGLASPIREGKKSKLIINQDLLKTWQKLNVTEQYLILLEVALF
FT                   WLSIDYGSVATFLSTFNTWMRLPQKKVKITKQNAGKYNLDYLETVTHFALFDLFGLVKL
FT                   ESGKPLPGKGWNITAIEKTPFGEAMMQVLIRCFMSQGSSFVSHRENPLIYGEFQPLLQE
FT                   YFPDYQHKFTIPDPNESRELTDGIYQFKVSLGRAWRRILLRGDSTLDPLADTILNAFDF
FT                   DKDHLYQFICKNRLGKEFYINERFLEEPPYTDKFLVKELPLQIGDTMIFLFDFGDNWQF
FT                   SVMLEGINPPDKDLKIPIIEESKGKAPIQYEEWDDHEY"
FT   gene            complement(10332..11204)
FT                   /locus_tag="cce_5228"
FT   CDS_pept        complement(10332..11204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5228"
FT                   /product="probable integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5228"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54574"
FT                   /db_xref="GOA:B1X363"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B1X363"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54574.1"
FT                   /translation="MFPMTPLNTYHPPITEVDNDTQVIQLWLSGLRLGTQKTYARTVNQ
FT                   FLGFVEKPLVNVLLEDLTRWVDLLFIKDYSQNSIALKISIIKSLFSYAWKIGYLPLNIA
FT                   KAVKAPSSVNALHERILEQPEVKALIEAAKEGRDRTILTLIYATGLRATEALSINWRDL
FT                   RPRKQGGQATITGKGGKVRTVLISDNLWKELKKLPRSQKTEAVFTTRFGNRLDRHQLHR
FT                   IVKKTAEKAGINEHTSTHWLRHAHACHSLENGCDIDVLMRSLGHSSLTITSKYLHARPN
FT                   EGSSQFIDI"
FT   gene            11341..12060
FT                   /locus_tag="cce_5229"
FT   CDS_pept        11341..12060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5229"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54575"
FT                   /db_xref="UniProtKB/TrEMBL:B1X364"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54575.1"
FT                   /translation="MRITFYVNRVPGNPLKGRGWIDIRNLEVVKRLNIPMTGDCTNSHI
FT                   QIKVKCSSPEYEKFRQKGYTRSKSNGISVGKFEEDYLMVTVACHRGKAGGKKFQVIEKR
FT                   ENVSLIVQKSLTIEAVRFWAETWASEGAYLVTPGGKKIAIEQNKVIETEYVYLIYSEVM
FT                   NAIKIGRAKNVEKRFTSLQTAHPYPLKIIKTLKVSGKKAAIDLEKQLHQQFADYRLSGE
FT                   WFKACEALMNFSDDKNS"
FT   gene            12224..13714
FT                   /locus_tag="cce_5230"
FT   CDS_pept        12224..13714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5230"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54576"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B1X365"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54576.1"
FT                   /translation="MSQSVVVPDELGEIITAVIEFYQDAVDKIEPKIVFLELRKNVVDW
FT                   VSRTQLKIEEKEIQATGLTRQQQTAYKEMINFIENSSEQYFRLSGYAGTGKSFLMAKVI
FT                   EWLKQEDYKYSVAAPTNKAAKNLTQIARSQGIKIEATTVAKLLKLQPTIDVDTGQQSFE
FT                   FNSEKELELKDYDVIIIDEYSMLNKDNFRDLQQAVKGGESKFIFVGDSSQLPPVKEKEP
FT                   IVANHPDIRKSANLTQIVRYDGEIVKVAESIRRNPRWNHQTYPFETVADGTIIKLNTED
FT                   WLQQALSHFEKEDWLSNPDYVRMITWRNKTADKYNQAIREALYGENVEQLVVGDRLIAK
FT                   KPVFRSLPGGKKKEKKIILNNSEECKVIETPKINYNEKYKWEFYQVKVRTDEGGMIELR
FT                   ILTSESEEKRQKKLKELAKRAREEENYSEKKKQWAIYYELDELFDNMAYAYALTCHKAQ
FT                   GSSIDNVFLLVSDMHYCRDKTKMIYTGLTRAKKCCYVG"
FT   gene            13696..13929
FT                   /locus_tag="cce_5231"
FT   CDS_pept        13696..13929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5231"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54577"
FT                   /db_xref="UniProtKB/TrEMBL:B1X366"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54577.1"
FT                   /translation="MLLCRLVMKKFNDEKLMSKQELLEQEKLLEIERQHPVYQGIISYL
FT                   LEEAFSEEKEPQYIKKEEIHEWLLSLVDEKDD"
FT   gene            13913..14404
FT                   /locus_tag="cce_5232"
FT   CDS_pept        13913..14404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5232"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54578"
FT                   /db_xref="GOA:B1X367"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:B1X367"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54578.1"
FT                   /translation="MKKMTKLSPRQRKVTRLHRISHILDKAIPIPGTQWRIGLDPILGL
FT                   IPGGGDTIAGVLSAYIVWESARMGVNRKVIGQMVANVLLDSLAGSVPVVGDVFDVTWKA
FT                   NVRNIELLEHHLNFTPENKKVDRLFLIGLSIVLILILLGFTLLTLALLTWLWQNIMGNN
FT                   "
FT   gene            14438..14605
FT                   /locus_tag="cce_5233"
FT   CDS_pept        14438..14605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5233"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5233"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54579"
FT                   /db_xref="UniProtKB/TrEMBL:B1X368"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54579.1"
FT                   /translation="MGRGINRKPSKTSSFIIYDIVTVQKLAGHASPVTTAKYDRRGEAV
FT                   KRKAVHNLGF"
FT   gene            complement(14709..15869)
FT                   /locus_tag="cce_5234"
FT   CDS_pept        complement(14709..15869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5234"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5234"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54580"
FT                   /db_xref="GOA:B1X369"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:B1X369"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54580.1"
FT                   /translation="MTIQPIYLDYHSTTPVDPRVAELMVYYLTTAFGNASSIDHTYGDE
FT                   AEKAVYNARQAIAQLIKASPKDIIFTSGATESINLAIIGHIQAINSPKLPRIAVSPVEH
FT                   KAVLDTIQMLAKKGQAELIYLKVDGFGRLDLENLENTCADGLSLLCVMAANNEIGNIYP
FT                   IEKIGQIAHQYDIPFLCDASQAVGKIPINFNDWGITYLAISAHKLYGPKGVGALVVRKG
FT                   YPLEPIIFGGGHQKGLRSGTLNVPGIVGLGEACRLRQLEMEQDEQQIARQRDRLQTLLQ
FT                   AQIPDLQVNGNINARLAGNLHISLPGIPNSAIIARVRHQLAISTGAACSSGVATPSHVL
FT                   RALKLSDEMIEGALRIGVGKFTTDEDIEKAANILTVAVEKIRPYLS"
FT   gene            complement(15866..21391)
FT                   /locus_tag="cce_5235"
FT   CDS_pept        complement(15866..21391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5235"
FT                   /product="unknown"
FT                   /note="contains a FtsK/SpoIIIE domain"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5235"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54581"
FT                   /db_xref="GOA:B1X370"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X370"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54581.1"
FT                   /translation="MDSIDLIGQVATKFLRESLNTEDSDGVARFILDRLTGEQVTNICQ
FT                   SILATPDLSPHIKIQIPRTLVAGYDLPEAILTDEKTVHLRHAPCDRPCLLLANTNDDQG
FT                   QSLKDISALGAGLLKEQIEIWVDVASEGLDLPDEQLKYWNKALKGLLAASECSLEQFAN
FT                   YVMDTRERIASESVPIINALGWALPALRLPRDSGYFEAIPQKTWGHAQKWQQKYQQAVS
FT                   KRACLLLKQTPTRKPIEESELQSTFEKVKEDIPEQAHSIIQAFIKSPPEWNEQGKALTK
FT                   FEWEIDNIHAIFSGLKTKKTDLYSLTQQFYEDEYPDSLTESELDYLETLKKRKAKEANE
FT                   EDKEFYDNHRSELENDRTLKTKWDKFVYGQPIECTDFLVGLVQAFERLFDQADSQENPT
FT                   QLIIKTQKSSRKSKWLELNADMGLYFCTRYRGIEQLTYPEITWETHWLFKYDELLKDEQ
FT                   TKNKKKYKKNVSVAKAACEIKFYVELRSCFSQELISKIQLIWKVNPNSIGMELHDDLNR
FT                   LVNSNPSPFLISEVSRELVSKKGRLQGISLDDVGTLMAAYRQDRGSLVSKYDRKQDLAK
FT                   LFPTALKQAVQDNRLSSESAEIIKQAWGKFKETYTKALNSWLSQEGISHPVLIHQCDDY
FT                   QELLKTLLNHALGDTNRVELIEPILRLGCVEVKRGKPAAIITPWHPLRLASLSIKARQI
FT                   SGLLKHILSTEDVNFGDSRLFFSDLRNELTHPYYPEVCLGYKGNEPLLLYLSDTVNDYS
FT                   LLEQPIKDITQQSTNEDPKKAANKLLDLMKRYLELLPHEQTNLSIILYQCDSTRLPQTV
FT                   ITKLSELQDNYNEARCQVILCHRDSPKLSDLYQQLIESSQTDADAFVASEGTHDFMARL
FT                   RISVMSNTSSSSNGKIADIVFLQDIISRQAEIVWQPTPLSNDNPDILKHVPTRYSRKRP
FT                   AAKDELKSTVYLVCPSQPSVGQTYLDAIYSSLKRVDLDCAKNQHFLPARQISFQDEDTS
FT                   TVFKEVHRLGEWVVNYDDLLERRQLINQGVNVIRYQQSRSDDRNFLVSSNAPLNLLQVL
FT                   VKRRLESLNLDLDETTIKTLAEQFIEQAKDISGDIILRAAKSGKYASELMGVVLSKALL
FT                   LSELGEEHPVGWYFLDDYASWLGQKEGRIADILAISPQIKNEQPVLKIIISEAKYIEAN
FT                   GLNDARKSSQHQLRDTVERMANALFVSPGRLDRDLWLSRLGDLLLDGIEFNSTDSISIE
FT                   EWRKGVRDGTIPLDLSGYSHVFISGPSDTSVSNDQIPIAKVDRCYQEIFNRETVRQLVL
FT                   AIHHQQPLASIREKLGNEQPWTVSEPRFPADRVVWVNPILELPILDDSASSEKIAYIES
FT                   LSTESTETIVNRTLQNENLTTINSNQKQSLVTSPQNIHPSHSINSLKTPNKAANDNHPI
FT                   NDFNSQQNSNGVSDYNSQSNHLNQLNYTNQNKNEEKKEVNNITQTTWASPALATWINQQ
FT                   TESKINEQQEKKWLETTVSTLRKALISYDLQAKVLGQRLTPNAALIRFKGSDRLNIKDI
FT                   ETRRSSLLTTHGLNVINILGAPGEIIVSIARPQREIISLSQVWKQREINLKAGVNLSFI
FT                   IGVKEIDGELLYLNLGEEFAHLQQHAPHTLIAGATGSGKSVLLRNLLLDVCATNSPELV
FT                   KIYLIDAKQGTDYFPLEDLPHLTEGIITEQYQGIEVFEKIVSEMDSRYQLFREQKVNNL
FT                   LVYNQKVSAEKQLPVLLLVHDEFADWMLVEEYKNAVSSAVQRLGVKARAAGIHLIFAAQ
FT                   RPDNNVFPMQLRDNLGNRLILRVESVGTSEISLGQKGGECLLGKGHLAARLPGESDLIY
FT                   TQVPFLSNEEFSLVAEAIKQDLSQNL"
FT   gene            complement(21392..23077)
FT                   /locus_tag="cce_5236"
FT   CDS_pept        complement(21392..23077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5236"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54582"
FT                   /db_xref="UniProtKB/TrEMBL:B1X371"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54582.1"
FT                   /translation="MIIKRLPKPTSHNKTHRETEMWVDEAIWGHRLYDEQTPWLTLLEF
FT                   LGIVQTQLEREQAFIEPENHQLEYPSYSRLYLRNILFNNPFLEAVYAEYPTEEERWQQW
FT                   LTLMNDNCGGINTPNFSYLQERFIRFRDFLEVVRFLQSNAIEGDSNKRWTSKFVFPYGV
FT                   NCLYEDLRISKNSYSNDRRFFARNGELLYLMISRSSLKLDILTHLKKLGIIDHKQSSKW
FT                   NKLVATLQPNDHSDTKPRGKDSSPPYLPYEHLDEFENLANDWINLFNCHLPDYDSLPHL
FT                   VTITGVHLVIYLLKRAKAVLNNEDDPRFSSESLLNSQQNLLFKSETIANTNEDSLNSTT
FT                   TLNSQDKPQLILEIIAPKKTIIRDLASDAFLNNNNLSKRAVEHYIKRLSQLPEWQTCLN
FT                   SANSIEDALEIIKEEIYYKKDEIKCNSPDELLEEIRLSAITRHKQHVGQFHSKWTKEIG
FT                   LASSRGSRRTRYAPTDSLLKTLVLCCVPKRMEFQEFLDTLYQKYGFIIGEKQAIDIIQR
FT                   KEADLEAFSDNAERLEQRLASLGLLKRLSDACAYVLNPYTVEKT"
FT   gene            complement(23074..24981)
FT                   /locus_tag="cce_5237"
FT   CDS_pept        complement(23074..24981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5237"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54583"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X372"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54583.1"
FT                   /translation="MIGYIYLSLITLIMNYNSTFKKSKWITFLRQYGPIPRNDNMYDEA
FT                   IQRALKKNKIQPICFETPYLQELIDNFQSDFPKSVILTGTAGDGKTFCCREIWEKLGGS
FT                   KEEWETNQEIYKLPLLQKTLIIIKDLSAIQDEEKTQLLPQIAEGIINPYHTDKVYLIAA
FT                   NDGQLIEAWNVAENTPQIEKARQLIETLLVEEKRENPEFNLLLYNLSRLNNEEIFSRIL
FT                   DAVLNHPGWEECSQCPYQTPTDSQQRCPIWENKTRLDGKNDQQLMRQRIIDLLELSRHK
FT                   GTHLPIRQLLLLISNIILGHPDVKDKLLNCNQIPKITTQKTGYLASPYSNLFGENLSSR
FT                   KRNKTDVFVALRYFGIGTESSNYIDNILIFGEDDPDLKQDYENLVLTDTFYGAHQQFRI
FT                   AQKSYLESNDSQDSKEEFLNILHTQRQRLFFTIPQHRVAELKLWELTAFQYAGDYLEQV
FT                   CRPLKQNQTIPKYLIFKIVKGINRIFTGLLINNQDQLVLATSGSYSQAKISRVFEEYIS
FT                   VIKKRGESVTVELNTDHNTPDFIISLSSHPEVDPIKLRLNLTRYEYLNRVAEGALPSNF
FT                   SQECYEDMLAFKTRLLGQLNIRRQKEEEADETEASEMIIRLLELNADGIANERTLEIQL
FT                   "
FT   gene            complement(25004..26728)
FT                   /locus_tag="cce_5238"
FT   CDS_pept        complement(25004..26728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5238"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5238"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54584"
FT                   /db_xref="GOA:B1X373"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1X373"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54584.1"
FT                   /translation="MLGKITIQRFKNLENLTLDLDRVNILVGSNNSGKSSILQAIQFAV
FT                   SVGQTASLQSNVNWKDEKLSTSLSPQQLIYAPLRDVYALAYGGKLVENKDQAIIISFEE
FT                   NQEKQNVLVTVRKGRNRNLSITVEGKELGERLQIIETPYSIYVPGLAGIPDVEECKTPG
FT                   IVRKAAARGDANKVFRNVLYLLHNESEQWKQFISDFNYLFPDLKVIVEFNPERDDYINC
FT                   QIQANDENSLPIDLAGTGVLQAIQIISYINIYKPQILLLDEPDSHLHPNNQRKLAKMLI
FT                   KLTEERDLQIIVTTHSRHLLDALREKTKIYWLKNGTIINEKDFDTVQLLLDIGALDKDE
FT                   LLLNTENIKCVLLTEDEDTKPIETLLEASGFRMDEVDIWSYKGCTKVETALVLAAFIRK
FT                   HSSQTKILLHRDRDYLTDDEANDFREKIERANILCFLTTGTDAESHFINLGHIQSLYPQ
FT                   LTTDRIQELISNSTAEKSEKSKEKFINSRTDIELQQSRQKGNGRINNGQIASNCYQMYD
FT                   QDCERYRYGKSVLKTLKSKLQQEVGGNIDLFCVTDSLKIAELEELALLIWSQRKDTS"
FT   gene            complement(26759..27559)
FT                   /locus_tag="cce_5239"
FT   CDS_pept        complement(26759..27559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5239"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54585"
FT                   /db_xref="GOA:B1X374"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1X374"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54585.1"
FT                   /translation="MAQKKIRHILGLSGGKDSTALAVLLHKEIPDMEYFFCDTHKELPE
FT                   TYEYLDRIKARLGITIHYLSENRGFDHWLTMHDGLLPSPKMRWCTVKMKIKPLEEFVGE
FT                   DEAISYIGIRADENREGYISTKPNIKPVFPFKERGLVKADIIRLLEDSGIGLPDYYRWR
FT                   SRSGCFFCFFQRKYEWVMLAQEHPDLFAKAVEYESNHRDGRTYTWTEGETLLELLERKE
FT                   EIIANHEKAIAREKKAAPNRPLSEALEVVLDEEDDDLPCLVCHL"
FT   gene            complement(27507..27614)
FT                   /locus_tag="cce_5240"
FT   CDS_pept        complement(27507..27614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5240"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5240"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54586"
FT                   /db_xref="UniProtKB/TrEMBL:B1X375"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54586.1"
FT                   /translation="MDQIIGNAKIIAQENLGRNGTKENKAHTGTLRRQG"
FT   gene            complement(27673..28257)
FT                   /locus_tag="cce_5241"
FT   CDS_pept        complement(27673..28257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5241"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54587"
FT                   /db_xref="UniProtKB/TrEMBL:B1X376"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54587.1"
FT                   /translation="MGKVMKNNQLLTGLITSFSLGFLLVPPSYAEEIIRQIDFNNFTYQ
FT                   IREGGMGPSGNITLKQGQYQDDDWGYVSLDKVQYRDFNDDSKEDALVVLLSSGGGSGIS
FT                   THAYIFESQSRKIKPIFSTMNFIEIRPYGSGFVLYTSNRANTGKINCGNFLVGSNVIDI
FT                   TPYQWEENGFSPLKTTTIQGREICNVLSIPS"
FT   gene            complement(28320..28889)
FT                   /locus_tag="cce_5242"
FT   CDS_pept        complement(28320..28889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5242"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54588"
FT                   /db_xref="UniProtKB/TrEMBL:B1X377"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54588.1"
FT                   /translation="MKFLSIITLFSSISLFVSFLSQPSFAEVLCEIDGNYESPSPTYRR
FT                   LNLEGFGISVDIPENYRVMLKQDRSVEILHPNDYQFLECIANGGIAQYHTGRYSESIRL
FT                   IENNQSEGLKELILDIYHGDLKTYFFYKNSRNPGYIIVSESGYSMTFLGTIPDKSKLLE
FT                   VSIRCDCEVELQDLTNFLSRITLLNQ"
FT   gene            complement(28942..29562)
FT                   /locus_tag="cce_5243"
FT   CDS_pept        complement(28942..29562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5243"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54589"
FT                   /db_xref="UniProtKB/TrEMBL:B1X378"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54589.1"
FT                   /translation="MKRCNLYFLVFILTFLSTTLGYFEQTSAQFLPNSVKINGKDKCNL
FT                   SNFYGTPAATTNRTIVLEDFGIKISNIPTNYRAMSGLNGLKRVDIIRQDVFEVLQKPND
FT                   SRADYLGDYPNIYIFFEQTSLEEILNHAHQNRDSLGYMKEHKILDSLGNLRSGYLIELG
FT                   DGAAYYIDIPGKQVLGIHIYPGEPGLQVLKCMLPNVTLLSKTL"
FT   gene            complement(29585..30112)
FT                   /locus_tag="cce_5244"
FT   CDS_pept        complement(29585..30112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5244"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54590"
FT                   /db_xref="UniProtKB/TrEMBL:B1X379"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54590.1"
FT                   /translation="MKNFFRHKFLFLSFKQFLSTALITLPIIIDVSPSLAQRNLSIEVL
FT                   SDECRTITSEVFNQIRRYQPTREHFEKTSVDVARDYKGNYSIGFSALSGEFGSGERERV
FT                   MLQIAQRLAPFCPQVALVSFSGPTWSDWTMRRDGFSRIHYKDEQFPGDWDFYWNWNKLP
FT                   FDYDPLKNYFPD"
FT   gene            complement(30124..30831)
FT                   /locus_tag="cce_5245"
FT   CDS_pept        complement(30124..30831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5245"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54591"
FT                   /db_xref="UniProtKB/TrEMBL:B1X380"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54591.1"
FT                   /translation="MERNYPMRSFLSLTIAAVLSSSSAMELSAQTNSYLGSQWISVGHP
FT                   NVRIEINKNSLQKTDNSVTSEFAYFFYDSDKKQQSLAVKGKRIDSCQSKNFTNKQVKVI
FT                   QAKAFKTYYEGEFVNELNVPPDQFDYYVLNPYHSTLLNRYLCNNLHPNYLKAGMNLSQA
FT                   KQLLYTNGFRIVTQEETAVSASNQNICESNAPCLTCGNGWSGCYIDFWNSKTQVKLTVR
FT                   VDYGHKIVIDTHL"
FT   gene            complement(30935..34687)
FT                   /locus_tag="cce_5246"
FT   CDS_pept        complement(30935..34687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5246"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5246"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54592"
FT                   /db_xref="UniProtKB/TrEMBL:B1X381"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54592.1"
FT                   /translation="MIQPLSQYITLKRRYSRSVNLERDSEQFEALEGYVLTDRSITTLR
FT                   RISSGIAAPEGNRAWTLTSVYGTGKSAFAHYLTALLADNKSKLRKKALEIARNTLGKES
FT                   LDYQTISQVIPEKGYIRAVATGQREPISHTIIRALSRGVETYWKPAQQNKIPAIAKLTD
FT                   LETELASEEAIDSRKIVELVQELATASKTGIFLIIDELGKALEYAAYNQGAEDLYLLQQ
FT                   LAELPKNTATPVYLLGILHQAFAEYSQRLAAVQRNEWAKIQGRFEDIPFTESASSMMRL
FT                   MGQAIDQTQAEPLECAIHNTASEWFSRLKTAIQGEEITLDILENIYPLHPVTALALPTL
FT                   CQRYAQNDRSLFTFLTSNEPYSFRIFLEETSIKNNTIENSEKPTTQKSQTDYINPFPTL
FT                   KLDRVYDYFIEAAGMGLASRPNLQRWVEIQDLIADAKRLENDSLRVLKAIGILNLITTT
FT                   GANRATRELVTLAMCDSPHDSEQLEYWGSIIDDLLQKNIITHRRQLDELRIWQGSDFNV
FT                   DSELNVFIDQQRESLVNLLSSLRPFNPQIAQRHSYKTGTLRYFERRYLDSKLYFDSNSK
FT                   GLETKGEDDKFKVLQEQLQLENADSDGLIGYWLDEEIPPQIPATTVDGKPFILICAAKL
FT                   DLLRIRTREYAALKQIQTSASELQSDGVARREVRYRVTEAERLLDEILTQAFDLALNHN
FT                   RCWVQGEEKKLNSIADFNATLSHVCDEVYHKTPILWNELINRRDLTSQGTKARRELITA
FT                   MIEQSSKPRLGLSGYGPEVSMYYSLLEETRIHGQTVAITEEKLVTDTGNEERVDSSEIS
FT                   VTVEEKLINTPDISEIIEEDWDFYPPETTSGIFSFWEAVEDFCLNAYDTPHTLDQLYQK
FT                   LAEPPYGIKQGAIPVLIAAVILNHIDDVGLYQDGTFIAILGAEHFELLVKDPSRFAVKY
FT                   FEVVGLRSEVFKELESILRNPKLKKAGKLRNATLLTVVTPLYQFVKKLPSYTKQTQRLG
FT                   KEALGVLKALQTTVEPDELIFTSLPVACGLDPIGTEEAEDGTIAKTLRTRLVQALREIN
FT                   TAYETLLTDCQKLLYEAFGVRSQEKQLREDLRVRASYLAGQCVERNLRSFVQVATDEDK
FT                   SDSEWLEAVVMVISDKPPESWTDKDVTGFEVKLSDIARRFKNLEALQKEVAAKGDGFEA
FT                   RRITVTRPDGEETHRMVWVDNSNEDKVEKYVQQILDILPDNEQIRQAVLAKLTERVLNT
FT                   NSLEGVSLLQEKASSQKGKSKKVAR"
FT   gene            complement(34715..34930)
FT                   /locus_tag="cce_5247"
FT   CDS_pept        complement(34715..34930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5247"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54593"
FT                   /db_xref="GOA:B1X382"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:B1X382"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54593.1"
FT                   /translation="MSMIIDERLRRKIATQSGLSIIGVLGILIAAKQRNLIESVKPLLD
FT                   SLIQETGFWIEEKLYKEVLHIVGEAL"
FT   gene            complement(34967..35104)
FT                   /locus_tag="cce_5248"
FT   CDS_pept        complement(34967..35104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54594"
FT                   /db_xref="UniProtKB/TrEMBL:B1X383"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54594.1"
FT                   /translation="MNSDPFFSSTNPMSLTIPDEFLETAKISEGELKLEITIILIKRKN
FT                   "
FT   gene            35250..35834
FT                   /locus_tag="cce_5249"
FT   CDS_pept        35250..35834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54595"
FT                   /db_xref="GOA:B1X384"
FT                   /db_xref="UniProtKB/TrEMBL:B1X384"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54595.1"
FT                   /translation="MNKLRNCLLHYSGYIIGIHILFISPVESANISTSLDFSSDIQISL
FT                   LRQQNTKTIESQLGWKGFFSLYRMFPDRPDNYDEEFPYSIVYLEPIGNSLNIYNSYVKK
FT                   PLGQLAGCNTHYCDRAKASLIGRLNFKEQGNQWIVTEASGQTRILFDNARCEIYRKSKT
FT                   LICKGFYKVENYPMTPVPAIYKFVNDGSTPF"
FT   gene            complement(35739..35903)
FT                   /locus_tag="cce_5250"
FT   CDS_pept        complement(35739..35903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5250"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5250"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54596"
FT                   /db_xref="UniProtKB/TrEMBL:B1X385"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54596.1"
FT                   /translation="MFIFILNYLYKKKLVVLLLLVTVLKRGASIIDKFVNCRNWSHRII
FT                   LYFIKSLTY"
FT   gene            35896..36465
FT                   /locus_tag="cce_5251"
FT   CDS_pept        35896..36465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5251"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54597"
FT                   /db_xref="UniProtKB/TrEMBL:B1X386"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54597.1"
FT                   /translation="MNKLRFFLIGYTTFFLVTNLLSSYEVKSANLLSKSTIRDEQPTLL
FT                   VQNKTTLESINWGFFSYYIRYPHDTEYPYPNAIYKSVVYLERKNNIIYIYNTYLRRPLG
FT                   QANGCGGLGCDMGKGSLLGTLKLQRRGNFLVVTEATEQAKILNNVKCQVQGDDTVPVLS
FT                   CIGTFQSELNPNAFPFTVIYEFGSGT"
FT   gene            complement(36545..36877)
FT                   /locus_tag="cce_5252"
FT   CDS_pept        complement(36545..36877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5252"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5252"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54598"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:B1X387"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54598.1"
FT                   /translation="MTFIKFHLDENVENAIAEGLRRRNIDVTTTAEVNLIGASDEQQTT
FT                   FALTQKRIIFTHDADFLRLHQRQVEHAGIIYCRQGRRSIGEILQALWRIYLSHTTESMY
FT                   QRLEFI"
FT   gene            complement(36971..37255)
FT                   /locus_tag="cce_5253"
FT   CDS_pept        complement(36971..37255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5253"
FT                   /product="hypothetical protein"
FT                   /note="contains DUF433"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5253"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54599"
FT                   /db_xref="GOA:B1X388"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1X388"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54599.1"
FT                   /translation="MSKLPVISEHICMTPGVCGGKPRIAGHRIKVQDIVIWYEEMGLSP
FT                   DEIVSRHPTITLADVYAALTYYYDNFQEIRKAILEDDRLETEMRSSLSS"
FT   gene            complement(37420..38328)
FT                   /locus_tag="cce_5254"
FT   CDS_pept        complement(37420..38328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5254"
FT                   /product="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5254"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54600"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:B1X389"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54600.1"
FT                   /translation="MTITQPNLFESLPPVNPVFARHETFHPRYGWLKKGFDLATQYSGI
FT                   FTDDYAPVRLGVGKNMVKAIRYWCNAFKVLENDQPSNFGQQLLSDDGYDPFLENPASLW
FT                   LLHWHLLKPTCEAAAWYYTFNEFRAVEFYAEDLTEGLRSYQENLGKSTAESSLKKDINC
FT                   ILRMYVQQQATKGLIEDSIDCPFSELGLIHTAGESKRYTFRIGTKATLPPEIIVAACLD
FT                   YASRVSYGTKTLAISRLLYDVGSPGLVFKLTEEALCDAIERVARHNNKLALSDTAGLIQ
FT                   FSFNDEPLELAREILEQYYRQ"
FT   gene            complement(39433..39606)
FT                   /locus_tag="cce_5255"
FT   CDS_pept        complement(39433..39606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="cce_5255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:cce_5255"
FT                   /db_xref="EnsemblGenomes-Tr:ACB54601"
FT                   /db_xref="UniProtKB/TrEMBL:B1X390"
FT                   /inference="ab initio prediction:CRITICA:1.05"
FT                   /inference="ab initio prediction:Glimmer:2.13"
FT                   /protein_id="ACB54601.1"
FT                   /translation="MTKQPKDKASAKQSKQEPQDPIVPEVQGCEFLTEDSDHLPCHILG
FT                   TPLGTRIESRIV"
XX
SQ   Sequence 39620 BP; 12017 A; 7125 C; 7455 G; 13023 T; 0 other;
     ctagctacgc ccgtcgagta aatttccctg ctgcccctca aaagtttcta aaccctcgtt        60
     aacggctttc tcaacagctt gcaaggcatc ttttgatatc tcaaccactt tctgccagcc       120
     ttgattaatt ccttgtaaaa gacgaacttt taggtgagga cggtttttat tacctgattg       180
     cggatctaag tagacaaggg ttcccggttg tatctccacc ccatcgactt ttcgttgtgg       240
     gcccacatat ttgtagacat cctggttaac ctcagtggct gcgatcgcat cgatttgttt       300
     ttgttcaacc ggttctaatg ccttgtacac ggctttagcc tgttctgggt gttgtttttg       360
     tacctgctta agttcaaccc aggtgttaca agctaatagc agggacttta gttcatcgag       420
     tgtcggtggt gccgtttcag tggctttagt taaggccgaa ataaagcgat cgccataatc       480
     aggacaaatt gctctcaagg tttgatcatg aagctcggtt tttgcactaa cttctgacaa       540
     caaggcatct tgttcttctg tcgtatagta tcgagagtta ttttccaaat caactaatac       600
     cttcattaac cactcgatat ctgcattagt ttttggtggt tgattttcag attgagggga       660
     tggctcaacc tttgtaaacg acgcatcatc tagttttgac tgtgattgat tggtaagttg       720
     atgatttggg ggggtcgatt ctgagagagg ggatgttgta gtagtagaag ctgaacgaca       780
     agcactttta ttatctacta cattagatat aattttcgag tacgttgagt catcaatttt       840
     agcaactttt tctttaaagc aagtctggat aggcatttcg gcgattgata cctccatcga       900
     attaccagaa ctttggcaac tatcatcaac ttctagatta ttagagttta attcagaaaa       960
     accaaaccgt tgttcaaagg gaatatattt cattgatttg cctacccctt ctaactttcc      1020
     gtaaccatta ccagcaagaa cttgaaaata tttagtgcgt atttggtcag tggacatttt      1080
     tttgagggcg ttaaaatttt tcttggccca ggaggcacta accccttttt cagtctgttg      1140
     gtaaacatcg agagctttag tatggatttt tagtaaaatt ccttctagct cattagagga      1200
     gtcggtattt gtaaaaatga gtcgatgttg acctaagtaa aacgaaccca tttcaatggc      1260
     tgctttcata gtttccccat caatgactaa atgtggtttt tctcctcgta acaaggaatt      1320
     aactaaatgc aaccataagg ccaagcgaag ggtgtaacat tctattttgg ggtaaaccag      1380
     acttaaggca tggttatatt ctctgatgcc aaaatccact aaggtatggt tccatgcttg      1440
     gaataacacc ttagaatcgt ggtctagtaa atatgtctgt tcgggtaatt ctcgcatttg      1500
     ttcatagagc caccttaact tgtgttgtaa gtcgggaact gcatttgttt cttggaatag      1560
     gtctaagtac cgttttggag cattcccaat cgaacacagt aagaaccggg ccatgtatcc      1620
     tgattcgata aaaccagaat tatccatcaa cttagataaa gtatcccatt ggatcgttcc      1680
     agttttactc aacgctgttt tctctaggaa taaatgagaa tcactacggt cataactaat      1740
     cgaactacca ttgaaaaaac tgagttcttg ttctttatcg tctcccatcc cccctttctt      1800
     atattggttt aggcgacgaa aatcactcga taactcatcc atgtattcca ataagcccct      1860
     tggattttca ccatgtattc tcatcttggt ggtgatggtt acattagtca tcatgaatct      1920
     ttccctggtg ggactgggaa tatcccctga tttatcctgt tcatattccc gttttaaaag      1980
     gttatattta tcggctgctt ctgcttctaa gtcaatcaat ggtttaatga tcacttgttg      2040
     cggtggtgtc ttggcttgtc ctgagtgggc cacgttccca ctccaaaaaa tcaacggctg      2100
     ttcatagcct cctgtcccat tagccaccac tgttgaactc gttcctccac aagcggctac      2160
     gactggcagt agcgtattaa atagatactc cggggctgtt ggcatcgcat tagctgcatc      2220
     tatcattaac ccggcaaagt ctttctctaa gtatcggctt atgtctaatc gttgttggta      2280
     gagattcagg ttcgttgata atgatgcgat cgcttctgct gtttcttcat ctatattttc      2340
     ttccctttcg acggttctgg ccaatagttc gatttctcga tagttgtatc ctgtttgggc      2400
     ggctaagctg attaaggcca tgtaccttaa ggaatcttga ggtaattccc tgagtatttc      2460
     ttttatggct tcaagtaagt tgattttcgg tttttctgag ctatttttag ttgcctcagt      2520
     tccctgttgt tgaaccttgt actgtgtgtt atttctgggt ctttgaggtt gcaccacctc      2580
     tttccaatac caacccctga tacacgcttc tatggcttct ggtgggcaac ttgggtcact      2640
     attcgtcttt tggcaccatt ggtatctttc attttcttct gaggctgtca ttccactacg      2700
     ttgacagaat tcatggaaca atgccgttgc agaatcactg taactttggc ctatggtttg      2760
     taaatatcgt tcaaccgcga tcagttctaa gcctatatta atcgctgtgt cgtttcgttt      2820
     acaccctttg ggaactcctg tcgtcaccca ttcccttacc tccttacggc aacattgcag      2880
     caatggaacc ggtgccgtta caggaacact tatctgttca ggatgtcgtg gtaaactgga      2940
     cacgcttaga ttgtctggaa acttgtttac aaaatcacgg tggttggctg cttctactag      3000
     gggcagctct tctttttgct ccggaatgat tgctcttagt tctttgtatg tgtaagtctt      3060
     ggctgatgca gagataatct tcgtttggtt gtaaacagga tttccgtttt catcgtggga      3120
     tatgtgccat ccccctgcta atctcatcac acgggctggg ttcttaatcg agcgatcgcc      3180
     atcggcatat tcgaggaggt ctttctgcaa ctgtgaccat ttctctatgg caaccggttc      3240
     atcaaatacc cagtaggagt ggatcgattt cccacctgta tcgacttgaa atgttggttc      3300
     aggtaggtct aacgttttcc ataactcccg ttggatatct ttttctaggt catcatgctc      3360
     aataaaaatt gcataacctt gagttacatc tgagttttta tgaccccccc catttataac      3420
     gaaataagct ccacggcctt ctttttgata ctgttctatc tgtttccagt tgagtcgatc      3480
     tgcttttctt cctgaatccc cctctttgcg tggatcgtca cttgggtaga aaaatcgtaa      3540
     gtatacaggt ttgttgatgt tgtgtccgag taacgttaac tgacgttgaa ctaaattgcg      3600
     atcaatttgt ggaaatttca taattttttt ctccttacag ttttgtgggt atggactgct      3660
     ggagatgccc gttatctaag gatcatagcc ttaactaatg agtgactgtt attaacgatg      3720
     ttccttattt gtgatctcaa tctctactat ttccttgcaa ccaaagatag gattaaaaag      3780
     atttgtattg gggaactgga ttatggtttt ttccagcttt tgttgttgtt gccgttctca      3840
     ttgacatcaa ctgattactt tggtagtgag ttcattcgag attaagacac gataacaaag      3900
     catttccagc ttcttttctt cttttttcaa cggaatagct actgctgtcg accaattaag      3960
     ctactaagac agagttatct ggtgattgcc cagacgttgc tcttattgat tttggccaca      4020
     gtcaataact atgcaatcga tgtaagcttc ggtgacgaca gatgacactg ctagagacgg      4080
     cttggttgat tggttgaatg atgttctttc acgcttaaaa aataagtatg aaaagcatac      4140
     ctcacctgat agtaagattt tcaacccata aacctttttt cgctaattaa cgcttatttt      4200
     ttgcgcgcaa gcctaaaatt ttgacaaaaa gattgcctag accacaactt tcgcttatga      4260
     tagaagtgtt gtggacttag tgtcgcagcg ttaaccgcct caaaaaattc aatgacttcc      4320
     tactcttcta taagtcacct cctttgacga aacagagagt atccagggag aaaccgatat      4380
     cagaaacgtc cgtcaaactt ccccaagccg acggcgtttc gccatttata tggtttcttt      4440
     tgtctgtgat tctctgaatg aacattatct tgtgcataaa agcgtttaag atactaacca      4500
     ttgtacccct aaattaccat taggggacca ttagaggttg cctgatttcg cagaggctgt      4560
     cgtttttatc agcttctgtc ctttttatcg tgtttacctt gacaaaatcc taggttgata      4620
     gtaatttatc gcttatcatt taaaacaggg ataactgaca ggcgtgaaac attaccccgt      4680
     cgtccttgat gataactgag atgacaagca gtacaaagag gaataaggtt agatgggtca      4740
     ttattttctg gagtaaagtc agaatgatga acttgcaatg ttcttgcttt cctttccttg      4800
     accgttagtt ttgagacatc ttcccctggt ttaatacact gcatcccaca cttggcacaa      4860
     ccccaccctg cattgctttt aatagtgtcg gctatggttt tccagtcttt tgaatatcga      4920
     gaggtcattt acttacttat tgcagtaatg cagtatttga gtgtttaagc atttaattaa      4980
     tgatatacta ccgtaaatag agaaactttg aatcggtaat tttcatcaat aatgcagtaa      5040
     ggcagtaaat aagtaagtat ggcaatcatt agtttagtca atcagaaagg gggggtatca      5100
     aagtcaacga cttcggtaca tctggcttat tggttgttga cacagcagaa acaaaaggtc      5160
     ttattagtag atgctgatgg tcaacggtct tcatctcaat gggttgaggg gatggaggat      5220
     atcaagattt ctcataaagt cattcaaagt cctgatgatc tccttgaaca aattccgact      5280
     ttagctgctg attatgatta tgtgatcatt gatgggcctg ctagtttgtc agaagcaact      5340
     agagcaatct tgtttcgttc cgacttggca gtgattcccg tgcaaccaac gggagttgat      5400
     ttgcgatcag cttctgatgc aatgcggtta gtcaaacaag cgcagtcagt tagaggtggt      5460
     ttacccttag ccgtcatctt tctcagtcga gcggttaaag gcacaaactt aaaaaaggag      5520
     gcgatcgctc ttttgtctca gattaaagag gccaagttat taaaaacagt ggtgcatcaa      5580
     aaacaagcga tcgcagatac ttccggtcag tcagcaactg tatgggattt ttcaggaaaa      5640
     ccggcgaaag actcagcccg tgaatatgaa caattattta aggaggtgct gtcatgccta      5700
     taaagaaacg taaaaactta gatgatgttc tagctcaaga atttgtctat ggagacaagg      5760
     aaacatcgga gcaacaaccg atagaaccaa cagaagaaaa tcaatccgtt gaactggttg      5820
     aaagtaaaga agctgtcacg actgataaaa catcaattat ggataaatta caacctattg      5880
     aacaaagaga agcgacgaaa cgattcacgg tagatttgcc tgattcaatg caccgtaaat      5940
     tgtcgatatt atcagcaaag acaggtagga ctaaggctga tattgtcagg atgttgttag      6000
     atgatatttt gaaggatatt gaagattgag actataaggg gtatggaaag aatacttcca      6060
     aaccccttga taatattaaa gtctgcgagt aaagtttaac cactacacca attttctagg      6120
     gtcaaagttt ctgcggcgga gggatgttct tcgagatagg tttctaaagc cgttttttcg      6180
     ggctttttat tctgataaaa agaggcttct gcttcaagtt cttctactaa taaccaagct      6240
     tcttgacaag cttgtgaatc atgagaaaac tcttgacata gttttcgagc ttgactaatc      6300
     ttctcttcaa tttcttgttg taattggtct tcaatgggat tgtttaaaaa ctcactttta      6360
     tttaaaatat caacaataga aacaatacct aaaagttcat ctttaatgac tggagcgcaa      6420
     cgaattccat gatttttaaa gagtttagct gcatattcaa cacctaaatc tggatttaaa      6480
     acaagacaag gtttggtcat aatttcgtaa actctgactt gtttgggatt tttaccagaa      6540
     gcaataactt cattgacaat atcactgtct gtaataattc cgtaagcatc ttgagggtgg      6600
     cgacgttgaa caattaaagt atgaattttt ttgtctcgca ttaatttaac agccatagaa      6660
     accgtagctg aactgcgaat ggtgatgaca tctttggtca taatgtcagc gactttcatc      6720
     atcatcaatt tttaacccat tttgcttcaa tgtaacataa actggtttaa tgtaaatatt      6780
     taaaaaggat aaaataaagc tttgttacaa aagaagttca aaaagaaaat accttgctaa      6840
     attaagagat aaaagactca tttatatttc ttgggttaga taacatagtt attttgaagt      6900
     caagctaaat tgcacccaag aaaaggtaaa ctcgctttct ttgaggagaa aaaaatgatt      6960
     accttattaa ttttatcctt tattgcttta ataactttaa ccctgatatt tgaagtaatc      7020
     ttttataagg aagaacatca atctttgtaa cacagcagaa atggaactaa aactgattcc      7080
     tttagaaata ccatcaggct ctaacctaat tttagggcaa agtcacttta ttaaaaccgt      7140
     agaagactta tacgagatca tggtaggaat ttcgtctcaa gtccaatttg gactagcttt      7200
     ttgtgaagct tctggcgcga gattgattag agtgacagga aataaccaag aattacaaga      7260
     ggtggcggtg aaaaatgctc aggcactctc agccggtcac agttttatta ttatgttaaa      7320
     agaggctttt cccattaact ttttaaacag tattaaacag tgtccagaag tgtgtcgtat      7380
     ttattgcgcc acggctaatc ctgttgaagt ggttgtcgct gaaagtgaac aaggaaaagg      7440
     aattttggga gtgattgatg gttattctcc tctgggggtg gaaacggaac aagatattat      7500
     tgagaggcaa gaaattttac gaaaatttgg ctataaatgt tagctattat taaaggatat      7560
     tgatagcttt gatatcctta acaatcttat atttatgaag gtaatacctt gttctgagca      7620
     aaacttagat aatgttcaaa taaacacggc ggttattcaa ctgaatggga aagaagttac      7680
     tatcattcaa atagtagata aacaaggatt tccttacagt tggttaacca ttgccgaagg      7740
     gttagtcaaa gactcatcat ttagagagtt atggaatcaa accttagccg aaataccgtt      7800
     taattttcaa tggaaacccg ttcccataca tcctaaattt gctaaaactt atcctttttt      7860
     tgctgtttta gtaccttcat cttttcctcc atcaaatcct tcggcttacc gtaaatatct      7920
     caacaaacta tctaatgaag aattaattac aacctttcct aatttatcag gcgatgccct      7980
     tttattaatt cctaaagata caggcgatta tggtcatatt gcagattttt gtcgtaatgc      8040
     agatgataag ttaattcaaa ccttatggca atcgtttgga aaattaacct atcaagctat      8100
     tcttaatgaa gagattctat ggtgtaatac acatggtcat ggcgttcctt ggatgcacat      8160
     acgatttgat gaaaccttaa aatatgcagc gtttcctcct tatggaacca ttgatgaaac      8220
     atctcaaaaa gaatggtatg aaacgattta tttaaaagtt tttgaataac cattaatttt      8280
     tacttctgtg cgatagcgcc ggaacgtagt gaggaacttc tgttcgatag agccggagcg      8340
     gagcgaggaa cttcataaat gttgtcccaa accacaccac ccactgtaag caatagcgat      8400
     cgcatctact tgcgcgtctc gtttcaatgg gttaaggtag aacatttgtt cgagtatgtc      8460
     tgcaatatct tctctttcgg ctttaggatt atcaagatta cttttccaag tggcaggatt      8520
     taccatcaga ggaagacaac catgacgata agcgacgagg ttaagaacgc ctaacacttg      8580
     cagtaattta gcggttgatg ggaattcagg gttaataaag gtcttttcga tcgcaatctg      8640
     tgtcggttga tagtctttga taatctcttg taaatcagct tcaatttctg ctaatcgaca      8700
     aggtagcgga tcatcggaat tggttgaaat taagccaaaa tcaaccattt gggggtcttc      8760
     tgtggtttct ccttcaagga tagcccatcc taattgagag atactcggtt tgatgcctag      8820
     ccaacgaggg ggatgggaag ttgagggttt ttccgcactt tgatctaagg agatggcata      8880
     agcttttatc tcttcaacaa aacattcagg aactcgaatg gctttagtgg ggagatgatg      8940
     ccattgagtt cgatgagggt gaggtaatgg atgataattc ggcatgattg gagtgtacac      9000
     tcaaataaag ataaatagag tggttaacaa tatggatctt gattttttaa tggtttctgg      9060
     gttaatggga gacgttcccc ctgttgaccc caaccttaaa caatggttgc aacaacagac      9120
     gattacccaa gagagtccag ggcgtatttt tcaagattgg caaagtttct tagattttat      9180
     tggcactgat ggggcagaag taacaggaaa aaatgattat ttccctatga aacttttacc      9240
     cgaaattaat gcttgtctta gtcaaccaat tgatattgat ttgaaacgac ctcaacagaa      9300
     atcttatcct tatattcatg gactttattt actggtgaga ttattaggat tagcttctcc      9360
     tattcgagag ggaaaaaagt caaagttaat tatcaatcaa gacttattaa aaacttggca      9420
     gaagttaaac gtaactgaac agtatttaat tttattagaa gttgcgctct tttggctttc      9480
     aattgattat ggaagtgtgg cgacttttct ttcaacgttt aatacttgga tgagattgcc      9540
     tcaaaaaaaa gttaaaatca cgaaacaaaa tgcgggtaaa tataatttag attatctaga      9600
     aactgtcacc cattttgctc tttttgacct atttggtttg gttaaattgg aatcaggaaa      9660
     acccttacca gggaaaggat ggaatattac ggctattgaa aaaacgcctt ttggagaagc      9720
     gatgatgcaa gtcctcattc gctgttttat gagtcaagga agttcatttg tctctcatag      9780
     ggagaatcct ttgatctatg gagaattcca acccttatta caagagtatt ttcctgacta      9840
     tcaacataaa tttaccattc ctgaccccaa tgaatcaagg gaattaaccg atggtattta      9900
     tcaatttaaa gtctcattag ggagagcatg gcgacgcatt ctgctcaggg gcgattcgac      9960
     gttagacccc ttagctgata ctattttaaa tgcttttgac tttgataaag accatctcta     10020
     tcaatttatt tgtaaaaatc gtttagggaa ggaattttat attaatgaga gatttttaga     10080
     agaacccccc tatactgata aatttctagt caaagaatta cctttacaaa taggagatac     10140
     tatgattttc ctctttgatt ttggggataa ttggcaattt tctgttatgt tagaagggat     10200
     taatccccct gataaagact taaaaatacc gattattgaa gaaagtaagg gcaaggctcc     10260
     aatacaatat gaagagtggg atgaccatga atattaaaca tgagttaaaa aggataaaaa     10320
     ggggggttga tttatatatc aataaactga ctactgcctt cattgggtct agcgtgtaaa     10380
     tatttagaag taatggtcaa agatgaatgg ccaagcgatc gcatcaggac atcaatatca     10440
     caaccatttt ctaaactatg acaagcatga gcatgacgta accaatgagt agacgtatgt     10500
     tcattaattc ctgctttttc tgcggtcttt ttaacgatac gatgaagttg atgacggtct     10560
     aaccgattac caaaccgtgt ggtaaacacc gcctctgttt tctgtgaacg aggaagcttc     10620
     tttaactcct tccaaagatt atcactaatt aaaaccgtcc taactttacc ccctttccct     10680
     gtgatagtcg cttgtccccc ttgtttgcga ggtcgtaagt cacgccagtt gatactcagg     10740
     gcttctgttg cccttagtcc cgttgcataa atcaaagtta atattgtgcg atcgcgtccc     10800
     tccttggccg cttcaatgag tgcttttacc tccggctgtt ctaaaattct ttcgtgtaaa     10860
     gcattaaccg aactaggggc tttaaccgct ttggcgatat tcaggggtaa ataaccaatt     10920
     ttccaagcat aagagaataa actcttgata atggagattt tgagggcgat agaattttga     10980
     gaatagtctt tgatgaatag gagatcaacc catcgtgtca aatcttctaa gaggacatta     11040
     actaacggtt tttcaacgaa accgagaaat tggttaacgg tgcgagcgta agttttttgg     11100
     gtgccgaggc gtaacccact taaccacaat tggataactt gggtatcgtt atcaacctct     11160
     gtgatagggg gatgataagt atttaggggt gtcataggga acaactaaca caacgataga     11220
     aatgttttgt tgtatttctt tgaccttatt ctaatcccct ttgttcaatc tcaggtaatc     11280
     ggttaatatc gtgaagcgtg cagaagtggc caccttgctc tttttttaga tgaaaaatta     11340
     atgagaataa cattctacgt gaatcgtgtt cctgggaatc cattaaaagg aagaggatgg     11400
     attgatatca ggaatttgga agtagtcaaa cgtcttaata ttcccatgac aggagattgt     11460
     actaattctc atattcaaat taaggtaaag tgttcctcac cagagtatga aaagttcaga     11520
     caaaaaggtt atactcgttc aaagtcgaat ggaatttcag tgggaaaatt tgaagaagat     11580
     tatctaatgg ttacagttgc ttgtcataga ggaaaagctg gtggcaaaaa gtttcaggta     11640
     atcgaaaagc gagaaaatgt aagcttgata gtgcaaaaat ctttaaccat agaagcggta     11700
     aggttttggg cagaaacttg ggcaagtgaa ggagcttatt tagtaactcc aggaggaaaa     11760
     aagatagcca tcgaacaaaa taaagtaata gaaactgaat atgtgtattt gatatatagt     11820
     gaagttatga atgccataaa aataggacga gctaaaaacg tagaaaaaag atttacatct     11880
     ttgcaaacgg ctcatcccta tcctttaaaa attattaaaa ccttgaaagt gtctgggaaa     11940
     aaagctgcta tagatttaga aaaacagtta catcaacaat ttgctgatta taggttgtca     12000
     ggagaatggt tcaaagcttg tgaggcttta atgaattttt ctgatgataa aaatagctaa     12060
     aagatgctga aatgaccttt aattaaagaa aattaattga ggcttataat tcaattccga     12120
     atgtgatgga atgacgagat tttgtagcac aattttaact aaggaggggc ttaaaaaata     12180
     ttgattcgat gttatataat taataaaaag tcctgaaaaa gttatgagtc aatcagtagt     12240
     cgtccctgat gaattagggg aaataataac agctgttatt gaattttatc aagatgcagt     12300
     tgataagata gagccaaaaa tagtcttttt agaattaaga aagaatgtag tggactgggt     12360
     atcaagaact cagttaaaaa tagaagaaaa agaaattcaa gccactggat taacaagaca     12420
     acagcaaaca gcctataaag agatgattaa ttttattgag aatagttcag agcaatactt     12480
     taggttgagt ggatatgctg gcacaggaaa aagcttttta atggctaaag taattgaatg     12540
     gttaaaacaa gaagactata aatattcagt ggccgctcca actaataaag cagcgaagaa     12600
     cttaacccaa attgcccgta gtcaagggat aaaaatagaa gcgacaaccg tagctaaact     12660
     tttgaaacta caaccgacta tcgatgttga tacaggacaa caaagctttg aatttaactc     12720
     ggaaaaagag ttagaattaa aagactatga tgtaatcatt atagatgaat attctatgct     12780
     caataaagat aactttagag acttacaaca agcagtaaaa ggaggagaaa gtaagttcat     12840
     ttttgtgggg gatagttcac aattaccacc agtcaaagaa aaagaaccga ttgtagctaa     12900
     tcatcctgat ataagaaaaa gtgctaactt aactcaaatt gttagatacg atggtgaaat     12960
     agtaaaagta gcagaaagta tcagacgaaa tccacggtgg aatcatcaaa cttatccatt     13020
     tgaaacagtg gccgacggga caataataaa attgaataca gaggattggt tgcaacaggc     13080
     tttgagtcat tttgaaaaag aagattggtt gagtaatcca gattatgtaa ggatgataac     13140
     ctggagaaat aaaacagcag ataagtataa tcaagctatt cgtgaagctt tatatgggga     13200
     aaatgtagaa cagttagtag tgggcgatcg cctgatagca aagaaaccag tatttagaag     13260
     tttaccaggg ggtaaaaaga aagagaaaaa gataattctt aataattcag aagaatgcaa     13320
     agtaatagaa actcccaaaa ttaactataa cgaaaaatat aaatgggaat tttatcaagt     13380
     aaaggtaaga acagatgaag ggggaatgat tgagttaaga attctcactt ctgaatcaga     13440
     agaaaaaaga cagaaaaagt taaaagagtt agctaaacga gctagagaag aagaaaatta     13500
     tagtgagaaa aagaaacaat gggctattta ttatgaacta gatgagttat ttgataatat     13560
     ggcttatgct tatgccctga cttgtcataa agcacaagga agttccatcg ataatgtatt     13620
     tttattagta tcggatatgc actattgtcg agacaaaaca aaaatgattt atactggatt     13680
     aactagagct aaaaaatgtt gttatgtagg ttagttatga aaaaatttaa tgatgagaaa     13740
     cttatgagta aacaagaatt attagaacaa gaaaaactct tagaaatcga gagacaacat     13800
     cctgtttatc aaggtattat tagttatctt ttagaagaag cttttagcga agaaaaagag     13860
     cctcaatata tcaaaaaaga agaaatccat gaatggcttc tctctcttgt agatgaaaaa     13920
     gatgactaaa ttatcccctc gtcaaagaaa agtaactcgt cttcatagaa ttagccatat     13980
     attggacaaa gccatcccca ttccagggac acaatggaga ataggattag atcccatatt     14040
     aggattaata ccagggggtg gggacaccat agcaggtgta ttatcggctt atattgtttg     14100
     ggaatcagca agaatgggag taaaccgtaa ggtgattggg caaatggtgg ctaacgtatt     14160
     gttagattca ttggcaggtt cagtccccgt agtgggagat gtttttgatg taacctggaa     14220
     agctaatgta agaaatatcg aattattaga acatcatcta aactttactc ctgaaaacaa     14280
     gaaagttgac cgactttttt tgattggatt aagtatagtt ttaattctaa ttctcttggg     14340
     atttacactt ttaacattag ctttactaac gtggttatgg caaaatatta tgggtaataa     14400
     ctaaggtcgt aattctaaca aaaatgtcgt aagattagtg gggagaggca taaatagaaa     14460
     gccaagtaaa acatcatcct tcattatcta cgatattgtt accgtgcaga agttagccgg     14520
     ccatgcttcc cctgttacca cggcaaagta tgataggaga ggggaggcag ttaagagaaa     14580
     agcggtgcat aatttgggtt tttaagtgcc cgctcgcttc tttaggtaaa aacttgaaag     14640
     tatttaagga aaaataacaa tttctacggt ttctcctgct aaaatcagat taaaagttgc     14700
     tgactttttc acgaaagata ggggcgaatt ttttcaaccg ctactgtcag aatgttagcc     14760
     gctttctcaa tgtcttcatc agtggtaaat ttgccaactc caatgcgtaa ggctccttca     14820
     atcatctcat cagataactt taatgcacgc aatacatggg aaggagtagc gactcccgat     14880
     gaacaggctg cacccgtaga aatggctaat tgatggcgaa ctctggcgat aatagcacta     14940
     ttaggaatcc ctggtagaga aatatgaaga ttacctgcaa ggcgagcgtt tatgtttccg     15000
     ttaacctgta aatcagggat ttgcgcttgt aataaggttt gtaagcgatc tcgttgccta     15060
     gcaatctgct gttcatcttg ctccatttct aattgacgca gacgacaagc ttcccctaat     15120
     cccacaatac cagggacatt gagggttcct gaacgcagtc ctttttgatg gccaccccca     15180
     aagataatgg gttcgagagg atagcctttt ctcacaacta atgcgccaac gcccttgggt     15240
     ccataaagtt tatgggcaga aatagccagg taagtaatgc cccagtcgtt gaaattgata     15300
     ggaattttac ccacagcttg ggaggcatca caaaggaaag gaatatcgta ttggtgggcg     15360
     atctgaccaa ttttttcaat ggggtaaata ttgccgatct cattgttggc tgccataaca     15420
     cagagaaggg atagtccatc agcacaggta ttttccagat tttctaaatc taatcgtcca     15480
     aaaccatcaa ctttgaggta aatgagttca gcttgtcctt ttttggcgag catttgaatg     15540
     gtgtctaaaa cggctttatg ttccacggga gaaacggcga tgcgggggag tttaggggaa     15600
     ttgatggctt gaatatgacc aataatggcg agattaatgc tttccgttgc accagaggtg     15660
     aagataatgt ctttggggga agccttaatc agttgggcga ttgcttgacg ggcgttgtaa     15720
     actgcttttt cagcttcatc gccgtaggtg tggtcaatgc tgctggcgtt accgaaggct     15780
     gtagttaagt aataaaccat taattcagcc actctggggt caacgggggt ggttgaatgg     15840
     tagtcaaggt aaatgggttg aattgtcata gattttgact taaatcctgt ttaattgctt     15900
     cagcaactaa ggaaaattct tcattcgata agaatggcac ttgagtatat attaaatctg     15960
     attcccctgg tagtcttgcg gctaaatgtc ctttgcctag aagacattct cctccttttt     16020
     gtcccaagga aatttcggaa gttcctacac tctcaactct taagattaag cgattgccta     16080
     agttatctcg aagctgcatg ggaaagacat tattatcggg acgttgtgct gcaaagatta     16140
     gatgaattcc ggctgctctt gctttaactc ctaagcgttg tacagcagaa gatacagcat     16200
     ttttatattc ttctactaac atccaatcag caaattcatc atgaactaaa agaagaacag     16260
     gcaattgttt ttcagcagaa actttttgat tataaaccaa taaattattg actttttgtt     16320
     ctctaaatag ttgataacga gaatccattt cgctaacaat tttttcaaat acttcaatgc     16380
     cttgatattg ttcagtaatg attccttctg ttaaatgggg taagtcttct aaggggaaat     16440
     aatcggttcc ttgtttagca tcaattaagt aaatttttac caattctgga gaattagtag     16500
     cgcagacatc taagagaaga tttcttaata agactgattt accgcttccc gttgctccgg     16560
     caattaaagt atgaggggcg tgctgttgaa gatgagcaaa ttcttctcct aaattaagat     16620
     atagtaattc tccatcaatt tctttgactc caatgatgaa actaagatta actcctgctt     16680
     ttagattaat ttctcgttgc ttccatactt gagaaaggga aataatttct cgttggggac     16740
     gagcgataga aacgataatt tccccaggcg cacctaagat attgatgaca tttaacccat     16800
     gagttgttaa tagacttgaa cgacgagttt caatatcttt aatattaaga cgatctgagc     16860
     ctttaaaacg aattaaagca gcattagggg ttaatctttg tcctaatact ttagcttgta     16920
     aatcatagct aattagagct tttcgtagtg ttgaaacggt tgtttctaac catttttttt     16980
     cttgttgctc attgatttta gattcagttt gttgattaat ccatgtcgct aaagcaggac     17040
     tagcccaagt tgtttgtgtt atattattaa cttctttctt ttcctcattt ttgttctgat     17100
     ttgtataatt taattgattt aagtggttac tttgactatt ataatcagaa actccattac     17160
     tattttgttg ggaattaaag tcgttaatag gatggttatc attagcagcc ttattaggag     17220
     tttttaacga atttatgctg tgactaggat gaatattttg aggagaagta acaagggatt     17280
     gcttttggtt tgaattaatt gttgttagat tctcgttttg caatgtcctg ttgactattg     17340
     tttcagtaga ttctgtactt aaactttcta tatatgctat tttttctgat gaagctgaat     17400
     catcaagaat tggtaattct aaaataggat ttacccaaac cactctatca gctggaaatc     17460
     ttggttctga aactgtccaa ggttgttcat ttcctaattt ttctcgaata gatgctaagg     17520
     gttgttggtg atgaatagct aatactaatt gacgaacagt ttctcgatta aatatttctt     17580
     gataacatct atctacttta gcaattggta tttgatcgtt actaacagag gtatcgctag     17640
     gtccagagat aaacacatga gaataccctg ataaatcaag gggaatcgtg ccgtctctaa     17700
     caccttttcg ccattcttca atggaaattg aatcagttga attaaattca attccatcta     17760
     ataataaatc tcctaaacga gataaccata aatctcggtc aagtcgccct ggacttacaa     17820
     ataaagcatt agccattcgt tcaacggtat ctcttaattg atgttgagaa cttttacggg     17880
     catcatttaa tccatttgct tcaatatatt tagcttcaga aataattatt ttaagaacag     17940
     gttgctcatt ttttatttga ggactgatag ctaaaatatc agcaattctt ccttcttttt     18000
     gtcctaacca actagcatag tcatctaaaa aataccaacc aacaggatgt tcttctccta     18060
     attcagataa taataaagct ttacttaata ccactcccat taattcactg gcatatttac     18120
     cactttttgc ggctcgtaat ataatatccc ctgaaatgtc tttagcttgc tcaataaact     18180
     gttctgctaa cgttttgata gtggtttcat ctaagtctaa atttaagctt tctaaacggc     18240
     gtttgacaag gacttgtaac aggttcaaag gagcattaga agatactaaa aaattacggt     18300
     catcgctgcg actttgttga tagcgaatga cattaacacc ttgattgatt aattgtcgtc     18360
     tttcgagtaa atcatcataa ttaacgaccc attctcctag acgatgaact tctttaaata     18420
     ctgtgctagt gtcttcatct tggaaggaaa tctgtcttgc aggaagaaaa tgctgatttt     18480
     tggcacaatc taaatctacc cgttttaaac tactataaat ggcatctaga taagtttgtc     18540
     ctacagatgg ttgactcgga cagactaaat aaaccgtcga ttttaattcg tctttagcag     18600
     caggacgttt tcttgagtag cgtgtgggaa cgtgcttgag aatatcgggg ttatcgttag     18660
     ataaaggggt cggttgccaa actatttctg cttgtctgga aataatatct tgaagaaaga     18720
     caatatcagc gatttttccg ttagatgaag atgatgtgtt cgacatgacg ctgattcgca     18780
     gtctggccat aaaatcgtga gtcccttcac tagcgacaaa agcatctgca tcggtttgag     18840
     aactttctat gagttgctga tacaaatcac ttaatttggg ggaatctcga tgacataaaa     18900
     tgacttgaca acgagcttca ttatagttgt cttgtaattc acttagtttt gtaataactg     18960
     tttggggaag tctagtggag tcacattgat aaagaatgat actcaaattt gtttgttcat     19020
     gggggagtaa ttcgaggtat cgcttcatta agtctagcag tttattggct gcctttttgg     19080
     ggtcttcatt ggtagactgt tgagttatat cttttattgg ttgttcaagg agactgtaat     19140
     cattgactgt atcagacaga taaagtaata aaggttcatt ccctttataa cctaaacaaa     19200
     cttcgggata ataagggtga gtgagttcat ttcttaaatc agagaagaat aaacgggaat     19260
     ctccaaaatt aacgtcttct gttgaaagaa tatgtttcag taatcctgaa atttggcggg     19320
     ctttaatgct caaagaggct aatcttaagg gatgccaagg cgtaataata gcagcaggtt     19380
     ttcctcgttt gacttccaca caccctaagc gtaaaatagg ttcaattaat tccactcgat     19440
     tagtatcacc cagggcatga ttaaggagag ttttaagaag ttcttgatag tcatcgcatt     19500
     ggtggattaa aacaggatgg gaaatccctt cttgacttaa ccaactattc agggcttttg     19560
     tataagtttc tttaaatttt ccccaagctt gtttaattat ttctgcggat tctgaagata     19620
     agcgattatc ttgaactgcc tgtttaagag ccgtaggaaa cagtttagct aagtcttgtt     19680
     ttcggtcata tttactgact aaagagcctc tatcttgtcg ataagcagcc attaaagtac     19740
     cgacatcatc cagagaaatt ccttgaagac gacctttttt gctgactaat tcccgtgata     19800
     cttcagagat aagaaaagga gaggggttgg aattaactaa ccggtttaag tcatcatgaa     19860
     gttccattcc aatactattg ggatttacct tccaaattaa ttgaattttg ctgattaatt     19920
     cttgagaaaa acaagaacga agttctacat aaaatttgat ttcacaagcg gctttagcta     19980
     cagaaacatt ttttttatat tttttcttat ttttcgtttg ttcatctttt aataattcat     20040
     catatttaaa cagccagtga gtctcccaag taatttcagg ataggttaac tgttcaatcc     20100
     ctctatacct tgtacaaaaa tataatccca tgtctgcatt gagttctaac catttacttt     20160
     tacgggaact tttttgagtt ttaataatta attgagtcgg attttcttga gaatcagctt     20220
     ggtcaaagag tcgctcaaag gcttgaacta aacccactaa aaagtcagtg cattcgatgg     20280
     gttgaccgta gacaaattta tcccatttgg ttttgagagt acggtcattt tctaattcag     20340
     accgatggtt atcataaaat tctttgtctt cttcgttagc ttctttggct tttcttttct     20400
     ttaatgtttc tagatagtct aattcagatt cggttaaact atcagggtat tcatcttcat     20460
     aaaattgttg ggttaaacta tataagtcgg ttttttttgt ttttaatcca ctaaaaatag     20520
     cgtgaatatt atctatttcc cattcaaatt tagttaaagc tttcccttgt tcattccatt     20580
     ccggcggact tttaatgaag gcttgaataa tagaatgggc ttgctcagga atgtcttctt     20640
     taaccttttc aaaggtcgat tgtaactcac tttcttcaat gggtttacgg gtaggggttt     20700
     gtttgagtaa cagacaagcc cgtttagaaa ccgcctgttg atacttttgt tgccactttt     20760
     gggcgtgtcc ccaagttttt tggggtatgg cttcaaaata ccccgaatca cggggtaaac     20820
     gtaaggcagg taaagcccat cccaaggcat taatgatagg aacactttct gaggcgatgc     20880
     gctcacgagt atccatgaca tagttcgcaa attgctctaa actgcattcg ctggctgcaa     20940
     gtagtccttt taacgctttg ttccagtatt ttaattgttc atcaggtaaa tctaagccct     21000
     cactggccac gtctacccaa atttcaattt gttcttttaa gagtcctgca cccaaggcag     21060
     aaatatcttt taaagattgt ccttggtcat cgttagtatt agctaatagc agacaagggc     21120
     ggtcacaggg agcatggcgt aggtgaacgg tcttttcatc ggttaaaata gcttcaggaa     21180
     ggtcatatcc tgccactaga gtgcgaggaa tttggatttt aatgtgggga gataagtcag     21240
     gggtagcgag aatagactga caaatgttcg tgacttgttc tcctgttaaa cggtctaaga     21300
     taaaccgagc aactccgtct gaatcctctg tatttaggga ttctctgaga aattttgtcg     21360
     ctacttggcc aattaaatca atagaatcca tttaagtttt ctccacagtg taaggattaa     21420
     ggacataagc acaagcatcg gaaaggcgtt tgagtaaccc caaggatgcg aggcgttgtt     21480
     cgagacgttc tgcattatca gaaaaagctt caaggtctgc ttctttgcgc tgaatgatgt     21540
     caatggcttg tttttcacca attatgaagc catatttttg atagagtgtg tctaaaaatt     21600
     cttgaaattc catccgtttt gggacacaac aaagtaccaa ggtttttaat agggagtcgg     21660
     tgggtgcata tcgggtgcga cgacttcccc tgctcgaagc gagtccaatt tcttttgtcc     21720
     acttactatg aaattgacca acgtgctgtt tatgtctagt aattgctgag agacgaattt     21780
     cttctaatag ttcatcggga gaattacatt tgatttcatc ctttttatag taaatttctt     21840
     ctttgataat ttctaaggca tcttctatgg agttggcaga gttaagacag gtttgccatt     21900
     ctggaagttg agacagtctt tttatatagt gttcaaccgc tcgtttactc aggttattat     21960
     tgtttaaaaa ggcatcggaa gctaggtcac gaataatcgt ttttttggga gcaattattt     22020
     ctaaaattaa ttgaggttta tcttgactat tcaaggtggt tgttgagttc aatgaatctt     22080
     cattggtatt agctatagtt tctgacttaa ataatagatt ttgttgacta tttaagagac     22140
     tttctgagga gaatctaggg tcatcttcat tatttaagac ggccttagct cgtttgagta     22200
     ggtaaatgac taaatggact cctgtaatag taactaaatg gggtaaagaa tcatagtcag     22260
     gaagatggca attaaataga tttatccaat cattagctaa gttttcaaat tcatcaagat     22320
     gttcataggg aagataggga ggactgctat cttttcctct tggttttgta tcagaatgat     22380
     cattaggttg aagggtagca actaatttat tccatttact cgattgttta tgatctatta     22440
     ttcctaattt ttttagatgg gttaaaatgt ctaattttaa agaactacga ctaatcatga     22500
     gataaagtaa ttctccattt ctggcaaaaa aacgacggtc attgctataa ctattcttac     22560
     taattcttaa atcctcataa agacaattaa ccccataggg aaagacaaat ttagaagtcc     22620
     aacgtttatt actatcacct tcaatggcat tagattgaag aaatcttacc acttctagaa     22680
     agtcccgaaa ccttataaag cgttcttgta aataactaaa gttaggggtg ttaatacctc     22740
     cacaattatc attcattaaa gttaaccatt gttgccaacg ttcttcttct gttggatatt     22800
     ctgcataaac tgcttctaga aaaggattat taaacaggat atttcgtaaa taaagacgac     22860
     tataagaggg atattctaat tgatgatttt caggttcaat aaaagcttgc tctctttcta     22920
     attgtgtttg aacaatgcct aaaaattcta gaagggttaa ccaaggggtt tgttcatcat     22980
     aaagacgatg accccaaata gcttcatcaa cccacatttc agtttctcta tgggttttat     23040
     tatgagatgt aggtttagga agacgtttta ttatcataat tgaatctcca aggttctttc     23100
     attagctatt ccatcggcat taagttctag taaacgaata atcatctctg aagcttcagt     23160
     ttcgtcggct tcttcttctt tttgtcttct aatattaagt tgtcctaaca gtcgagtttt     23220
     aaaagctaac atatcctcat aacattcttg agaaaagtta ctgggtaatg ctccttctgc     23280
     aactctgttt aggtattcat agcgagttaa atttaatcgg agttttatag ggtcaacttc     23340
     agggtgggaa gatagagaaa taataaaatc gggagtatta tggtcagtat ttaattcaac     23400
     tgtgacactt tcacctcgtt ttttaataac agaaatatat tcttcaaaga ctcgactaat     23460
     cttggcttga gaataactac cagatgttgc taaaactaat tgatcttgat tatttatcaa     23520
     taatccggta aagatacgat tgattccttt aactatttta aaaatgagat atttaggaat     23580
     ggtttgattt tgttttaatg gtctacagac ttgttctaaa tagtctcctg catactgaaa     23640
     agctgttaat tcccatagtt ttaactctgc tactctatgc tgaggaatag taaagaataa     23700
     tcgctgtctt tgtgtgtgaa gtatatttaa gaattcttct ttactgtctt gagaatcatt     23760
     gctttctaaa tagctttttt gagcaatacg aaattgttga tgtgcgccat aaaaagtatc     23820
     tgttaagact aagttttcat aatcttgttt taagtccggg tcatcttctc caaaaataag     23880
     aatattatca atatagttac tgctttctgt accaattcca aaatatctta aagcaacaaa     23940
     gacatcagtt ttatttcgtt ttctgctaga aagattttct ccaaatagat tactataagg     24000
     actagctaaa taacctgttt tttgagttgt aattttagga atttggttac agttaagtaa     24060
     tttatctttg acatcaggat gtcctaagat aatattagaa ataaggagaa gtaattgacg     24120
     aataggaaga tgggttcctt tatgacgaga taattcgaga aggtcaataa ttcgctgtct     24180
     cattaactgt tggtcatttt ttccatcgag tctggttttg ttttcccaaa tgggacagcg     24240
     ttgctgacta tctgtaggag tttgataggg acattgacta cattcttccc aaccaggatg     24300
     atttaaaact gcatcaagaa tgcgagaaaa gatttcttcg ttatttaagc gacttaggtt     24360
     ataaagaagt aggttaaact caggattttc tcttttttct tctaccaata aggtttcaat     24420
     taattgacgt gctttttcta tttgaggagt gttttctgca acgttccatg cttcgatgag     24480
     ttgtccatca ttagcagcaa ttaagtaaac tttatcggta tgataggggt tgatgatccc     24540
     ttctgctatt tgaggtaata gttgggtttt ttcttcgtct tgaatggcac tgaggtcttt     24600
     tataataatt agagtttttt gtaagagtgg tagtttatat atttcttgat tggtttccca     24660
     ctcttctttt gaccctccta atttttccca aatttctcga cagcagaatg tttttccatc     24720
     tcctgctgtt ccggtgagaa tcaccgattt agggaagtca gattgaaagt tatcgattaa     24780
     ttcttgtagg taaggagttt caaaacagat gggttgaatt ttgtttttct ttaatgctcg     24840
     ttgaattgcc tcatcataca tattatcatt acgaggaatt ggcccatatt gacggagaaa     24900
     ggtaatccat tttgattttt tgaaagtaga attataattc ataattagag taattaaact     24960
     taaatatata taaccaatca caatttatga tttaacactt ttattaagat gtatctttcc     25020
     tttgtgacca aattagtaaa gctagttctt ctaattcagc tatttttaat gaatcagtta     25080
     cacaaaataa atcaatattt ccaccaactt cttgctgaag tttagatttt agagtcttta     25140
     agactgattt tccataacga tatctctcac aatcttggtc atacatttga taacagtttg     25200
     aagctatttg tccattattg attcttccgt tacctttttg acgagattgt tgtaattcta     25260
     tgtctgtccg actatttata aacttttctt tcgatttttc agatttttca gcagtggaat     25320
     tactgataag ctcttgtatc ctatctgttg ttaattgtgg atataaagat tggatatgtc     25380
     caagattaat aaaatgagat tctgcatctg ttccagttgt taaaaagcac aatatatttg     25440
     ctcgttcaat tttttctcta aaatcgtttg cttcatcatc cgttaaataa tctctatctc     25500
     tatgtaataa tattttagtt tgagaactat gttttcggat aaaagcagct aaaactaatg     25560
     ctgtttcaac tttagtacat cctttatatg accaaatatc aacttcatcc attctaaacc     25620
     ctgatgcttc tagcaatgtt tcaataggtt tagtgtcttc atcttcagtt aataaaacac     25680
     atttaatatt ttcagtattt aataataatt catctttatc taaagctcca atatctagta     25740
     aaagttgaac agtatcaaaa tctttttcat ttataattgt tccattcttt aaccaatata     25800
     tttttgtctt ttctcgtaac gcatcaagga gatgtcttga atgagtagtt actataattt     25860
     gtaaatcgcg ttcttcagtc aatttgatta gcattttagc taattttcgt tggttatttg     25920
     gatgtaaatg cgaatcgggt tcatctaaaa gtaatatttg aggtttataa atattaatat     25980
     aagatataat ttgtatcgct tgtaaaaccc ctgtaccagc taaatctatt ggtaaactat     26040
     tttcatcatt ggcttgaatt tgacaattaa tataatcatc acgttctgga ttaaactcaa     26100
     caataacttt taagtcagga aataaataat taaagtctga tataaattgt ttccattgtt     26160
     ctgattcatt gtgaagaagg taaagaacat ttcggaatac tttattggca tctcctctag     26220
     cagctgcctt tctaacaatc cctggagttt tacattcttc tacgtcagga ataccagcta     26280
     gtccagggac ataaatacta tatggtgttt ctatgatttg tagtctttct cctaattctt     26340
     ttccttctac tgtaatcgat aaatttctat ttctcccttt tctcactgta acaagaacat     26400
     tttgtttttc ttgattttct tcaaaagaaa tgataattgc ttgatcttta ttttcaacca     26460
     gtttacctcc ataggccaac gcataaacat ctctaagagg cgcatagatt agctgctgag     26520
     gggataatga agttgataat ttttcatcct tccaatttac attactctga agactagctg     26580
     tttgaccaac agatacagca aattgtatag cttgtagaat gctacttttt ccagaattat     26640
     ttgaacctac caaaatatta actctatcaa ggtctaaagt taaattttct aaattcttga     26700
     atctttgtat agttattttg ccaagcataa aatttcatga gatcaataat aacagtgatt     26760
     acaaatgaca cactaaacaa ggcaaatcat catcctcctc atctaaaacc acctctaacg     26820
     cttcggataa aggtcgatta ggggctgctt ttttctcacg ggcgatcgcc ttctcatgat     26880
     tagcgataat ctcctctttg cgttccaaaa gttctagtaa cgtttctcct tccgtccagg     26940
     tgtaagttct gccatccctg tgattagatt catattccac cgccttcgca aacaaatcag     27000
     gatgttcttg ggctaacatc acccattcat atttgcgttg gaagaaacaa aagaaacagc     27060
     ccgaacgact tcgccagcga taataatctg gcaaaccaat cccactatcc tctaataaac     27120
     ggataatatc ggcttttact aatcctcgtt ccttaaacgg aaaaacaggc ttaatattgg     27180
     gcttagtaga gatgtaaccc tctcgatttt catccgcacg aatgccaata tagctaatag     27240
     cctcatcctc acccacaaac tcctctaacg gcttaatctt catttttacc gtacaccagc     27300
     gcatttttgg agaaggtaat agaccatcgt gcatcgttaa ccagtggtca aaccctcggt     27360
     tttcactgag ataatggatt gtgataccta gacgggcttt aatgcggtca agatactcat     27420
     aggtttcagg gagttctttg tgagtgtcac agaagaaata ctccatatct gggatttcct     27480
     tgtgcagtag taccgccaaa gctgtgctat ccttgcctcc tgagagtccc agtatgtgcc     27540
     ttattttctt ttgtgccatt acgtcctaaa ttctcctggg ctatgatttt agcgttccca     27600
     ataatctgat ccaagtaaca tctttaccga aaaattagtt gaaatgaaag tatttagtaa     27660
     aaacttttac attcaagagg ggatagaaag aacattacaa atttctcgtc cttggatagt     27720
     tgttgttttg aggggagaaa acccattttc ttcccactga tatggagtaa tgtcaattac     27780
     gttagaacca actaggaaat ttccacaatt tatttttcct gtattagctc gattagatgt     27840
     atagagaaca aagccacttc cataaggtct tatttcaata aagttcatcg ttgaaaaaat     27900
     gggtttaatt tttcttgatt gactttcaaa aatgtaggca tgggttgaaa tcccacttcc     27960
     acctccactt gacagtaaaa ctactaaagc atcttctttg gaatcatcat taaagtctct     28020
     gtactgaact ttatctaatg aaacataacc ccaatcatca tcttgatact gaccttgttt     28080
     gagggttata tttccagaag gtcccattcc tccttctctt atttggtaag taaaattatt     28140
     aaaatctatt tgcctaatta tttcttcggc atagctaggt ggtacaagta aaaatcctag     28200
     ggaaaaagag gttattaatc cagttaacaa ttgattgttt ttcataactt tgcccattaa     28260
     taattaagtt tgactttgca acgaaatgct attaagacta aaagtaaaaa gcttagccct     28320
     tattgattta ataatgtgat tctactcaag aaattagtta agtcttgtag ttcaacttca     28380
     cagtcacatc taattgagac ttctagtagt tttgatttat ctggaatggt tcctaaaaaa     28440
     gtcatactat aaccactctc agaaactata atatagccag gatttctact atttttataa     28500
     aaaaaatatg ttttcaagtc accatgataa atatctaaaa ttagttcctt taaaccttct     28560
     gactggttat tttcaattaa tctaatactt tcggaataac gacctgtatg atattgggct     28620
     ataccaccat tggctataca ttcaagaaat tggtaatcat taggatgaag aatttctaca     28680
     gaacggtctt gtttcagcat aactctatag ttttcaggaa tatcaacact tattccaaaa     28740
     ccttcaaggt ttagtcttct ataagtagga gaaggagatt cataattgcc atcaatttca     28800
     catagcacct cagcaaaact tggttgagat aaaaaagaga cgaataagct aatagaagaa     28860
     aataaggtaa taattgataa aaatttcata atagccttac attgatgatt ttaaaaatag     28920
     gaacactaaa aaattagaag gttatagagt tttagagagt aaagttacat taggtaacat     28980
     acatttcaag acttgtaacc ctggctctcc tggatatata tgtattccta atacttgctt     29040
     tcctggtata tctatatagt aagcagcacc atcacctagt tcaattaagt atccagatcg     29100
     taagtttccc aatgaatcta atattttatg ctctttcata tagccaagag aatctctatt     29160
     ttgatgagca tgatttaaaa tttcttctaa agatgtttgt tcaaagaata tatagatgtt     29220
     aggataatct cctagataat ctgcacggga atcattcggt ttctgaagaa cctcgaatac     29280
     atcttgtctg ataatatcaa ctctctttaa tccattgaga ccactcattg ctctatagtt     29340
     ggttggaata ttgctaattt taatgccaaa atcttccaaa acgatagtac ggttagttgt     29400
     agctgctggt gtcccataaa agttggacaa attacattta tcttttccat ttatcttgac     29460
     actgttagga agaaattgag cagaggtttg ctcaaaataa cctaatgtag tagacaaaaa     29520
     ggttaatata aacactagaa aatacaaatt gcaccgtttc ataacttgtc cttaccctca     29580
     ttaattagtc tggaaaataa tttttaagtg gatcgtagtc aaaaggaagc ttattccagt     29640
     tccaataaaa gtcccaatca cctggaaatt gttcatcttt gtaatgaatt cgactaaaac     29700
     catctcgacg catcgtccaa tcagaccaag ttggcccaga aaacgaaacg agggctactt     29760
     gtggacaaaa gggtgcaaga cgttgagcta tttgtagcat caccctttct ctttctccag     29820
     aaccaaactc tcctgaaagg gcagaaaaac caattgaata gttaccctta taatctctag     29880
     cgacatctac agaggttttc tcgaaatgtt cacgagtcgg ttgatatcgt cttatttgat     29940
     taaagacttc agatgtaatg gtacgacatt catcggaaag cacttctatt gataaatttc     30000
     tttgagctaa agaaggagac acatcaatga taattggcag ggttatcaaa gcggtactta     30060
     gaaactgttt gaatgacaaa aatagaaatt tatgtctaaa gaaattcttc attttttaaa     30120
     ttcttaaagg tgggtatcta taacgatttt gtgtccgtaa tcaactctaa ctgttaattt     30180
     cacttgggtt tttgaattcc aaaaatcaat ataacaacca gaccatccat ttccacaagt     30240
     taaacagggg gcattactct cacagatgtt ttgattgctt gctgaaacag ctgtttcctc     30300
     ttgcgtgact atcctaaaac cattggtata taaaagttgt ttagcttgtg ataaattcat     30360
     tcctgccttc aggtaattag gatgtaagtt attgcaaaga tacctattaa gaagcgtgct     30420
     atggtaagga ttcaaaacat aataatcaaa ctggtcaggt ggtacattta gctcattaac     30480
     aaattctcct tcgtaataag ttttaaaagc ctttgcctga ataactttaa cttgtttatt     30540
     agtaaaattt ttggactgac aactatctat tctttttcct ttgacagcta aagattgttg     30600
     ttttttgtct gaatcataga aaaagtaagc aaactccgaa gtaacagaat tgtcagtttt     30660
     ttgaagacta tttttgttga tttctatcct cacattagga tgaccaacac taatccattg     30720
     agaccctaaa taactattcg tttgagccga tagctccata gcactagagc tagacaggac     30780
     agcagcaatt gttaacgaca gaaaagagcg cattgggtaa tttctctcca ttgagatgag     30840
     actcaggaaa aagagtgaat agtttcactc agttataaag ttcccaaaac aacactagaa     30900
     ctcttcaaaa tctagtccaa ttcacttaaa tcgtttaacg ggccaccttt ttagacttac     30960
     ccttttgaga tgaggctttc tcttgaagca aacttactcc ttcaagagaa ttagtattta     31020
     acaccctttc tgttaatttc gctaacacag cttgacgaat ttgctcatta tctggcagaa     31080
     tatctaaaat ttgctgaacg tatttctcta ctttgtcttc attactatta tctacccaaa     31140
     ccatccgatg ggtttcctcc ccatcaggac gagtaaccgt aatacgtcgt gcttcaaacc     31200
     cgtccccctt agcggccact tctttctgca acgcctctaa attcttaaac cgtctagcaa     31260
     tatccgataa cttaacctca aaccccgtga catccttatc tgtccaagac tcagggggtt     31320
     tatcggagat caccatcacc actgcttcta accattctga atcagattta tcctcatcag     31380
     tggcaacttg gacaaaactg cgtaaattcc gttctacaca ctgccctgct aaataactcg     31440
     cccttactcg caaatcttcc cgcagttgct tctcctgact gcgtacccca aatgcttcat     31500
     agagtaactt ttgacagtcg gttaacaggg tttcataggc cgtattaatt tcccgtaacg     31560
     cctgaactaa gcgagtccgc agggttttag caatggttcc atcctctgct tcttcggttc     31620
     caatggggtc taacccacaa gcaacaggaa gactggtaaa gatcagttca tcgggttcaa     31680
     cggttgtctg taatgctttg agtaccccta atgcttcttt accgagtcgt tgggtttgtt     31740
     tcgtatatga gggaagtttt ttgacaaatt gatagagagg agtcactaca gttagtaagg     31800
     tagcatttcg tagtttacct gcttttttca gcttaggatt gcgtaaaatg gactctaatt     31860
     ctttaaatac ctctgaccgt aaccccacca cttcaaaata tttcaccgca aagcgagacg     31920
     gatctttaac caataattca aagtgttctg cccctaaaat ggcaataaaa gtcccgtctt     31980
     gatataaccc cacatcatca atatgattga gaatgacggc cgcaattaag acaggaatcg     32040
     ccccctgttt gatgccatag ggcggttctg ctaatttttg gtagagttga tctaaagtgt     32100
     gaggcgtatc ataagcattc aaacaaaaat cttctacagc ttcccaaaac gaaaaaattc     32160
     ccgatgtagt ttcaggggga taaaaatccc agtcttcttc aatgatttca gatatatcag     32220
     gagtattaat tagtttctcc tcaacggtta cagatatttc agaggagtca acccgttctt     32280
     cattccctgt gtctgtcact aatttttctt cagttatcgc aaccgtttga ccatgaattc     32340
     tcgtttcttc taatagagaa taatacatac tgacttcagg gccgtaacca gataacccta     32400
     acctgggttt tgatgactgt tctatcatgg cagttattaa ttcccgtctc gcttttgtac     32460
     cttgggaagt taagtctcga cggttaatta attcattcca aagaatcggc gttttgtgat     32520
     agacttcatc gcagacatgg gataaggttg cattgaagtc ggcaatagaa ttaagtttct     32580
     tttcctcccc ttgcacccaa caacggttat gattaagggc aaggtcaaac gcttgggtta     32640
     atatttcatc aagcaatctt tctgcttcag tcacccgata acgcacttct cttctagcga     32700
     ctccatcgct ttgtaattca gatgcagagg tttgaatttg ttttaaggca gcatattctc     32760
     tggtacgaat tcgtagtaaa tctaattttg ccgcacaaat taaaatgaag ggtttaccat     32820
     ccactgtggt agcaggaatt tgtggcggaa tttcctcatc taaccaatag ccaattaagc     32880
     catcactatc ggcattttct aactgtaatt gttcttgtaa aactttaaat ttatcatctt     32940
     cccctttcgt ttctaatccc ttgctattgg aatcaaaata cagtttgctg tccaaataac     33000
     gtcgctcaaa gtatcgtaaa gtacctgttt tataactatg acgctgggca atttgaggat     33060
     tgaaaggacg cagagaagaa agtaaattaa ctaaagattc tcgttgttgg tcaataaaaa     33120
     catttaactc actatctaca ttaaaatctg acccttgcca aattcttaat tcatctaatt     33180
     gacgacgatg agtaataata tttttttgta gcaagtcatc aataatactg ccccaatact     33240
     ctaattgttc actatcatga ggactatcac acatggctaa ggtgactaat tcacgggttg     33300
     cgcggtttgc ccctgttgtg gtaattaagt ttaaaattcc aattgctttt aagactcgta     33360
     aactatcatt ttctaaacgt ttcgcatcag caattaagtc ttgaatttcc acccatcgct     33420
     gcaaattagg acgggacgct aaccccattc ccgcagcttc aataaaatag tcatacacac     33480
     ggtcaagttt tagggtggga aaagggttaa tataatctgt ttgagatttt tgtgtagttg     33540
     gcttttctga gttctctatt gtattatttt ttatgcttgt ttcttccaga aaaatcctaa     33600
     aggaataggg ttcattactg gtaagaaagg taaataaaga tcggtcattt tgggcgtaac     33660
     gttgacaaag agtaggtaat gctaaagcag ttactggatg aagaggataa atattttcta     33720
     aaatgtctag ggttatttct tccccttgaa tagcagtttt taagcgacta aaccattccg     33780
     aagctgtatt atggatagca cattctaagg gttctgcttg agtttgatca atcgcttgtc     33840
     ccattaagcg catcatagaa gatgctgact cagtaaaggg aatgtcttca aagcgtcctt     33900
     gaattttagc ccattcgttg cgttgaacgg cggctaaacg ttgactatat tcggcaaaag     33960
     cttggtgtaa aattcctaat aaatagacag gggttgcagt atttttggga agttcggcca     34020
     gttgttgtaa taagtataaa tcctctgccc cttggttata agctgcatat tcaagggctt     34080
     tgcccaattc gtcaatgatt aagaaaatcc ctgtttttga ggctgtggct agttcttgga     34140
     cgagttcaac aatttttcta ctatctattg cttcttctga tgcgagttca gtttctaaat     34200
     cagtcaattt agcaatagca ggaattttat tctgttgtgc aggtttccag taagtttcta     34260
     cacctcggct taaggcacga ataatagtat gactgatggg ttctcgttgt cctgtagcga     34320
     cggcacgaat atagcctttt tcgggaataa cttggcttat agtttgatag tctaggcttt     34380
     ccttccccaa ggtatttcta gcaatttcta gggctttttt tcgtagctta cttttattat     34440
     ctgctaataa agcggttaaa taatgagcaa aagccgattt tccggttcca tagacgctgg     34500
     ttaatgtcca agctcgattg ccttctggtg cggcaattcc gcttgaaata cgtcgtaggg     34560
     ttgtaataga acgatccgtt aggacgtaac cttctaaagc ttcaaattgc tcactgtccc     34620
     gttctaaatt gacggaacgg gagtaacgac gcttgagagt aatgtactgg gagaggggtt     34680
     ggatcatatt aattttgagg caccatcctc tatcttagag tgcttctcca acaatgtgta     34740
     aaacttcttt atataatttt tcttctatcc aaaatcctgt ttcttggatt aagctatcaa     34800
     gtaagggttt tacagactca attaagtttc tctgtttggc agctattaaa atgcctaaga     34860
     ctccaataat tgatagtcct gattgagtgg caatttttct tcttaatctt tcatcaataa     34920
     tcatcgacaa tcataacttt ataaggtttg taaatcttgg tgtcagttaa ttttttcttt     34980
     ttatgaggat gatagtgatt tctagtttta attcaccttc ggaaatttta gcagtttcta     35040
     agaattcatc gggaatggtt aaactcatag ggttggttga tgaaaaaaag gggtcactat     35100
     tcaattttag atgaaattta gctaagaata attatcaaaa gttatttttc ttgacttctt     35160
     ttgaaagttt tggttccgat ttgggaatcc taatactata ggctttcgag caatctatct     35220
     ttcttggtta acttattgaa tgaaataaca tgaataaact aagaaattgt ttacttcatt     35280
     actcagggta tattattggc atccatattt tatttattag tcctgttgaa tcagccaata     35340
     tatcgacttc tttagacttt agtagtgata ttcaaatctc tttattaaga caacaaaata     35400
     ctaaaacaat tgaatctcaa ttgggttgga aaggcttttt cagtttatat cgtatgtttc     35460
     ctgatagacc agacaattat gatgaggaat ttccctatag tatagtttat ttagaaccta     35520
     taggtaatag tcttaatatt tacaactcat atgtaaaaaa acctttagga caattggctg     35580
     gatgtaatac ccattattgt gatagagcta aagcttcatt aatagggcgt ttaaacttca     35640
     aagagcaagg taatcaatgg atagttactg aggcttctgg acaaacgaga attctctttg     35700
     ataacgctag atgtgaaata tacagaaaat ctaagacttt aatatgtaag ggattttata     35760
     aagtagagaa ttatcctatg actccagttc ctgcaattta caaatttgtc aatgatggaa     35820
     gcaccccttt ttaatactgt tactaataat aacagcacta caagcttttt cttatacaaa     35880
     taatttagaa taaatatgaa caaattaaga ttttttttga ttggctacac tacttttttt     35940
     cttgtaacta atcttcttag tagttacgag gtcaaatcag ccaatctctt aagcaaatcg     36000
     actattcgag atgagcaacc cactctatta gttcaaaata agacaactct tgaatctatt     36060
     aactggggat tttttagtta ttatatcaga tatcctcatg atactgagta tccttatcct     36120
     aatgccattt acaaaagtgt agtttatcta gagagaaaaa ataatataat ctacatctat     36180
     aatacttatc tgcgccgtcc gctaggtcaa gcaaatgggt gtggtggact tggatgtgat     36240
     atgggcaaag gttctctctt aggtacttta aaattacaac gccgaggaaa ttttttagta     36300
     gttactgaag ctactgaaca agcgaagatt cttaataacg ttaagtgcca agttcaaggt     36360
     gatgatactg ttccagtttt atcttgcatt gggacttttc agtctgaatt aaatcctaat     36420
     gcttttcctt ttactgttat ctacgaattt ggttctggta cttagattat taacttttta     36480
     ttgattatca atttacttaa gaataagcat tgagggaaat acgttcaata ataaattaaa     36540
     gtccttaaat aaattcaaga cgctgataca ttgattcggt agtatgagag agataaattc     36600
     gccataaagc ttgtaaaatt tctccaatag aacgacgacc ttgacgacaa taaataattc     36660
     ctgcgtgttc tacttgtcgt tgatgaagtc tcaaaaaatc ggcatcgtgg gtaaaaatta     36720
     tccgcttttg agtcaaagca aatgtggttt gttgttcatc agatgcccca attaaattga     36780
     cttctgctgt ggttgttaca tcaatattcc gtcttcttaa tccctcagca atggcatttt     36840
     ctacattttc atccaagtga aatttaataa aagtcatatt ttaaaaaata ttaattagac     36900
     gaattgtcaa ggttttatct accctaaaaa tcaagttaac ctcgctcaat tgggaatcgg     36960
     acgaaatatc ctaagaagaa agtgatgaac gcatttcagt ttctaagcgg tcatcttcta     37020
     agattgcttt tctaatttct tgaaaattat cataataata agttaacgct gcataaacat     37080
     ccgctaatgt aatagttgga tgtcgagaaa caatttcatc aggggaaagt cccatttctt     37140
     cataccaaat aacaatatct tgtactttta ttcgatgacc agcaatacga ggttttcccc     37200
     cacaaacccc tggagtcata caaatatgtt cggaaattac gggtagtttc gacatttttc     37260
     tttaatcttt caaaatttac gatagtcaat tcattataga acctttttat ttcctttgtg     37320
     aatcctcaaa attgtgctaa gaaaaaagcc tataacaaca cgctatcaat cattggcaat     37380
     gataataatc ataaacttca tgaccgaatt aatcacctat tactgtcgat aatactgctc     37440
     taaaatttcc cttgccaatt ccaaaggctc atcattaaaa gaaaactgaa ttaatcccgc     37500
     cgtatcagac aaagccagct tattattatg tctagctacc cgttcaatgg catcacataa     37560
     ggcttcttcc gttaacttaa ataccaaccc tggactaccc acatcataca acaaacgaga     37620
     gatagctaag gttttcgtcc cataactgac tcgactggca taatctaagc aagcggccac     37680
     aataatctca gggggtagag tcgctttcgt cccaatacga aaggtatagc gttttgattc     37740
     tccggcagta tgaatcaatc ccagttcact aaaaggacag tcaatagaat cttcaattaa     37800
     tcccttagtc gcttgttgtt gaacgtacat ccgcaaaatg cagttgatgt ctttctttaa     37860
     cgaagattcg gcggttgatt ttcctaaatt ttcttgataa ctgcgtaagc cttcggttaa     37920
     atcttcggca tagaattcca cagcccgaaa ttcattaaaa gtgtagtacc aggccgctgc     37980
     ctcacaagtg ggttttagca aatgccaatg gagtaaccac aatgacgctg gattttctag     38040
     aaatggatca taaccgtcat cactgagaag ttgttgccca aagtttgatg gttgatcatt     38100
     ttctaaaact ttaaaggcat tacaccagta gcggatggct tttaccatgt tttttcctac     38160
     tcctaaacgc acaggagcat aatcatcggt aaaaattcct gagtattgag tagcgaggtc     38220
     aaagcctttt tttagccacc cataacgagg gtggaaggtt tcatgacgtg cgaaaacggg     38280
     attgactggt ggtaaagatt caaatagatt cggttgggtt atggtcattg cttctccaat     38340
     ggatctagat taattaattg atcgttgata tggttgtcac ttttgggttt ctagagattc     38400
     cagttacccg tttgattgat taaattttta gactcaatac ttaacaagct caaaggtcag     38460
     gtcagaacta gccaagctgt tacccctcat gtcacagcca caagcgtgat ggagtaaatg     38520
     ggcattccct cctgttacta aattctatct cgatttcctt gggtttttta tctaatggtc     38580
     tttgagcatt ggcttttatt ttttcttcga tggctcaagg ccattcaaat gctttatcgg     38640
     attgtggcct tttatagcac ttttcaattg gatagacaaa tcttcgactt tgatgacaag     38700
     gtgacttgga gaggacttgg agacttggaa gaatgttaac agaaaatctc ccaagtcttc     38760
     cgtgtcttac ccaactagaa atattggcca cagacgatga aaaacgctat taaaccaaca     38820
     atcgtcgcac agattatccc cgtcgccccc attgcagtac gatgtgtatc gacttaaata     38880
     tggtaattag gtttcagccc ttgtttgtct gtataatttg cgctagcaag aaaggattta     38940
     cctcacacgt ttcaatctta agtaagcgtc ttttaactct gtcgtattcc catcggttac     39000
     tttgtaattg tgcaaactaa caatagataa tatgtgtttc atgaatttac ttgagtattt     39060
     ttacttagta agacaatgca cttaaagttc acgccttagc accctgcgcg cacgtttatg     39120
     tgctttcact agcgggaaaa agtgcattta tagtgctttt gcgtgcgtta tccgtgcagt     39180
     agtcgtgcat aaacagtatg agtggccaca caaaacactg cttgctttcc cccagaaaag     39240
     gcagcgaact agaacgaaga agattcaacg agaataacga ggaataaact cagaaaaata     39300
     gtaacacgtc tgtagtaaca aggtagtaat tttagagatg gaacagagaa tgtaatcgtg     39360
     aaaacagtcc gaacacttgt gaaggacaag aggcaagaga ctccactcta gagttgatca     39420
     tttttcgccg aatcaaacaa tgcgcgactc aatgcgagtg ccaagtggag taccgagaat     39480
     atgacaaggt aggtgatcgc tatcctctgt taaaaattca cagccttgaa cttccggaac     39540
     aatgggatct tgtggctcct gcttggactg ttttgcagaa gccttatctt tcggttgttt     39600
     tgtcatggtt gcgtcctctt                                                 39620
//

If you have problems or comments...

PBIL Back to PBIL home page