(data stored in ACNUC7421 zone)

EMBL: CP000812

ID   CP000812; SV 1; circular; genomic DNA; STD; PRO; 2135342 BP.
XX
AC   CP000812;
XX
PR   Project:PRJNA15644;
XX
DT   19-SEP-2007 (Rel. 93, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 6)
XX
DE   Pseudothermotoga lettingae TMO chromosome, complete genome.
XX
KW   .
XX
OS   Pseudothermotoga lettingae TMO
OC   Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Pseudothermotoga.
XX
RN   [1]
RP   1-2135342
RX   DOI; 10.1073/pnas.0901260106.
RX   PUBMED; 19307556.
RA   Zhaxybayeva O., Swithers K.S., Lapierre P., Fournier G.P., Bickhart D.M.,
RA   DeBoy R.T., Nelson K.E., Nesbo C.L., Doolittle W.F., Gogarten J.P.,
RA   Noll K.M.;
RT   "On the chimeric nature, thermophilic origin, and phylogenetic placement of
RT   the Thermotogales";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(14):5865-5870(2009).
XX
RN   [2]
RP   1-2135342
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Foster B., Bruce D., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Nelson K., Gogarten J.P., Noll K.,
RA   Richardson P.;
RT   "Complete sequence of Thermotoga lettingae TMO";
RL   Unpublished.
XX
RN   [3]
RP   1-2135342
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Foster B., Bruce D., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Nelson K., Gogarten J.P., Noll K.,
RA   Richardson P.;
RT   ;
RL   Submitted (23-AUG-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 98ccdf824f2958d1454a40e01da87363.
DR   BioSample; SAMN02598331.
DR   EnsemblGenomes-Gn; EBG00001233507.
DR   EnsemblGenomes-Gn; EBG00001233508.
DR   EnsemblGenomes-Gn; EBG00001233509.
DR   EnsemblGenomes-Gn; EBG00001233510.
DR   EnsemblGenomes-Gn; EBG00001233511.
DR   EnsemblGenomes-Gn; EBG00001233512.
DR   EnsemblGenomes-Gn; EBG00001233513.
DR   EnsemblGenomes-Gn; EBG00001233514.
DR   EnsemblGenomes-Gn; EBG00001233515.
DR   EnsemblGenomes-Gn; EBG00001233516.
DR   EnsemblGenomes-Gn; EBG00001233517.
DR   EnsemblGenomes-Gn; EBG00001233518.
DR   EnsemblGenomes-Gn; EBG00001233519.
DR   EnsemblGenomes-Gn; EBG00001233520.
DR   EnsemblGenomes-Gn; EBG00001233521.
DR   EnsemblGenomes-Gn; EBG00001233522.
DR   EnsemblGenomes-Gn; EBG00001233523.
DR   EnsemblGenomes-Gn; EBG00001233524.
DR   EnsemblGenomes-Gn; EBG00001233525.
DR   EnsemblGenomes-Gn; EBG00001233526.
DR   EnsemblGenomes-Gn; EBG00001233527.
DR   EnsemblGenomes-Gn; EBG00001233528.
DR   EnsemblGenomes-Gn; EBG00001233529.
DR   EnsemblGenomes-Gn; EBG00001233530.
DR   EnsemblGenomes-Gn; EBG00001233531.
DR   EnsemblGenomes-Gn; EBG00001233532.
DR   EnsemblGenomes-Gn; EBG00001233533.
DR   EnsemblGenomes-Gn; EBG00001233534.
DR   EnsemblGenomes-Gn; EBG00001233535.
DR   EnsemblGenomes-Gn; EBG00001233536.
DR   EnsemblGenomes-Gn; EBG00001233537.
DR   EnsemblGenomes-Gn; EBG00001233538.
DR   EnsemblGenomes-Gn; EBG00001233539.
DR   EnsemblGenomes-Gn; EBG00001233540.
DR   EnsemblGenomes-Gn; EBG00001233541.
DR   EnsemblGenomes-Gn; EBG00001233542.
DR   EnsemblGenomes-Gn; EBG00001233543.
DR   EnsemblGenomes-Gn; EBG00001233544.
DR   EnsemblGenomes-Gn; EBG00001233545.
DR   EnsemblGenomes-Gn; EBG00001233546.
DR   EnsemblGenomes-Gn; EBG00001233547.
DR   EnsemblGenomes-Gn; EBG00001233548.
DR   EnsemblGenomes-Gn; EBG00001233549.
DR   EnsemblGenomes-Gn; EBG00001233550.
DR   EnsemblGenomes-Gn; EBG00001233551.
DR   EnsemblGenomes-Gn; EBG00001233552.
DR   EnsemblGenomes-Gn; EBG00001233553.
DR   EnsemblGenomes-Gn; EBG00001233554.
DR   EnsemblGenomes-Gn; EBG00001233555.
DR   EnsemblGenomes-Gn; EBG00001233556.
DR   EnsemblGenomes-Gn; EBG00001233557.
DR   EnsemblGenomes-Gn; EBG00001233558.
DR   EnsemblGenomes-Gn; EBG00001233559.
DR   EnsemblGenomes-Gn; EBG00001233560.
DR   EnsemblGenomes-Gn; EBG00001233561.
DR   EnsemblGenomes-Gn; EBG00001233562.
DR   EnsemblGenomes-Gn; EBG00001233563.
DR   EnsemblGenomes-Gn; EBG00001233564.
DR   EnsemblGenomes-Gn; EBG00001233565.
DR   EnsemblGenomes-Gn; EBG00001233566.
DR   EnsemblGenomes-Gn; EBG00001233567.
DR   EnsemblGenomes-Gn; EBG00001233568.
DR   EnsemblGenomes-Gn; EBG00001233569.
DR   EnsemblGenomes-Gn; EBG00001233570.
DR   EnsemblGenomes-Gn; Tlet_R0001.
DR   EnsemblGenomes-Gn; Tlet_R0002.
DR   EnsemblGenomes-Gn; Tlet_R0003.
DR   EnsemblGenomes-Gn; Tlet_R0004.
DR   EnsemblGenomes-Gn; Tlet_R0006.
DR   EnsemblGenomes-Gn; Tlet_R0007.
DR   EnsemblGenomes-Gn; Tlet_R0008.
DR   EnsemblGenomes-Gn; Tlet_R0009.
DR   EnsemblGenomes-Gn; Tlet_R0010.
DR   EnsemblGenomes-Gn; Tlet_R0011.
DR   EnsemblGenomes-Gn; Tlet_R0012.
DR   EnsemblGenomes-Gn; Tlet_R0014.
DR   EnsemblGenomes-Gn; Tlet_R0015.
DR   EnsemblGenomes-Gn; Tlet_R0016.
DR   EnsemblGenomes-Gn; Tlet_R0017.
DR   EnsemblGenomes-Gn; Tlet_R0018.
DR   EnsemblGenomes-Gn; Tlet_R0019.
DR   EnsemblGenomes-Gn; Tlet_R0020.
DR   EnsemblGenomes-Gn; Tlet_R0021.
DR   EnsemblGenomes-Gn; Tlet_R0022.
DR   EnsemblGenomes-Gn; Tlet_R0023.
DR   EnsemblGenomes-Gn; Tlet_R0024.
DR   EnsemblGenomes-Gn; Tlet_R0025.
DR   EnsemblGenomes-Gn; Tlet_R0026.
DR   EnsemblGenomes-Gn; Tlet_R0027.
DR   EnsemblGenomes-Gn; Tlet_R0028.
DR   EnsemblGenomes-Gn; Tlet_R0029.
DR   EnsemblGenomes-Gn; Tlet_R0030.
DR   EnsemblGenomes-Gn; Tlet_R0031.
DR   EnsemblGenomes-Gn; Tlet_R0032.
DR   EnsemblGenomes-Gn; Tlet_R0033.
DR   EnsemblGenomes-Gn; Tlet_R0034.
DR   EnsemblGenomes-Gn; Tlet_R0035.
DR   EnsemblGenomes-Gn; Tlet_R0036.
DR   EnsemblGenomes-Gn; Tlet_R0037.
DR   EnsemblGenomes-Gn; Tlet_R0038.
DR   EnsemblGenomes-Gn; Tlet_R0039.
DR   EnsemblGenomes-Gn; Tlet_R0040.
DR   EnsemblGenomes-Gn; Tlet_R0041.
DR   EnsemblGenomes-Gn; Tlet_R0042.
DR   EnsemblGenomes-Gn; Tlet_R0043.
DR   EnsemblGenomes-Gn; Tlet_R0044.
DR   EnsemblGenomes-Gn; Tlet_R0045.
DR   EnsemblGenomes-Gn; Tlet_R0046.
DR   EnsemblGenomes-Gn; Tlet_R0047.
DR   EnsemblGenomes-Gn; Tlet_R0048.
DR   EnsemblGenomes-Gn; Tlet_R0049.
DR   EnsemblGenomes-Gn; Tlet_R0050.
DR   EnsemblGenomes-Gn; Tlet_R0051.
DR   EnsemblGenomes-Gn; Tlet_R0052.
DR   EnsemblGenomes-Tr; EBT00001579008.
DR   EnsemblGenomes-Tr; EBT00001579009.
DR   EnsemblGenomes-Tr; EBT00001579010.
DR   EnsemblGenomes-Tr; EBT00001579011.
DR   EnsemblGenomes-Tr; EBT00001579012.
DR   EnsemblGenomes-Tr; EBT00001579013.
DR   EnsemblGenomes-Tr; EBT00001579014.
DR   EnsemblGenomes-Tr; EBT00001579015.
DR   EnsemblGenomes-Tr; EBT00001579016.
DR   EnsemblGenomes-Tr; EBT00001579017.
DR   EnsemblGenomes-Tr; EBT00001579018.
DR   EnsemblGenomes-Tr; EBT00001579019.
DR   EnsemblGenomes-Tr; EBT00001579020.
DR   EnsemblGenomes-Tr; EBT00001579021.
DR   EnsemblGenomes-Tr; EBT00001579022.
DR   EnsemblGenomes-Tr; EBT00001579023.
DR   EnsemblGenomes-Tr; EBT00001579024.
DR   EnsemblGenomes-Tr; EBT00001579025.
DR   EnsemblGenomes-Tr; EBT00001579026.
DR   EnsemblGenomes-Tr; EBT00001579027.
DR   EnsemblGenomes-Tr; EBT00001579028.
DR   EnsemblGenomes-Tr; EBT00001579029.
DR   EnsemblGenomes-Tr; EBT00001579030.
DR   EnsemblGenomes-Tr; EBT00001579031.
DR   EnsemblGenomes-Tr; EBT00001579032.
DR   EnsemblGenomes-Tr; EBT00001579033.
DR   EnsemblGenomes-Tr; EBT00001579034.
DR   EnsemblGenomes-Tr; EBT00001579035.
DR   EnsemblGenomes-Tr; EBT00001579036.
DR   EnsemblGenomes-Tr; EBT00001579037.
DR   EnsemblGenomes-Tr; EBT00001579038.
DR   EnsemblGenomes-Tr; EBT00001579039.
DR   EnsemblGenomes-Tr; EBT00001579040.
DR   EnsemblGenomes-Tr; EBT00001579041.
DR   EnsemblGenomes-Tr; EBT00001579042.
DR   EnsemblGenomes-Tr; EBT00001579043.
DR   EnsemblGenomes-Tr; EBT00001579044.
DR   EnsemblGenomes-Tr; EBT00001579045.
DR   EnsemblGenomes-Tr; EBT00001579046.
DR   EnsemblGenomes-Tr; EBT00001579047.
DR   EnsemblGenomes-Tr; EBT00001579048.
DR   EnsemblGenomes-Tr; EBT00001579049.
DR   EnsemblGenomes-Tr; EBT00001579050.
DR   EnsemblGenomes-Tr; EBT00001579051.
DR   EnsemblGenomes-Tr; EBT00001579052.
DR   EnsemblGenomes-Tr; EBT00001579053.
DR   EnsemblGenomes-Tr; EBT00001579054.
DR   EnsemblGenomes-Tr; EBT00001579055.
DR   EnsemblGenomes-Tr; EBT00001579056.
DR   EnsemblGenomes-Tr; EBT00001579057.
DR   EnsemblGenomes-Tr; EBT00001579058.
DR   EnsemblGenomes-Tr; EBT00001579059.
DR   EnsemblGenomes-Tr; EBT00001579060.
DR   EnsemblGenomes-Tr; EBT00001579061.
DR   EnsemblGenomes-Tr; EBT00001579062.
DR   EnsemblGenomes-Tr; EBT00001579063.
DR   EnsemblGenomes-Tr; EBT00001579064.
DR   EnsemblGenomes-Tr; EBT00001579065.
DR   EnsemblGenomes-Tr; EBT00001579066.
DR   EnsemblGenomes-Tr; EBT00001579067.
DR   EnsemblGenomes-Tr; EBT00001579068.
DR   EnsemblGenomes-Tr; EBT00001579069.
DR   EnsemblGenomes-Tr; EBT00001579070.
DR   EnsemblGenomes-Tr; EBT00001579071.
DR   EnsemblGenomes-Tr; Tlet_R0001-1.
DR   EnsemblGenomes-Tr; Tlet_R0002-1.
DR   EnsemblGenomes-Tr; Tlet_R0003-1.
DR   EnsemblGenomes-Tr; Tlet_R0004-1.
DR   EnsemblGenomes-Tr; Tlet_R0006-1.
DR   EnsemblGenomes-Tr; Tlet_R0007-1.
DR   EnsemblGenomes-Tr; Tlet_R0008-1.
DR   EnsemblGenomes-Tr; Tlet_R0009-1.
DR   EnsemblGenomes-Tr; Tlet_R0010-1.
DR   EnsemblGenomes-Tr; Tlet_R0011-1.
DR   EnsemblGenomes-Tr; Tlet_R0012-1.
DR   EnsemblGenomes-Tr; Tlet_R0014-1.
DR   EnsemblGenomes-Tr; Tlet_R0015-1.
DR   EnsemblGenomes-Tr; Tlet_R0016-1.
DR   EnsemblGenomes-Tr; Tlet_R0017-1.
DR   EnsemblGenomes-Tr; Tlet_R0018-1.
DR   EnsemblGenomes-Tr; Tlet_R0019-1.
DR   EnsemblGenomes-Tr; Tlet_R0020-1.
DR   EnsemblGenomes-Tr; Tlet_R0021-1.
DR   EnsemblGenomes-Tr; Tlet_R0022-1.
DR   EnsemblGenomes-Tr; Tlet_R0023-1.
DR   EnsemblGenomes-Tr; Tlet_R0024-1.
DR   EnsemblGenomes-Tr; Tlet_R0025-1.
DR   EnsemblGenomes-Tr; Tlet_R0026-1.
DR   EnsemblGenomes-Tr; Tlet_R0027-1.
DR   EnsemblGenomes-Tr; Tlet_R0028-1.
DR   EnsemblGenomes-Tr; Tlet_R0029-1.
DR   EnsemblGenomes-Tr; Tlet_R0030-1.
DR   EnsemblGenomes-Tr; Tlet_R0031-1.
DR   EnsemblGenomes-Tr; Tlet_R0032-1.
DR   EnsemblGenomes-Tr; Tlet_R0033-1.
DR   EnsemblGenomes-Tr; Tlet_R0034-1.
DR   EnsemblGenomes-Tr; Tlet_R0035-1.
DR   EnsemblGenomes-Tr; Tlet_R0036-1.
DR   EnsemblGenomes-Tr; Tlet_R0037-1.
DR   EnsemblGenomes-Tr; Tlet_R0038-1.
DR   EnsemblGenomes-Tr; Tlet_R0039-1.
DR   EnsemblGenomes-Tr; Tlet_R0040-1.
DR   EnsemblGenomes-Tr; Tlet_R0041-1.
DR   EnsemblGenomes-Tr; Tlet_R0042-1.
DR   EnsemblGenomes-Tr; Tlet_R0043-1.
DR   EnsemblGenomes-Tr; Tlet_R0044-1.
DR   EnsemblGenomes-Tr; Tlet_R0045-1.
DR   EnsemblGenomes-Tr; Tlet_R0046-1.
DR   EnsemblGenomes-Tr; Tlet_R0047-1.
DR   EnsemblGenomes-Tr; Tlet_R0048-1.
DR   EnsemblGenomes-Tr; Tlet_R0049-1.
DR   EnsemblGenomes-Tr; Tlet_R0050-1.
DR   EnsemblGenomes-Tr; Tlet_R0051-1.
DR   EnsemblGenomes-Tr; Tlet_R0052-1.
DR   EuropePMC; PMC2667022; 19307556.
DR   EuropePMC; PMC5924567; 29690652.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP000812.
DR   SILVA-SSU; CP000812.
DR   StrainInfo; 304122; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002278
CC   Source DNA and bacteria available from Kenneth Noll
CC   (kenneth.noll@uconn.edu)
CC   Contacts: Kenneth Noll (kenneth.noll@uconn.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2135342
FT                   /organism="Pseudothermotoga lettingae TMO"
FT                   /strain="TMO"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:416591"
FT                   /type_material="type strain of Pseudothermotoga lettingae"
FT   gene            137..1471
FT                   /locus_tag="Tlet_0001"
FT   CDS_pept        137..1471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: tma:TM0926 chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32574"
FT                   /db_xref="GOA:A8F346"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F346"
FT                   /protein_id="ABV32574.1"
FT                   /translation="MKSEIIESLKSKLNRRVWESWFGTFDVKEIGPDYVVFQVGNLFIR
FT                   EWLEKKYGSLISKTLRELFGKPMDFRIEHASAKTEEKLDSNEDEPLVKKRPLILTPLNP
FT                   ILTFENFVVGPNNMFAYSTCLEVAKNPGKYNPLFLHGGVGLGKTHLLQAIGHYLFKHEP
FT                   DMRVIYLTSERFLNELVDSIKKNRVQEFRDKFRNKIDVLLLDDVQFLIGKTGIQTELFH
FT                   TFNELYNEGKQIVVCSDRDPQQLEKFQDRLVSRFQMGVVTKIEKPDEETCFKIAQKMAQ
FT                   LENAELQEDILKLISKNFSDNLRRLRGALVKLIMYQQISGEKVDLQKAFELLAIQNSYH
FT                   NKSLPEEKLMNSICEIFGVSQEEILSKSRKKEVALARQIGMYVARNYMGFSLRKVADMF
FT                   KRSHPTVSHTIQKLEELTNSGNMVIKSQIDRLARCVTGQILDQSV"
FT   gene            complement(1440..2450)
FT                   /locus_tag="Tlet_0002"
FT   CDS_pept        complement(1440..2450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0002"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein;
FT                   KEGG: tma:TM0378 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32575"
FT                   /db_xref="GOA:A8F347"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F347"
FT                   /protein_id="ABV32575.1"
FT                   /translation="MKFSILGAGSWGTAFAKLLVENGHEVLIWARREELADKINKYHAN
FT                   DDYLPNVRLPETLIASSDISSAVHFSDNLVIAVPTKYVDETMAKIERKPAVIVNLSKGI
FT                   DEKLRTISSIVKSRWRDADYLVLSGPCHAVEVAKRLPTSVVIAGPNSITEAFQQAFSND
FT                   YFRVYVNDDVLGVEISGAVKNVIAIAAGILDGLGQWHNAKAALITRGLQEIARFGLSLG
FT                   ARSPLTFMGLAGMGDLIVTCTSPYSRNRYVGEMIGKGMALKDILSQMKMVAEGVYTVGP
FT                   LLRMADSLHIDMPICRQVYDVLFRKKDPYQAISELMSRPLKMEIDLTQIGPESDL"
FT   sig_peptide     complement(2400..2450)
FT                   /locus_tag="Tlet_0002"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.717 at
FT                   residue 17"
FT   gene            complement(2447..3373)
FT                   /locus_tag="Tlet_0003"
FT   CDS_pept        complement(2447..3373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0003"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
FT                   PFAM: putative methyltransferase; KEGG: tma:TM0925 tRNA
FT                   (guanine-N7-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32576"
FT                   /db_xref="GOA:A8F344"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F344"
FT                   /protein_id="ABV32576.1"
FT                   /translation="MSEFLRYDLDLRHYAAPIDWKKIFGNNKELAVEIGFGNGEFLVSM
FT                   AKEKSWCNFIGFETSLISLVKIQKKLYSESIENVKVSRIDGKFALREFFSDNSVWEVYI
FT                   NFPCPWPKKSHQGKRFTDQGFTETLAAVLKADGNFQLISDVKWYVEHMKAFLLKTGCFE
FT                   IIEFGKSDKTIVGTRYEKKWISQGKDIYILRAKKINHITVERWTWGGFEMPHVHIENVN
FT                   REKILGLKDTIFKHLKGVFVVKSVYYSQDEYLLRIVSNEGGFQQRYFISVEKVHDRWLV
FT                   KLDTDASAYRTPVVKFSVRKIAEVIGF"
FT   gene            complement(3370..4524)
FT                   /locus_tag="Tlet_0004"
FT   CDS_pept        complement(3370..4524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0004"
FT                   /product="Tetratricopeptide TPR_3"
FT                   /note="PFAM: Tetratricopeptide TPR_3; KEGG: tma:TM0923
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32577"
FT                   /db_xref="GOA:A8F345"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8F345"
FT                   /protein_id="ABV32577.1"
FT                   /translation="MSVNDAVERVVRDLIKENMLSRARAVLSLFQDDYPHLLLELEAAS
FT                   GNWKTVLKVYENLSEERKDEYSTLYKTAHERVKTDYSQDVKEAFEEANKNNFEGAMAIL
FT                   ESVSKTYPELVEAVALKLELARREGDKARAKIFENVLKKLDASHPLLIAKSGGASNFVK
FT                   MDLIVLIAILFTLAISLAGIFKSMAQSSKIDVVESEMQELRTHVKELDLSLRRINESFS
FT                   NFEISTLSEKVEQTSNELSQSIDKILLAIESIKEGESQELGSLKEEIIKLLGEARSKPI
FT                   SLELSENLSIDLVRSLWLFGYQLYRSGYYQDAYNVLENVSNILKDTSIYFKDDAFYFMA
FT                   LSSYEVGNIVMASQLFSKFITLYPDSEYVPHAKYFLERMSGAGK"
FT   gene            complement(4521..6044)
FT                   /locus_tag="Tlet_0005"
FT   CDS_pept        complement(4521..6044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0005"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: tma:TM0922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32578"
FT                   /db_xref="GOA:A8F348"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A8F348"
FT                   /protein_id="ABV32578.1"
FT                   /translation="MKIVTSQQMKEIDRLAAEQFFIPSSILMERAGLSVVLSIEQVFKN
FT                   LSDLSFLVLCGPGNNGGDGFVAARDLLDYTDYVTIVFAGDEKKLSVEAGENFKRLKSVG
FT                   GDIRVLGVDVTLDDVADIMKKCDIVIDALLGIGIKGEVRGQIAELIKLINLYSNYVVSI
FT                   DIPSGLDSDTGKILGIAVKADLTVTFGLPKPCHLLYPGRELCGQLKVASIGIPRVLRES
FT                   KQFTRQIITKQLVSRLIPERFPDSHKGSYGKLLVIAGSAEYPGAAVLTSLSALRVGCGY
FT                   VHLLTCSPANEVAIQREPGLVATVVDKKHFCEQDVAIALELSNNADAVVIGPGITCNDG
FT                   VRKFLSEFLENLKVPVVIDADGLNCLARDLNILEKIQVPAVLTPHPAEFARLTGEDLSD
FT                   VKYNYLLTEEFSKKYNLVVVLKSATTIISTPNETFFNLTGNTSLSKAGSGDILAGMIGG
FT                   FAAQGLNQKDASICSVYLHGLASEHYRHREGSMLVSELLDLIPVAMEEV"
FT   gene            complement(6049..6510)
FT                   /locus_tag="Tlet_0006"
FT   CDS_pept        complement(6049..6510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0006"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   tma:TM0921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32579"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8F349"
FT                   /protein_id="ABV32579.1"
FT                   /translation="MKLICLTLFLIIIVLFYWQFPVKYYSVVRENSKPLDPLLIMALIK
FT                   VESNFRENAISPAGAIGLMQVMPRTADWMKEKFNLIDSNVNHPVDNIVLGTTYLKYLMQ
FT                   LYDENIDLALMAYNVGPSQLETRKTLAEKYLYRIKLYYKIYKVLYFWMG"
FT   gene            complement(6572..7294)
FT                   /locus_tag="Tlet_0007"
FT   CDS_pept        complement(6572..7294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0007"
FT                   /product="peptidase A24A domain protein"
FT                   /note="PFAM: peptidase A24A prepilin type IV; peptidase
FT                   A24A domain protein; KEGG: tma:TM1696 leader peptidase
FT                   (prepilin peptidase) / N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32580"
FT                   /db_xref="GOA:A8F8Y0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y0"
FT                   /protein_id="ABV32580.1"
FT                   /translation="MWHFLSFVFGVIIGSFLNAVIYRLPRENLSLVKPAYSICPLCGKK
FT                   IRWYDNIPLISYILLGGRCRNCGGRISLRYPAVELCNGVGYLVNFIFCSNFLEFIALSI
FT                   ILSSVIVLSLIDLQFMLIPDITLLLIGAGSFVLWIVRGAELLNLVAVGLVTVLLIVLSL
FT                   LYKGGMGSGDILLMAAMSLSLGITGSLYSLVFASLSGIIYALIRDKGKLIAKKRIPFGT
FT                   FLAPTGYIILVIQKFLSV"
FT   gene            complement(7279..8352)
FT                   /locus_tag="Tlet_0008"
FT   CDS_pept        complement(7279..8352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0008"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: tma:TM1695
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32581"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y1"
FT                   /protein_id="ABV32581.1"
FT                   /translation="MERVIILEIQQKQIEITTDTPFVIMLRDLMYEGDWEFMKQDFVNK
FT                   EWIKREIENCEYIENNVTLLNEVVYDPICFEELVEWLEKKKISPRNFIHATMNGLYDLA
FT                   LDYADKDLHEVSFKVIKYILEIDKNYAPAYELLGSLMLEKGDFEQGIRYLDKAIEIDPW
FT                   LVEAYSSLGEAYYNLGEYARAASYWEKEIEYAPDNKFTYFMLAEAYRKMGAHSRVCEVL
FT                   ERFLKIDSNSVLGMFELSEAYKKVGKLDKATEMEQRILKTRPVYMSDVEVWSRIQLKHG
FT                   NYATVEEVVTQMLGDSKTKTHLKLLLFLAYLKQGKKDQAKQIIQEMKDQNIWYLYGKKE
FT                   LFSEFLTEEEMRSCGIS"
FT   gene            complement(8420..9433)
FT                   /locus_tag="Tlet_0009"
FT   CDS_pept        complement(8420..9433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0009"
FT                   /product="uncharacterized conserved membrane protein"
FT                   /note="KEGG: cac:CAC3016 uncharacterized conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32582"
FT                   /db_xref="GOA:A8F8Y2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y2"
FT                   /protein_id="ABV32582.1"
FT                   /translation="MKSTLSKSLIILVISFIIVIFIAGFTDLSSTVRALKRVSIGWLTI
FT                   GGFLMICDWFLETITVKIFAISYKTKISMTYLFKSTLIGNFFSAITPFSTGGQPAQIAF
FT                   MNKRGVEYGEATALYVSRFIVYQLVATGMGIFGVYAAYDILQKNITRFAWFAFAGFALN
FT                   GAVLMFLLIFSINRNLAIWLVKTLIKPLAFLRLIKHQQAVVEKTIAQTELFNKYMLRSM
FT                   GNPFLLLFSIFTTLCQMTARVSITYFVARSVGVNCSYFETVLFQLVLFLVISLMPTPGA
FT                   MGVSESGYVLFFKFLFGPETVATLLLWRFLTYYVNIIIGGLTTAHEMRNMSKFYVK"
FT   sig_peptide     complement(9344..9433)
FT                   /locus_tag="Tlet_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.352 at
FT                   residue 30"
FT   gene            complement(9430..10440)
FT                   /locus_tag="Tlet_0010"
FT   CDS_pept        complement(9430..10440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0010"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: efa:EF2891
FT                   glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32583"
FT                   /db_xref="GOA:A8F8Y3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y3"
FT                   /protein_id="ABV32583.1"
FT                   /translation="MRILLYAEAARLISKSGIGTAYKQQIEALKRAGVDYTCDWEDIYD
FT                   IAHVNTVGPSSRMVVEHCKKKNIPVIWHVHTTAEDIRNSFIFSNFYARISQKWLKKLYS
FT                   KADYLIFPTKYTESIIRGYGIQIPGTVLSNGIDTEIFKKNDEKAKQFLKKFGLSKPIVL
FT                   SVGFPFKRKGIHDFVAVARKMRNYTFVWLGAKITSVLPRDVREMIKNPPQNVIFPGFLD
FT                   REELVGAYSAADVFFFPTYEENEGIVVLEALSCECPVVVRDIPVYRDWLENGVNCLKGN
FT                   SNDDFEALIEKLIVDKNLSDKLSREGRKVAFERDLSNIGRALREIYENILGRCTS"
FT   gene            10516..10590
FT                   /locus_tag="Tlet_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            10516..10590
FT                   /locus_tag="Tlet_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(10592..12943)
FT                   /locus_tag="Tlet_0011"
FT   CDS_pept        complement(10592..12943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0011"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: tma:TM0205 ATP-dependent
FT                   DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32584"
FT                   /db_xref="GOA:A8F350"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028993"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="InterPro:IPR036845"
FT                   /db_xref="UniProtKB/TrEMBL:A8F350"
FT                   /protein_id="ABV32584.1"
FT                   /translation="MFTMHPILVEEFLDFLEQSLLEVLHGKKGTNELVEEVQDRYELVA
FT                   DHVLQNSEILEKFKQLFEYIEPVADMQPERAIKRVKNSLGMIERFRDWYLISNPDCSQM
FT                   KQPSCEIKYAKRVGPRKEAILKKLGISTLGDLIFYFPRDYEDRRKIIPISEISFEGKLT
FT                   TRGKVVNVETKKIGSMTITAAVLADGVSQLLLKWFNQEYLHKGLQVLKNKTIYATGLVK
FT                   HSQFGGIEMVNPEIEPEDGTQVLEILPIYPLTHGISQKEIRRIVRENISCVCHYTDELP
FT                   EELMKKRKLMDISRALLGIHFPKSNYHLKKSIERLAYEELFLMQFALLLSRKSFEEIGG
FT                   LPKKIPGKLAEEFLRKLPFKLTDSQKEAHRQIRADLMSNKPMSRLLQGDVGCGKTVVAQ
FT                   LAIVDNFEAGFQSAVMAPTSILAMQHYRRMSPAFEEMGIRTALLLGETSSREKEKIKRM
FT                   LSDGEISVVIGTHTLIQEDVSFSNLGLVIIDEQHRFGVKQREALVSKGKALDTLVMTAT
FT                   PIPRTLALTIYGDLDITVIDEMPPGRKDVKTMLVSVSKLEQVYEFVKKEIAEGGQVFIV
FT                   YPLIEESDKIQAKAAIRMHEYLSKKIFGEFRVGLLHGKMSQQEKDKIMERFATGEFDIL
FT                   ISTTVIEVGIDVPRATVMIIENPERFGLAQLHQLRGRIGRGDKQGYCFLVVGNVDDDAL
FT                   ERLRYFSMTKNGFEVAEYDMKLRGPGEILGLKQHGLPELKIADLIRDRELLFRARNDAE
FT                   EIVRKKEQYPDIVKKVKTIYGERLKLVKIA"
FT   gene            complement(13070..13582)
FT                   /locus_tag="Tlet_0012"
FT   CDS_pept        complement(13070..13582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0012"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; KEGG: tma:TM0206
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32585"
FT                   /db_xref="GOA:A8F351"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8F351"
FT                   /protein_id="ABV32585.1"
FT                   /translation="MLPKILFDEGAVRSRISEMGREIEEYYRDKTDSLSAICVLKGSVH
FT                   FFSELVLSINMNISYSFVHVSSYAGTQSTGRIRVKSWVDEDLAGKHVLVVEDIIDTGNT
FT                   LRYILAYLRKYKPADLKVVTLIEKQKHDHGIPIDFVGFKVGDLFVVGYGLDYEERYRNL
FT                   PYIGYLE"
FT   gene            complement(13596..14228)
FT                   /locus_tag="Tlet_0013"
FT   CDS_pept        complement(13596..14228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32586"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8F358"
FT                   /protein_id="ABV32586.1"
FT                   /translation="MRITWFGHACFLIDTGKTLILTDPFDSSVGYRVPDVTVDLITESH
FT                   QHFDHNAHRLIKGKFEIIKDSGDYEFRDVKISGIETFHDDESGARRGRNIVFVFDFGRF
FT                   RVAHLGDLGHIPDESQIKHLKDLDVLLLPVGGTFTIGPKEARKILDLIKPKIAIPMHYK
FT                   TKYIKFDIAPVEEFTRLCENVRYTSDNFIDLSEELKSFDRMVQVLNV"
FT   gene            14513..16288
FT                   /locus_tag="Tlet_0014"
FT   CDS_pept        14513..16288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0014"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: tma:TM0373 dnaK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32587"
FT                   /db_xref="GOA:A8F359"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A8F359"
FT                   /protein_id="ABV32587.1"
FT                   /translation="MSEREYVVGIDLGTTNSVIAWMKPDGSIEVIPNAEGGRITPSIVA
FT                   FTKSGEIIVGEPAKRQMILNSERTIKSIKRKMGSDYKVKIDDKQYTPQEISALILKKMK
FT                   KDAEQYLNGKIKKAVITCPAYFNDAQRQATKEAGQIAGFEVLRIINEPTAAALAYGLDK
FT                   KKEEKVLVYDLGGGTFDVSILEIGEGVIQVVATSGNNHLGGDDFDQRIVDWMAEEFKKQ
FT                   HGVDLREDRQALQRLRDAAEKAKIELSSKLETDISLPYITATASGPLHLELRLTRSLYE
FT                   SLVKDLFEMTKGPVEKALSDAKLSPKDINEVILVGGMTRSPTVHKIIQDIFGKEPNKGV
FT                   NPDEAVAIGAAIQAAILAGEAKEKDIVLVDVTPLTLGIEVKGGLMEPVIPRNTTIPVKK
FT                   SKIFTTAEDYQTEVEIRVYQGERTMARDNIFLGSFRLVDIPPAPRGVPQIEVTFDIDSD
FT                   GIVHVSAKDLASNKEQSMVVTGRHKLKDEDIKKMMEEAQKYEEQDKRKREEVELKNKAD
FT                   DLAYSVSKSLKEHGDKLPADLKSKLEQLVNDLRDAINKDDIPRVKMLFDDLQQESMKVG
FT                   QYLYENVRKEQSSSQ"
FT   gene            16313..16756
FT                   /locus_tag="Tlet_0015"
FT   CDS_pept        16313..16756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0015"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: tma:TM0374
FT                   heat shock protein, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32588"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:A8F352"
FT                   /protein_id="ABV32588.1"
FT                   /translation="MLLERREDFMKPFRELQREIDRLFEDFFAPVTRRSTVYSYLPDVD
FT                   VYETDDSVVVEVEVPGMDKKDFEVKVEDSILRITGEKKLEREKENRNYKVVERCYGKFE
FT                   RTLSLPDYVDADKIKAKYENGVLTISLPKREEKKAKVVDVKIE"
FT   gene            16802..19021
FT                   /locus_tag="Tlet_0016"
FT   CDS_pept        16802..19021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0016"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: tma:TM1391 ATP-dependent Clp protease, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32589"
FT                   /db_xref="GOA:A8F353"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8F353"
FT                   /protein_id="ABV32589.1"
FT                   /translation="MIDFKDYTESAQRVLTSVQDILNRFSQNQMSSEHILLAILEDSDN
FT                   AAIDILKKIGVNIDTLRDETSSFVSRYGMRGGLINPSGSLSQVYITPDARHVLEESKKE
FT                   ARRMGDEKIGTDHLLLGMILSPSSMTYRLLSRHGVTPDKVYEAIRELRTSGKTAEDENV
FT                   DVLFKFTEDLTKLAKDGKLLPVIGREKEILRIIQILGRKFKNNPVLIGDPGVGKTAVAE
FT                   GLAQKIISENVPGFLKNKKILKLDMGRIIAGTKFRGEFEERMKKLIDALKKNVGQYILF
FT                   IDELHTVVGAGAAEGAVDAANLLKPELARGEMQVIGATTVNEYRKYVEKDKALARRFQP
FT                   VFVGEPSVEETIEILRGIKKEFEKHHEVSITDQALVAAARLGARYITDRFLPDKAIDLI
FT                   DEAASAIRLQDNGKIVNENDIAKVVELWTGIPVSKMLQSEREKLMNLEQLIHKRIVDQD
FT                   NAVKIVAQTIRKSRAGLKDPKRPNGVFLFLGPTGVGKTELAKALAEVLFGSEDALIRID
FT                   MSEYTEKHTVSRLIGAPPGYVGYEEGGQLTEQVRRRPYSVILLDEIEKAHQEVFNVLLQ
FT                   VFDDGRLTDGKGNTVDFRNTIIIMTSNIASEQILDALEEGIDDLTVMIEEEMKKHFKPE
FT                   FVNRIDAAVVFKPLSLEHMKQIVELQLEKISERLSEQGRKVYFTEQAKEYIAKRGYLPA
FT                   LGARPLRRVVESEIEAPIAEKIISEQFKENETITIDADEYGIIFK"
FT   gene            complement(19039..20043)
FT                   /locus_tag="Tlet_0017"
FT   CDS_pept        complement(19039..20043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0017"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: tma:TM0299
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32590"
FT                   /db_xref="GOA:A8F354"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F354"
FT                   /protein_id="ABV32590.1"
FT                   /translation="MKITIKDIAKKLGVNASTVSRALNGKPGVSAQLREKIIQLAEKMG
FT                   YLPDLTAMGLKKGQTKIIGVLIPDISNPFFAYTVRGMEKVLRPIGYHLLLCSTNEDPDQ
FT                   EVENLRTLASQKVEGILAAPVDSGGNRTIYKKIAESGIPLVFFDRIVPNVDVSYVITDN
FT                   ESGVRELVTYLYKSGHRTIGIMTLRARSFTGKERLNGVLKACKELGITVQNEWIIDGES
FT                   SEEGGYRAAKRFFSLCRKPTALIVSNNLMMLGVMKVIKETGLKVPQDISLVSFDDSHWN
FT                   EIFEPPITCVAQEPEQMGLIAATLLINNIFHDKKTSRTVLKAHFIERQSVAKI"
FT   gene            complement(20320..20841)
FT                   /locus_tag="Tlet_0018"
FT   CDS_pept        complement(20320..20841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0018"
FT                   /product="putative HNH endonuclease"
FT                   /note="KEGG: pha:PSHAb0292 putative HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32591"
FT                   /db_xref="GOA:A8F355"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:A8F355"
FT                   /protein_id="ABV32591.1"
FT                   /translation="MVYVISKDDKPLMPAKRHGKVRRLLKQGLAKVVRREPFTIQLLYD
FT                   TTTYAQPVTVGVDIGSKVIGVSAITDKQELFSVEAELRQDIKKLLLERREYRRNRRYGK
FT                   TRFLNRKRRNNWLSPSLQWKVDAHIRLVNLIAKILPIAKVVVEIAPFDIHRVNPEIESV
FT                   GYQNGVQKGF"
FT   gene            21309..22724
FT                   /locus_tag="Tlet_0019"
FT   CDS_pept        21309..22724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0019"
FT                   /product="L-fucose isomerase_2 domain protein"
FT                   /note="PFAM: L-fucose isomerase domain protein; L-fucose
FT                   isomerase _1 domain protein; L-fucose isomerase _2 domain
FT                   protein; KEGG: tma:TM0307 L-fucose isomerase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32592"
FT                   /db_xref="GOA:A8F356"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:A8F356"
FT                   /protein_id="ABV32592.1"
FT                   /translation="MKRKVGLMTFSDGREYVHKDLININKAFEQKLVEALESTGEIQVI
FT                   RSNKIVNKPSVAREEAVFLNNSGAQMTIFNYAVWAFPHFSVIASKFAPPPFLLFGNINP
FT                   KYPGMVGMLAAAGALDQDGTQTYRVWGDIKQKDVLRKVLAFVRAATARNMLRGQRYGLF
FT                   GGRSMGMYTAVPNVDLWNKLFGIDIEHIDQLEIIEKSKKIPDQAAKSAREWLEKLTRKI
FT                   HYDGKQLTPEKLELQIKSYYAVKKICEEFELDFTGIKAQPELTEHFVTMDLTEAFMNDP
FT                   YDFDGPKEPIVCATEADSDGALTMQILKLISNQPVLFADLRHYDEQDDFFDLCNSGEHA
FT                   TFFAAKSYDPAVNLAKVELYPESFYFPAGGASVRHIAAPGEVTLARLTRKNGEYVMTVI
FT                   KGEFLDFGEQKNEEKARNTQIEWPHAFAKLKISADDFLATYSSNHIHGVYGDYVEELVH
FT                   FTKLLGFNMRIYA"
FT   gene            22890..23681
FT                   /locus_tag="Tlet_0020"
FT   CDS_pept        22890..23681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0020"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: sfu:Sfum_0814 extracellular solute-binding protein,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32593"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8F357"
FT                   /protein_id="ABV32593.1"
FT                   /translation="MKRLVSWVVVLSVIIIPTFLFAATTLEEIVKRGKIIIATDMTSVP
FT                   MQYRDPSGKPTGFTIELMELAAKYMGVQIEWQDMAWESLIPSLLTKKVDMIAANMSMTL
FT                   TRLKTIRFSEPFFLTGIRVLARKDSKMVYWKDIIDPSVKIGATMGSVHADYVEKQLRKK
FT                   PFLYENLAEWLSDLKTGRIDAVMDDEMLCIELVKNNPELKILEGYVRPDTYGLAFRQDS
FT                   ESDSLVNWFNWFIRWVKLTGEYGEIYKKYTGMEWTPSPIID"
FT   sig_peptide     22890..22958
FT                   /locus_tag="Tlet_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            23739..24467
FT                   /locus_tag="Tlet_0021"
FT   CDS_pept        23739..24467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0021"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_0239 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32594"
FT                   /db_xref="GOA:A8F360"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8F360"
FT                   /protein_id="ABV32594.1"
FT                   /translation="MESVVEITGLNKFYGRNHVLKNINLRVEKGDVLVICGPSGAGKST
FT                   LLRCINRLENFETGTVRVLGKDVKIHTNLIFIRRNTGMVFQHFNLFPHLTVLDNIIIAP
FT                   IHVKKVAKHEAVEKAKILLQRVGLSEKLMSYPHQLSGGEKQRVAIARALAMDPEIMMFD
FT                   EPTSALDPEMIKEVLNVMVDLANGGMTMIVVTHEMGFAKQVSNKIAFMDKGEIIEFATK
FT                   ESFFSNPTSQRAREFLSKIL"
FT   gene            24493..25161
FT                   /locus_tag="Tlet_0022"
FT   CDS_pept        24493..25161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0022"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dps:DP1560 probable
FT                   amino acid ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32595"
FT                   /db_xref="GOA:A8F361"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F361"
FT                   /protein_id="ABV32595.1"
FT                   /translation="MIFDFRTLAQYLPDFMEALLETLKIAIISCFFAISIGTIVGFLSN
FT                   TRSRLLRTLIEFYTGFIRSTPLLVQLYFVHYGLPILNIMPTRFQSATITFSLNTGAYIS
FT                   EIIRGGLQSINIGQFEAAYSLGLSRFQTIRLIIFPQLFRIVLPPLVSQFSYLIKDTSLA
FT                   AVLTIPELTYMARRAAATTYRPLESFIPPMLMYFAIYFILSFLSNTLEKHLQKNDQEMI
FT                   "
FT   gene            25161..25835
FT                   /locus_tag="Tlet_0023"
FT   CDS_pept        25161..25835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0023"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bsu:BG11488
FT                   glutamine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32596"
FT                   /db_xref="GOA:A8F362"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F362"
FT                   /protein_id="ABV32596.1"
FT                   /translation="MQSMPFTQQVLRLGNAFLQNLVLLPFVLIMGIFFGFIIALIRYYK
FT                   IPVLSQFFAFAIEIVRGSPFLLLVYAVYFVLPYFGIELQSFETAVVVLTITSTVYLSEV
FT                   FRSGLLAIDKGQFEAADALGMSFANKLFLIILPQVLQITLPSIVGQIVLTIKDTSIVSL
FT                   IGMAEIVRTSRQVMQITLDPFTAFLIVAGYFAAVCYPLILVSRKLEQRILKGGKKNEAT
FT                   VR"
FT   gene            25816..27039
FT                   /locus_tag="Tlet_0024"
FT   CDS_pept        25816..27039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0024"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mhu:Mhun_2943 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32597"
FT                   /db_xref="GOA:A8F363"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F363"
FT                   /protein_id="ABV32597.1"
FT                   /translation="MKRQLGSSKLEYFSPDPFSFIRELRKKPSKSKIIDLSIGAPNRPT
FT                   PPWIIETMKNALNEVSYHTYPPQNGSSELRKAISDWYKNRFSVDLDPEKNILITVGIKE
FT                   IVFNALQALINQGDIVLIPDPGYPTYYDASNFAGAKILTYDSKASPEKILEDITLVLKK
FT                   NRVKAIIVNFPSNPVGTIVNIEFYKRLSTIAEEHFCIVISDIPYYEITFNDSVAPSYLQ
FT                   GNPSLRNAIEYFAFSKTYNMAGWRVGAVVGDEKIIDLLKLFKSKIDSNVFYPIQIAAVS
FT                   ALRETPQEYYESLRKEYKLRRDTMVGYLEKSGLEFHMPDGAMYIWVRVPEEEDCWSFVE
FT                   KLYLNTGILTVPGIAYGPSGKDHIRLGLVQEVDALKEAGERILKYISNQNNMELEKIRI
FT                   RSVKMQEK"
FT   gene            27053..27958
FT                   /locus_tag="Tlet_0025"
FT   CDS_pept        27053..27958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0025"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   bcl:ABC3607 dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32598"
FT                   /db_xref="GOA:A8F364"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A8F364"
FT                   /protein_id="ABV32598.1"
FT                   /translation="MKRLSGVTVAALTPLTDDGTQVDHEAIKEYVDFLIQKGVHGIFAL
FT                   GTTGEGLLLTVEERKKALESFIKAVSGRATLIAHCGALRFEEVKELLSHAKSSGADGAA
FT                   IVSPFYYKYRSDEIVEFFLRATENVEDFPIYLYNIPGLTGNWITPKIANQIHEKNPNIV
FT                   GVKDSSGDLLHVLSLINDTYQDFDVVVGCDRAFLSILQMGAKGCVSGPAAVFPEFFVRL
FT                   YEQFKKGDIEGARQTQRKLTKLSLALGDGASIPILKTVLSWRGINAGGCRSPLKILNET
FT                   ELQKLKISIETVLEEVKLTF"
FT   gene            complement(27962..28792)
FT                   /locus_tag="Tlet_0026"
FT   CDS_pept        complement(27962..28792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0026"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   pfu:PF1868 integrase-recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32599"
FT                   /db_xref="GOA:A8F365"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8F365"
FT                   /protein_id="ABV32599.1"
FT                   /translation="MKTDVDLLKRFEAVLRSQKLSSMTVRAYMSAVRKFTQSIEELNVE
FT                   EILKWAETTAEGRKPSTVNLYYCAIRRFLEEVSPEILLDLRNKLKVKGRSSTIPKALSE
FT                   REFLKLWNKAVKIFDEDYRQLLIVGLAGYAGLRVSEIRSLKVGHINLREDHILVNGKGR
FT                   KMRIVPIPSKLKPYIFKIVPKLKEEEPLLKNLSGKPITSHGISYLLKNLAKKTGIKHIS
FT                   PHVLRHTAATNLLKKGVNLKIVQEFLGHSSLATTERYLRVTINDMKENLRKAGY"
FT   gene            29172..30170
FT                   /locus_tag="Tlet_0027"
FT   CDS_pept        29172..30170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0027"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: shm:Shewmr7_3231 response regulator receiver
FT                   modulated metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32600"
FT                   /db_xref="GOA:A8F366"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8F366"
FT                   /protein_id="ABV32600.1"
FT                   /translation="MQQKKILIVAESRNKLKSIQEFLQGKCLLDICENCIDAYRICRKS
FT                   PCEYDLLITYCDYPFNILPLIRAIRNDISFIHPYILAVTDDRLKTTTIALKAGADSVVE
FT                   KETVQDFLRSALEKEKKSTDLRAFTEFAMKIIEYKNFPTYEHSKNVKIISSILANLYFL
FT                   ENKKIDFQFHDNLRIAALFHDIGKILVPESILCKPSSLTYDEFNTMKSHTRRGAELFST
FT                   ISKIYPEDELLSACMKVCLYHHEKFDGSGYPHGLKGEQIPLEARIVAIADVFDALTSVR
FT                   YYRSAYSLEKALRVMEEEKAHYDPYIFHLFMDNIEFFCNLKLDSSHSESPL"
FT   gene            30205..30690
FT                   /locus_tag="Tlet_0028"
FT   CDS_pept        30205..30690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0028"
FT                   /product="protein of unknown function DUF355"
FT                   /note="PFAM: protein of unknown function DUF355; KEGG:
FT                   tma:TM0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32601"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:A8F367"
FT                   /protein_id="ABV32601.1"
FT                   /translation="MNFEIVQVKIPEGANVIIGHSHFIKTVEDLYEVIVTTNPNIKFGL
FT                   AFNEASGPCLIRYEGNDQQLTDVAIENARNIGAGHLFVLVIKDGYPINILNQIKNVQEV
FT                   CRIFAATANPLQVIVTETDQGRAVLGVVDGYKIKDVETEKDREFRHNFLRQVTKYKK"
FT   gene            complement(30707..31951)
FT                   /locus_tag="Tlet_0029"
FT   CDS_pept        complement(30707..31951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0029"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: mhu:Mhun_0418 PKD"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32602"
FT                   /db_xref="GOA:A8F368"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A8F368"
FT                   /protein_id="ABV32602.1"
FT                   /translation="MGRFSSFWTLIIFGIFLILLVFVSPLTRQSREDVEWLKFIGRTSR
FT                   DIAYDIARLNDGSFVIAGWTGSKEDFDQDVLLLGMDKGGKLLWEKEFGGTGTDGAVSLT
FT                   PASDGGFVVLALSDSDSGELFAQFGEQDVWLLKFDNKGTLQWKKCYGTYGYETAFDVIE
FT                   DEGYIFAGSINIDGQEDFWVVKVDKSGDVVWSRNFGGTDWDAAFSVAKSKNGYIVAGMS
FT                   KSADGDVKINHGSADMWIAEISTDGRLLWENAFGGSEWDQIVDLTAVEDGYIAAGVSWS
FT                   EEIVGKERKADFVMIKFDINGKVQFFRTYGGSSDDIVQKILVTEDGYVLAGTSWSDDGD
FT                   VAGKHKGSDYWLIKVDKDGELIWQKCFGGDMDEVAYALENSKSGFLIGGISYSYAAGIA
FT                   GRSHGGGDVFIVKTK"
FT   sig_peptide     complement(31859..31951)
FT                   /locus_tag="Tlet_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.551 at
FT                   residue 31"
FT   gene            complement(32309..32782)
FT                   /locus_tag="Tlet_0030"
FT   CDS_pept        complement(32309..32782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0030"
FT                   /product="Flavodoxin-like protein"
FT                   /note="KEGG: cdf:CD1679 putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32603"
FT                   /db_xref="GOA:A8F369"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8F369"
FT                   /protein_id="ABV32603.1"
FT                   /translation="MKVLVAYDTYTGTTEKCAKILAEKFKEARIINLAKGYGVVLNEYD
FT                   CVVVGSYVHAGKISKRVKKFCEKNIENLRGKKIGIFLCMLGEEKDFEEYVSRNFSSQFL
FT                   DLVKAKDYFGGELNYERMNFVFRFILKLIVKNTKPKLGVREEKIENFAKQLMD"
FT   gene            32873..33976
FT                   /locus_tag="Tlet_0031"
FT   CDS_pept        32873..33976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0031"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: nucleoside:H symporter; major facilitator
FT                   superfamily MFS_1; KEGG: tma:TM1032 permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32604"
FT                   /db_xref="GOA:A8F370"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F370"
FT                   /protein_id="ABV32604.1"
FT                   /translation="MLNSCVLEALIYSIMACSTLMSQYFTITGFSPSQIGLLMALMPLT
FT                   AVYGNYIYFSLVDRFSTIKIIRIFSISAVLSSWLLYISEGFVMKFLFMAVLAFFQASFL
FT                   PLVESAMIDLSEKYAFSYNKIRIFGSIGYAVAAFLIGQLVRLGFEWLFIVLSVIFVLIN
FT                   LLIRKINIKTEKAEKNRKFGKVPSPFLFLFIMVTIAIGFNLFNSNFLPVFVKHRNYNVS
FT                   IVGTTLSLMALSEVPFLMSAEKIRKKISSKFLFLTGILIIGVRLILVPMSWSTGSMVLI
FT                   QMLHGWTFIVVYYSTIFIMREALKGQTLRSAQTLFWIALQGVGPLLGSTMGGIVVDSIG
FT                   ISNTYITFGAICLVTSAVYSSYFIKKL"
FT   gene            complement(33981..35195)
FT                   /locus_tag="Tlet_0032"
FT   CDS_pept        complement(33981..35195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0032"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3440 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32605"
FT                   /db_xref="GOA:A8F371"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F371"
FT                   /protein_id="ABV32605.1"
FT                   /translation="MRFFIYAILIIFMVLSLFPTFLMFFTAFVPEGDLFNRTIEKTITD
FT                   FELPKAILLSKVRPVKTTINLIKEGENSFLRIDASKDFSGIAPSMGSSDINKVKFVELR
FT                   LRNEESIRLRVGFKDIKDRVDYCIVRDIPASREWQNLRFEIKPGDLSLDTFHISQLRIE
FT                   TLGDGWVDIDDVKLVNRYPTFYNFVKVLRDDYFGRYLLNSAIVSTGSVVGNLFFCSMVA
FT                   YAFARKNFRFKELLFSLILGTMMIPPQVTIIPTFILMKKLGFIDTYWALILPNLVTPFG
FT                   IFLMRQYIEQLPVELDQAAFVDGATDFQIFRYIILPLSKPALSVLGINTFVLTWNDVFY
FT                   PLILTTSREMRTVQIGLALYQKLNVFTWPSLMAASAIAGLPIILMFLIFEKRIISGILE
FT                   GAIKS"
FT   sig_peptide     complement(35097..35195)
FT                   /locus_tag="Tlet_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.729 at
FT                   residue 33"
FT   gene            complement(35192..36058)
FT                   /locus_tag="Tlet_0033"
FT   CDS_pept        complement(35192..36058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0033"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tte:TTE0800 ABC-type sugar
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32606"
FT                   /db_xref="GOA:A8F372"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F372"
FT                   /protein_id="ABV32606.1"
FT                   /translation="MKKRGRITILFLLPWIVSFIFFTAYPLIFSIFVSFTDYSGLNPAM
FT                   KFIGLSNYTRAFSDKIFLKALLNTFSFVIITVPITTVISLFLAILLTGGIRLKRVFQAS
FT                   YFLPSVISMVVISMIWLYIYSATGPLNLLLNALGFNFPARSWLSSSKTALGSIMVMDIW
FT                   SAIGYYTVLFVAGLQSIPIQLYEAARIDGATKWQIVKSITLPLLKSTILFVISINSIRS
FT                   FQIFTEIFTLTGGGPANSTQTVVYYLYDTSFRKFEMGYGSAIAYILFLIIMSVTFIQRK
FT                   FLKGEQL"
FT   gene            complement(36107..37321)
FT                   /locus_tag="Tlet_0034"
FT   CDS_pept        complement(36107..37321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0034"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: lwe:lwe1747 ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32607"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F373"
FT                   /protein_id="ABV32607.1"
FT                   /translation="MLRKFFIFVILVLVVISFGKTKLTFWQFMMDDALAKEVLSGFSKE
FT                   FPDIEVEVVQLSWSTGFDKIVTAIAAGAAPDVVELGNTWIANFASEGVLSELHPEDLEK
FT                   YRDFPGMNSTEYMGKYYGYPWLLGTRAMFYNVDLMMKAGLDPDRPPQTWSELLEAARKI
FT                   SELPDVYGIGLPAGEVYSPWQEWFLLAIWGNGGNVISKDLKKATLNSQQNRDTARFYQE
FT                   LSKYALKSKQKDLGDAFGEGRVGFLVSGAWSIGTLAQSYPNLNYGVCLIPKPDKPDGIH
FT                   ASFLGGEILAVPSQTKNVDAARKFINYLMRPEIAMIITKHYPGVYPADPKASSDPWFED
FT                   NPLHLVFFEQLKTAFPVPPTPAWPKIEDVLTNVVDDLIISYKDVDEVLNFYNTEIQRIL
FT                   DEVGM"
FT   sig_peptide     complement(37262..37321)
FT                   /locus_tag="Tlet_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.880 at
FT                   residue 20"
FT   gene            complement(37324..38694)
FT                   /locus_tag="Tlet_0035"
FT   CDS_pept        complement(37324..38694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0035"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tma:TM0809 hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32608"
FT                   /db_xref="GOA:A8F374"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8F374"
FT                   /protein_id="ABV32608.1"
FT                   /translation="MGRYEKVFFCGVSNSDDLKVVLNYDIGGVLLYPSVFEDPSEFAEI
FT                   MCNLEGKKLLVSTDHEGGQLEILPFIPQSPGNLLFGQTNPDFVFKYCNLSGKFMKELGI
FT                   NMIFAPVLDLKFPETNPVIGYRSYGSDPKKVSEFGLSAINGYKAAGLLSCAKHFPGHGR
FT                   TRQDSHQEIAVVDIDREELDKDLYPFRIAVQNGVDSIMMAHVIYSKIDEKPASISRRFI
FT                   DSMLRNELQYDGLIISDAVEMKSLSRHYSPEDILVDFFSSRGDMLIISRPRTLRIYVEM
FT                   LHKLIKNGKLEKTFLAESMQRIEKISPAIEDSYGFIRHAIEEAVEFHIEQLRSEQAVLV
FT                   LPDLTFYSEADVSERYLEFFKKQAKRFLKAKIIPFSGINSVSGNVLIIDLLIDASDKEI
FT                   VAHRKLSENFETVHIITRNPFLKTYFCDRNYIVTYSLSPIVMGYVFKKISRFLKGGV"
FT   gene            complement(38681..39748)
FT                   /locus_tag="Tlet_0036"
FT   CDS_pept        complement(38681..39748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0036"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: tma:TM0808
FT                   transcriptional regulator, XylR-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32609"
FT                   /db_xref="GOA:A8F375"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F375"
FT                   /protein_id="ABV32609.1"
FT                   /translation="MLNHLHHQILSCLKKNGPMTAQGISEELSVNESTISRNLRYLLEC
FT                   GIVFVKDHLPAKSAGGRKPRLLCLNPEWLKLLGISVEQGEICWTISDFLGRALFFKRLI
FT                   TNIDRENFEQVVSKVLFENSFDVVTIAMPGLIKSSENFIVFSEALGIENYSLNGIYHGP
FT                   FLLFNDANAAAACYLNFANNLVYLLLSIPYELSKPVGLGAGMVINGTIYEGSNGSAGEL
FT                   GEGVPVIRKTPFTVEDLEKNRNLLTEHENDLEAFIKHICDKVATAVNLIDPELFVLGGD
FT                   FHLLGERVLSKVIDKIESQVTVKRVKKINWQLDMSGSKTVALGSVLAFLERFFYDYEFA
FT                   KYVFESKGCVQNGKI"
FT   gene            complement(40183..40842)
FT                   /locus_tag="Tlet_0037"
FT   CDS_pept        complement(40183..40842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0037"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: swo:Swol_0065 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32610"
FT                   /db_xref="GOA:A8F376"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F376"
FT                   /protein_id="ABV32610.1"
FT                   /translation="MTVIGRKSLKDEVVERVKEYILKGRYSPGQKIVIDSLAKDLGVSV
FT                   TPVREALNYLAAEGLIDVEPHKGFSVKKWNRKEIEDLLLLRMYLERLAVRLFIERGYDE
FT                   NISILEQIVKEMSIAADSENLQRLLQLNTDFHNVIVMGSKNEELRKVISALRDKLYRVR
FT                   VFSLSYPGRIKQSYQEHLQIYKAIKSKDIELSEKLMEEHIKCVRDVLIKRASEGLI"
FT   gene            complement(40872..42374)
FT                   /pseudo
FT                   /locus_tag="Tlet_0038"
FT   gene            complement(42387..42821)
FT                   /locus_tag="Tlet_0039"
FT   CDS_pept        complement(42387..42821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0039"
FT                   /product="putative tricarboxylate transport protein TctB"
FT                   /note="KEGG: gtn:GTNG_1842 putative tricarboxylate
FT                   transport protein TctB"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32611"
FT                   /db_xref="GOA:A8F377"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:A8F377"
FT                   /protein_id="ABV32611.1"
FT                   /translation="MKQSSEKILAIVVLSFGVMYIITTLGLPRAPVGNPMSPLYFPIGL
FT                   GILMSVLGFLMLIRTEGSKVRKEVPKRSYFMILTILCACFAYAMLFKIIGFVASTMLFL
FT                   VGLLFLLNGYKKWLINIIVAISYTFGIWYVFEKIFMISLP"
FT   gene            complement(42867..43838)
FT                   /locus_tag="Tlet_0040"
FT   CDS_pept        complement(42867..43838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0040"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bld:BLi01241 putative tricarboxylic transport membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32612"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A8F378"
FT                   /protein_id="ABV32612.1"
FT                   /translation="MKLRFGIFMLAVFFTGILFAEIYPAKPITFIAPAGPGGGWDTTAR
FT                   VVSQILKETNLVDQPIIVVNMPGGGGGVGLAHMQSKKGDPYTMIVFSPPLLLINLTGQT
FT                   GYSYKNLTPLAMLIHDYGAFAVSKKSKFNSISEIMEALKKDPKSIKVGGISSFGSMDHI
FT                   QFLIAAKAAGVKNLKDITYVSFQEGEHLAALLGGHIDVLSTGLAETVTAMQAGAVRVLA
FT                   VTAPQRVGGILSSVPTLREEGIDAEFINWRGFFGPPDMPSYAVDYWINTFSKMVQRPEW
FT                   DKIVSKYSWTKAFMNGKDFENYLDKVNENYKEILREIGLYKE"
FT   sig_peptide     complement(43776..43838)
FT                   /locus_tag="Tlet_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            43996..44880
FT                   /locus_tag="Tlet_0041"
FT   CDS_pept        43996..44880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0041"
FT                   /product="putative methylisocitrate lyase"
FT                   /note="KEGG: ter:Tery_4268 putative methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32613"
FT                   /db_xref="GOA:A8F379"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8F379"
FT                   /protein_id="ABV32613.1"
FT                   /translation="MNSKSFEKAKKLREYLQREGVLTLRVCAYDALSAVLIERAGFEVV
FT                   GTTGYGISASLIGQPDIGLVGFAEMLERVRTIVNATELPVDADIDTGYGNALNVFWAVK
FT                   NFARVGVAGIRLEDQVWPKRCGHMEGKNIVPLEEMINKIKAATDAKNEENPEMVIGART
FT                   DARTVAGFEEVVRRAKAYAEAGADYVYVETPQSLYEIETLVREVSKPISFNIIPGGKTP
FT                   IFELEKLAELGVKYLSVPMICLYPATKAIMEALNALKNKDLEKISHMGVNWSEFNEIVG
FT                   IKKWNKLETKYSK"
FT   gene            complement(44919..46712)
FT                   /locus_tag="Tlet_0042"
FT   CDS_pept        complement(44919..46712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0042"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: tma:TM1703 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32614"
FT                   /db_xref="GOA:A8F380"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A8F380"
FT                   /protein_id="ABV32614.1"
FT                   /translation="MLKSTLNYMLFLLILSSLKIFGFYTTVPEVLRFSTLLSTTGWLIL
FT                   FFLLFTFFFREWGFGLYCVISIALFIDFLYFQNFGNLPSVKQLVLLPQVGKLGANIRYF
FT                   TNFFSLLFVADLIPLGIFDRRRYLQLRTTDFSTPKGLFLTMILCSVFAIVPLVSEKLKP
FT                   GQVFNRYGFFAYHIFDIATVFSKPERENYSVTHMNHEQPSSKKYWSIASNRNIIVVQLE
FT                   SFQNFLVNMRYNGQEVTPNLNKLVRNDSIYFNNYYQQTGIGNTADAEFVSLVSLHVPGD
FT                   EVAYEKYADIDFYALPRILKNHGFHTVAMHGNVGWFWNRFKIYPHLGFEKFLSLEDFNQ
FT                   DEVFGMGLNDVSFFEQSVDVLKNYPEPFFSFLVTVSSHSPFVIPEQYRKLMLLPEDENT
FT                   MFGNYLQAVHYADYALGIFVDRLKKAGLYERCILILYGDHAGLYPFNKESKERLSAIFE
FT                   KEYTYKEAMNIPLIFHIPGCKINEIVSTVGGQIDFLRTVLNVIGIDDSGVVSFGRDLLN
FT                   TEDGFVALRYHVPDGSFVDDERYFEISKDGILQNSLAVNYIEGTSLPYYECLDGFKAAV
FT                   KQIETSKNMLETAEATLAKLR"
FT   gene            46805..47551
FT                   /locus_tag="Tlet_0043"
FT   CDS_pept        46805..47551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0043"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: tte:TTE1933
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32615"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A8F381"
FT                   /protein_id="ABV32615.1"
FT                   /translation="MNSLLEHLRNFFKMPDLEEYRTILCIQPHPDDADIGMGATVAKLS
FT                   EKGAKVFYLTVTDGSAGSTNERLIGETLSKIRKEEQEKAAEILGVHDLIWLDFEDLGDY
FT                   QLKELRSMIAEHIVVLKPDIVFTVDPFLPYEIHPDHIKCGFAVAQASSFYKLPKISKFR
FT                   TDHILHAIGFFNTANPNNFYQIERKHLEKKFLALSHHKSQFDEKTLQTLYFYLEERAKV
FT                   GEDKLAESFKILPPVMLHVFPEAQDF"
FT   gene            47565..48530
FT                   /locus_tag="Tlet_0044"
FT   CDS_pept        47565..48530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0044"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   tma:TM1280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32616"
FT                   /db_xref="GOA:A8F382"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR039758"
FT                   /db_xref="UniProtKB/TrEMBL:A8F382"
FT                   /protein_id="ABV32616.1"
FT                   /translation="MYFMGIDVGGSKTDVAIVDKNGKLISHVRASGANYQGVGVQKAYE
FT                   ILKSAINDALQKSSLNYNELSYSYFGVAGADMDYEIKIVKSILERLQLKNYDFDNDGRI
FT                   ALKSGTFDDKGILISCGTGGITYAGDGKKIARKGGFSRFFGERLGAFVIASMVASAIIR
FT                   SKDQRDENTLMKQIFESKINQPIEEIMHYEYANEDKSKLAEYAILLIQSLYEAAHQFDY
FT                   VALRIMGNIVDEIIKIVTAYRKEMYFTSPVKVVLEGSFFKKADPILINMIQSALSDEYI
FT                   LIIPKHPPVVGAVLLAAEKAGYKYDENFIANLLSHWGGKK"
FT   gene            48527..49780
FT                   /locus_tag="Tlet_0045"
FT   CDS_pept        48527..49780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0045"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG: tma:TM1281
FT                   6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32617"
FT                   /db_xref="GOA:A8F383"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F383"
FT                   /protein_id="ABV32617.1"
FT                   /translation="MKITVIGAGSTYTPELVKGIMDISSEVKVDELILYDLEESEEKLE
FT                   TIYQFSKRLVKDLFKVVKPKNLIDALQGADYVIFQFRVGFLKARENDEKIPLRYNLIGQ
FT                   ETTGMGGFSCALRTFPVIEKYIELVDKYSKATVINFTNPSGHITEFVMNYIGFERFIGL
FT                   CNIPVNLLHMISQVTGYPPKDIFVKYYGLNHLTFLEKVYLKNEDATEKLLETVKLELAN
FT                   IPKEDFPGWLIECLKMYPNSYLRYYLMEKKMLKKIKKEGTRAEKVISIEKQLLELYKTG
FT                   DKIPDQLSQRGGSMYSTAAAYLIRDLHLSNGSVHILNTRNNGAISNLPDDYVLEIPCMV
FT                   KAGKVFPTSLGIADEFASGLIHIVKMYERITIDAYLKKSKNLALKAMLLHPLGPDVEDA
FT                   PKLLEDILNANKDFIKLE"
FT   gene            49792..51108
FT                   /locus_tag="Tlet_0046"
FT   CDS_pept        49792..51108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0046"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tte:TTE1932 Na+/melibiose symporter and related
FT                   transporters"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32618"
FT                   /db_xref="GOA:A8F384"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A8F384"
FT                   /protein_id="ABV32618.1"
FT                   /translation="MKNFLYSLGSFSSALFSNAISTFAIFYYVDVLKAPPHLISIIMVL
FT                   YGIWNAINDPLFGYLSDTTKTRWGRRKPYIVWFSLPLTISFAMFWAPPFDSSQKTALVI
FT                   YYLIMIFLFDTFFTIVFLNWTALFPEMYPTLKERAKISGLRQILAIPGLLLGVAVTPVI
FT                   AAKIGWGKMGAVFAVIGGSILYMTLFGIKENPEFSHQQTLNIIEAIKFTFFNRSFFTYV
FT                   VPSFLLQFTYTMLTATLPFYAKYVLKASETQTTLLLASIFVVAFFLIPVWQKITAKIGA
FT                   KKTMKVSMILWAILLIGFGFVKTFFQAIILTSALAMSLAGALIVFDIMIADISDEDEIK
FT                   TGKRREGMYFGANALIIRLGISLNSLIMGFVLSSSGYDANLPAEMQPLTAVSGFRILCS
FT                   VVPIIATIGGLLILKYYPLEGDYLNRIKEKIKNMRGEEV"
FT   sig_peptide     49792..49851
FT                   /locus_tag="Tlet_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.596 at
FT                   residue 20"
FT   gene            51105..51626
FT                   /locus_tag="Tlet_0047"
FT   CDS_pept        51105..51626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0047"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: putative
FT                   RNA methylase; conserved hypothetical protein 95; KEGG:
FT                   tma:TM1388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32619"
FT                   /db_xref="GOA:A8F385"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F385"
FT                   /protein_id="ABV32619.1"
FT                   /translation="MKITGGTLKGYHLNPVPDSRTRYTTSLVRQAVFNMIDVSQSSFLE
FT                   LFCGSAVMSIEALSRGAKHAVAVDISSKAIKTAIENAKKCGVELKIVKSDFRKFINLCN
FT                   DNFDVVFADPPYNLGFVQKLLELLSIKPSLGQIIIIEKAAAEQVVIPEKLKILKSKKYG
FT                   ETEVLVIART"
FT   gene            complement(51628..53070)
FT                   /locus_tag="Tlet_0048"
FT   CDS_pept        complement(51628..53070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0048"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: lac:LBA0354
FT                   gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32620"
FT                   /db_xref="GOA:A8F386"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8F386"
FT                   /protein_id="ABV32620.1"
FT                   /translation="MEMYIGVDIGTTAVKTIVYNSDAKKIEMDVSQSYEAFSKGHGQFE
FT                   QDPRQIERAVFETLKQVSKSFTNVRAIVLDSALHTVMLLNGDFEPLSNVIPWLDERSVD
FT                   HVKKVISDNQLSKHLHLKTGCPPDTVYPLYKLLWIKQNEKDMLNSASKIVSLKDYVIYK
FT                   LTGDLVSDIGVASGSGYMDIEKKVWCEELLKDFLEISSEKLPQLVSPKTVLRLSKEAAK
FT                   ITGLPEGLPVVVGISDAAASSIGAGAFVENSITISVGSSAAIRAVLNHPVKQYPVSSIW
FT                   CYVLDENHYISGAAIKNGGYVFDWYVKLFCCYDHETIVKKVEENLNFLDEKPVLFYPFI
FT                   FGKRFPEFDPSPRAKFDNLTSTTTQEQVARSVLEGIAFNLKRAFDVVKTIPDSLEKVFA
FT                   TGGLTRATVWMKMLSAILNHPILVQSKRQGAALGTILYFLSKGDLHSIGGYLSNNEVEI
FT                   FRPDRSLFEYYSKLYRMWVENF"
FT   gene            complement(53101..54075)
FT                   /locus_tag="Tlet_0049"
FT   CDS_pept        complement(53101..54075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0049"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: tma:TM0327
FT                   phosphoglycerate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32621"
FT                   /db_xref="GOA:A8F387"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F387"
FT                   /protein_id="ABV32621.1"
FT                   /translation="MKTVIVATRTFGKYSEEPVKLLEKNGFTLLRPEYLDENILKRADA
FT                   IILGTGKLSGEMIRHSSIKIIARHGVGVDNVDLKTATELGIPVTITPNANTVSVAELTI
FT                   ALILALSRRLIDSYREISEKKFSPVTGIEIFGKTLGIIGFGAIGRETSKRAICLGMKVL
FT                   ACDPYVEKNIIERHSVEAVDLETLLKNSDFVSLHVPLTQSTKHMIGKEQLKMMKKSAFL
FT                   INTSRGGIVDERALVEALKEGYISGAALDAFEQEPLPEDSILYDCPNLVLTPHAGAHTY
FT                   EAIYKMNMMSAQAVVDFFDGKIPLHVANEKVVEKLLEMGFLRG"
FT   gene            complement(54098..54940)
FT                   /locus_tag="Tlet_0050"
FT   CDS_pept        complement(54098..54940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0050"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: tma:TM0326 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32622"
FT                   /db_xref="GOA:A8F388"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8F388"
FT                   /protein_id="ABV32622.1"
FT                   /translation="MDILQTLRTVYDSLTAAEKRIADVILTNPRGVLECSISELSRLAN
FT                   VKSEASVVKFYRKLNLSSFQQFKVLLAQDLSKAPLEIVYEDVSEQDDLKTITQKIFKAT
FT                   VKAILDTLDSIDFDAIEKATDLIKEANRVLFFGFAASAAVAFDAFHKFSRIGKNCLFSN
FT                   DEHIMATLLANSIAGDVLVAVSHSGETKSMVSLAKKAIGLGVPVVTVTGNRKSSLAKVS
FT                   TVVLCTNTRETRIRTDAMTSRIVQLVILDTIYTMLAAKDPKAVESLNKSRLAVSELKY"
FT   gene            complement(55029..55784)
FT                   /locus_tag="Tlet_0051"
FT   CDS_pept        complement(55029..55784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0051"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: tma:TM0325
FT                   oxidoreductase, short chain dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32623"
FT                   /db_xref="GOA:A8F389"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F389"
FT                   /protein_id="ABV32623.1"
FT                   /translation="MNFKGKVVLITGAGSGIGRKAAMMFAERGAKVAINDVSEEKGNET
FT                   VEMIKNQNGEAIFVFGDVSKDAEKIVEKTVEVFGKIDILVNNAGIVPYGNAEETSDEEF
FT                   QKTIDINVKGPFLLSKHAVKYMKEQRSGVIVNIASEAGLIGIPRRCVYSISKAALLGLT
FT                   RSFAVDYVQYGIRVNAICPGTTYSQGLAERVRSSANPEETMNKMVSRIPMKRLGKEEEI
FT                   AFAILFAACDEASFMTGSFINIDGGSTMV"
FT   gene            complement(55797..57080)
FT                   /locus_tag="Tlet_0052"
FT   CDS_pept        complement(55797..57080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0052"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: tma:TM0324 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32624"
FT                   /db_xref="GOA:A8F390"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A8F390"
FT                   /protein_id="ABV32624.1"
FT                   /translation="MIIVIIAFIIFLAIGMPVAFAIGISGFLWFLQHLDLPVTIPIQLA
FT                   LSQTQSFTLLAIPMFIFAGNVMNSAGVTGRLMNLASALTGHMRGGLGQVSAVLSTLMGG
FT                   VSGSSIADAAMETRMLGPEMLKRGYPKGFAVAVNVWTSLITPIIPPGIAFIIYGTIGQV
FT                   SVGRLFAAGIVPGLLLMVVYMIAIWAAAKRMGLQPERERRASSKEIASAFSKSIWSVIF
FT                   PILLILGLRTGIFTPSEVGSFAVIYGLIVGFLIHRELNLKTLFKETLDNSIGDIGSVMY
FT                   IIVMSAIFGYGLVWDRIPEVLANFLLGISSNPYVLLLMIMIFLIFAGLFIDATALILMT
FT                   TAVFLPVARKIGIDPVYFGLVFILSAALGNQTPPVGASMYAGCSVLGASVEEYVKASIP
FT                   FFVATIAVIALLVFFPQLVLFIPDLLFR"
FT   sig_peptide     complement(57015..57080)
FT                   /locus_tag="Tlet_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.795 at
FT                   residue 22"
FT   gene            complement(57077..57574)
FT                   /locus_tag="Tlet_0053"
FT   CDS_pept        complement(57077..57574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0053"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: rsq:Rsph17025_3259
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32625"
FT                   /db_xref="GOA:A8F391"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A8F391"
FT                   /protein_id="ABV32625.1"
FT                   /translation="MRKIDEFLLKFEKNAAKILILVMVILVFASGIMRFLRYPINWAVD
FT                   MSTFMFAWACFFAADVAWREGKMMTVDLFVKRLSRKVQKILRLANYFIIAAFLIYLVIW
FT                   GFYLSYTTRFRTFVGIPNFSYTWVTLSIPIGAILMLRTTFLKIKSEFAENKERASTEGE
FT                   DK"
FT   gene            complement(57663..58676)
FT                   /locus_tag="Tlet_0054"
FT   CDS_pept        complement(57663..58676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0054"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: tma:TM0322 ABC transporter, periplasmic
FT                   substrate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32626"
FT                   /db_xref="GOA:A8F392"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A8F392"
FT                   /protein_id="ABV32626.1"
FT                   /translation="MKGKSRYLLMFVACVILAGSLIAAPKYTLKFNHVLGPSEPYHEGF
FT                   LKWAKAVEERTNGNLKIEVYHSAQLGVEEDILEQIRAGANIGQNTDSARMGMYVPQIAV
FT                   MNAAYFIDFMGAKTPDEVIEVLKKIKESDVMKKWLDELEQKYGFKVVSFMWVQGYRHFV
FT                   TNKPIRTPDDLKGLRIRTPGAPIWQESIRALGAQPVAVNFGEIYTAVQTRAVDGAELVY
FT                   ANVVAGALYEVLKYMSETGHILLINFEVVSAKWFNNLPEEYQQILVEECDRAGIETSLK
FT                   IMKELEESFKQQAVEKGIEVITDVDKEAFMKAAEKAYEKLGLVEARNALMEAIKVK"
FT   sig_peptide     complement(58605..58676)
FT                   /locus_tag="Tlet_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(58811..59737)
FT                   /locus_tag="Tlet_0055"
FT   CDS_pept        complement(58811..59737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32627"
FT                   /db_xref="GOA:A8F393"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F393"
FT                   /protein_id="ABV32627.1"
FT                   /translation="MKIYEYDKTLPLNVETIDLGCYLLVSFDAVYDPAIPQSKRVYVYV
FT                   YKAKKAWMNLIFLHGIGNGNIPYLLWFAEYFKLHGINTFFMVLPYHERRGMHGWKGGEP
FT                   FFSPSPSYCINRFHETVKDVRRTIDYIDSISDLHTSIMGFSFGGMIAVMSLALDKRLKK
FT                   GVLAFTGGDWRWINWHSPYTEELRKNYRLNGNEYGCRDENDCLKNRDAMKNLKKPDSLD
FT                   DIFLLSPKCFHYDPCLYGMFVNQEILFFRGIFDRIIPLRSSEALFKSLPKVKKIVLPCG
FT                   HRSSYFFRKFIANRVIKFLKNTPNPLI"
FT   gene            complement(59744..62113)
FT                   /locus_tag="Tlet_0056"
FT   CDS_pept        complement(59744..62113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0056"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: tma:TM0822 phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32628"
FT                   /db_xref="GOA:A8F394"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:A8F394"
FT                   /protein_id="ABV32628.1"
FT                   /translation="MLVATEWLREYVDIDWTDEEIASKLTIAGLNVANVIDSPIRGKIA
FT                   CGIVHEVSPHPCSEKLHVCKVFDGDSVHTTITSDMNICKGTKVPVAFPGTTLSDGRIVE
FT                   AMDIKGITSEVIMCSLQELGLEEKSECVYQIREEIPVGTDLIRYWKLDGKVLDIEITPN
FT                   RPDCLGVIGVAREMAVLSGRPLKKPSVDYTESDKPVNDMVSVSIEDVDGCPRYCAAFME
FT                   SVKAVSSPVWMRRRLMSAGIRPINSIVDAANYVMLETGHPVHTFDYSKISSGRIVVRKA
FT                   NKSERVLLLDEREYSLHGIETLITDGEKVLAVGGVMGTADSGVSDKTDSLLLEVAYFNP
FT                   VRIRKTSRSMNIKSDASYRFERGVDPNDVDFVMKRLIKVIEETSGGVAARGFVDKYVHK
FT                   IPPRTVFLRDSKLSRILGIDIDQSSVEHILSGLDFVTERITDGWKVLIPTFRPDISIEE
FT                   DLIEEVGRIYGYEKIEGKMLRIPVKSTGFGELQRFRKKINQLLIASGFDESINLSFCSS
FT                   SVVKKLVKMEPVRLKNPLSEDMDCLRPSLVFGLIDSVAYNLKRQLRDVKLFEIAKVYNF
FT                   ESGTVCEREKIGLVMTGKLNEDDYTDYRTVSLLNLKGVLDELASHLSVQFEVAEKEMPF
FT                   FVPGRSAEIFLNDKSVGVMGMLSGDFNDFYDFKGDVYFMELDLQVIFENRRIFKQIGNL
FT                   SSFPSVRRDISLLAPVGFNCGKIVSHLKQSSEYVEKVGVSDIYRGKDIPQDVLSITFYV
FT                   VYRAPDRSLTDEEVNDLFEKTVSEIETRFNLKRRFS"
FT   gene            complement(62128..63132)
FT                   /locus_tag="Tlet_0057"
FT   CDS_pept        complement(62128..63132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0057"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein; KEGG:
FT                   tma:TM0821 phenylalanyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32629"
FT                   /db_xref="GOA:A8F395"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:A8F395"
FT                   /protein_id="ABV32629.1"
FT                   /translation="MFEQLREQALREINAATDLQQLEKIRVSLLGKKGTITEQMKNIAS
FT                   LPVHERPGAGKILNELKDAVQRAIEQKKEMLKKIESQIIARKYWVDVTLPGARRNVGHR
FT                   HPISLMLEEIESIFVSMGFKVVEGPEIEDVWHNFDALNTPEWHPARDEHDSFYINDLLL
FT                   RTHTSPVQIRTMMSAKPPIAIISPGRVYRRDYDATHLPMFTQVEGLYVDENVSVGHLKY
FT                   TLERFAQMVFGSERKIRLRPSFFPFTEPSFEVDVSCGICNGKGCQACGYTGWLEILGAG
FT                   MVHPNVFKSVGYDSEKWTGFAFGMGVERIAMLKYNIKDIRDFVKNDKRFLEKF"
FT   gene            complement(63065..64096)
FT                   /locus_tag="Tlet_0058"
FT   CDS_pept        complement(63065..64096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0058"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tma:TM1103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32630"
FT                   /db_xref="GOA:A8F396"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:A8F396"
FT                   /protein_id="ABV32630.1"
FT                   /translation="MKIVPVFLPQMGCKKRCLFCDQRSATGFSQLPSIEELNKMINKYI
FT                   APDERFEIAFYGGTFTALPVLLQKRYLAWADEYIRKNVCDGIRISTRPDEINKENLIFL
FT                   KKNGVKFVELGAQSFCDDVLHESERNHSSKDIEKACTLLKELKIDFGLHLMIGLPGDEK
FT                   WKDLFSSWKTVENGAKTCRLHPTIVLKGAPLESLYLDGRYRAVRLDEAIDICSDMMAIL
FT                   ESNNVKVIRIGLFVPDELMKNIVAGPYHPRFGELVKGELLKKVVKFVDPELLIYTEKQA
FT                   SIVRNLDVKAIAGRELGFVVNKRFVSWKDALKEYVSGGVEDVRAIERTGTSRNQCSNRS
FT                   STT"
FT   gene            complement(64098..64814)
FT                   /locus_tag="Tlet_0059"
FT   CDS_pept        complement(64098..64814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0059"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: tma:TM1102 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32631"
FT                   /db_xref="GOA:A8F397"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F397"
FT                   /protein_id="ABV32631.1"
FT                   /translation="MNKEEAKILIDFMEKIGYRFYEPELLYNALCHSSYAHEQKQRGRK
FT                   DVESNERLEFLGDAVIDLLLAEYLYLEFPEASEGVMAKVKAAIASEEALAQIARDINLG
FT                   RYMFLGRGEEVSSGRERDSLLADMLEAVVAAVYIDGGLTAVKKVFLSYFAKYAKEVVEG
FT                   KIVFDYKTSLQEITQARYRKLPEYVLVNEKGPSHMKKFTVELRLSGKLIAVGEGPSIKE
FT                   AEKEAARRAIEKLKGD"
FT   gene            complement(64811..66700)
FT                   /locus_tag="Tlet_0060"
FT   CDS_pept        complement(64811..66700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0060"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; Transketolase
FT                   central region; KEGG: tma:TM1762 transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32632"
FT                   /db_xref="GOA:A8F398"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8F398"
FT                   /protein_id="ABV32632.1"
FT                   /translation="MKTFNKHDIKKLKQIARLCRGDILKMTYVANSGHPGGSMSSLEIF
FT                   LSVFSFANLNPDNPYDPLRDRVVVSHGHTSPGVYSVLGRLGFVDIDQVIAGFRHHSSIF
FT                   EGHVTRGIPGVEWTTGNLGQGLSAGVGFALAAKMKEQDYHIFVAMSDAEQAKGQVAEAR
FT                   RVAKKYGLSNLTVVIDYNDAQISGRARDVMPVNIRKNYEADGWRVLEVDGHDIEQLLHA
FT                   LSQAVEDKVNPVAILAHTIMGKGVSFMENDVSYHGKPLDKEQLEKALNELGIDNDVEKY
FT                   MKMRAQLGNQKHEPFHLEYPVKIKVPAGRTYTTKTDNRSAFGNALLDLVKENRNSETPV
FT                   VAVDCDLATSVKLDGVQKYVPERFLELGVQEHNAAAVAGALSADGVVTFFADFGVFGVS
FT                   ETYNQHRLNAINHTNLKVIVTHCGLNVGEDGKTHHGLDYISAPANWLGYKVIVPADPNQ
FT                   TDRVIRYIASVYGNYLVAMGRAKMMPIVDENGKLFFADNYRFEYGKIDILRKGTDVTVV
FT                   TCGSVVPNVVEAADKLRGKVSVLNVSCPLDLDEHVLREYGHGKKILVVEDHVATLGLTS
FT                   LLAKFFLQKGIIPSSFEQIAIQEHAVSGSYEALYEIYGLSSTKIAEKLGQMIS"
FT   gene            complement(66724..66945)
FT                   /locus_tag="Tlet_0061"
FT   CDS_pept        complement(66724..66945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH1226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32633"
FT                   /db_xref="GOA:A8F399"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A8F399"
FT                   /protein_id="ABV32633.1"
FT                   /translation="MIQISRILIVLGLILIIVGFSIYLIGRFTPLGRLPGDIVIKRERF
FT                   VFYFPLTTCLLISATLTLIFLLISKFWK"
FT   gene            complement(66929..67747)
FT                   /locus_tag="Tlet_0062"
FT   CDS_pept        complement(66929..67747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0062"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: tma:TM0772
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32634"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A0"
FT                   /protein_id="ABV32634.1"
FT                   /translation="MIAIVYAIEIFPKGKLFYYSENGEDIKPGDLVLVMTEFGPDVGKV
FT                   IKGPDEMGIEEIGSELRPVMRKLTEEDTKIYSENLKDAEQAMQICLEKIKEHNLPMKLL
FT                   HTRYMFDRSRLVFFFSSETRVDFRELVKDLARIFKTRIELRQVGVRDELKFIGGLGLCG
FT                   RPTCCSTFLREFDSITLKHAKCQQLMINTAKISGACRRLLCCLMYEYDFYEEALADIPS
FT                   EGETIIYEAKNCKVQSIDVFKEKVLVISEEGEMINLPFSYFRGDARDPDK"
FT   gene            complement(67760..68635)
FT                   /locus_tag="Tlet_0063"
FT   CDS_pept        complement(67760..68635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0771 probable DNA polymerase III gamma
FT                   and tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32635"
FT                   /db_xref="GOA:A8F3A1"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A1"
FT                   /protein_id="ABV32635.1"
FT                   /translation="MEKLLSTVKDFLIRNIGSSVCLKSRDESLLKWTCEQVIREVTNEF
FT                   LEFEAPGIDDIRYMSQFLYTSSSDGYKIVIIHRADRILHEAANSMLKILEEPPVYSEIV
FT                   LTSAKYTDLLPTIKSRVKVFNVAIDRQILNNLERKKASLVKPDLILSLAENDFEVLDFV
FT                   MKSDQFPQNNDFDPKAICNIFSKEEISAADKVSAILMIDDLYEKLSLVSEETLVKFYDD
FT                   MMSNLSRADLNRTIVHLCRLLQIVAEYRGCTELSLFKWIDSILTNRLMNFNGTLTLLNL
FT                   FLVIRENAKR"
FT   gene            complement(68643..69098)
FT                   /locus_tag="Tlet_0064"
FT   CDS_pept        complement(68643..69098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0064"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   tma:TM1646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32636"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A2"
FT                   /protein_id="ABV32636.1"
FT                   /translation="MRINPLEDGKFRSSEVKKKKKIKFKSSSAVRSMDSTSFFEVLEEA
FT                   EEEKLDELLERLIRQVVKSGNNLVRSPTQENFRSYRESIKDFLKVIEKKLYKIGKQLSS
FT                   VDLHLIVQEVDNRLEKIAAELFEAERGAILLSARVQEIYGLLMDLYR"
FT   gene            complement(69103..70143)
FT                   /locus_tag="Tlet_0065"
FT   CDS_pept        complement(69103..70143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0065"
FT                   /product="putative translation initiation factor, aIF-2BI
FT                   family"
FT                   /EC_number="5.3.1.23"
FT                   /note="TIGRFAM: putative translation initiation factor,
FT                   aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related; KEGG: tma:TM0911 methylthioribose-1-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32637"
FT                   /db_xref="GOA:A8F3A3"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3A3"
FT                   /protein_id="ABV32637.1"
FT                   /translation="MNFKTLTMQWTGNSLILVDQRKLPHVVNYVECKSYAEVARAIKDM
FT                   VVRGAPAIGATAAFGYVLGAKEAATLKNQNFIDVMKNVYDVLASTRPTAVNLFWALNRM
FT                   EKCVDLSKAVDEILEDLEKEAIKIAEEDIRINKTIGTHGQTLLKDGCAVLTHCNAGALA
FT                   TVDYGTALGVIRAAVESGKKIKVYVDETRPYLQGARLTAWELLEIGVETILITDNMAGW
FT                   VMKQGKIDAVIVGADRIAANGDVANKIGTYSVAVLSNQHGIPFYVAAPTSTIDIKIKNG
FT                   SEIPIEERSHDEVTHVHGVKVAPDGVAVYNPAFDVTEHQLITAIITEKGILRPPYKENI
FT                   AKLFGG"
FT   gene            complement(70140..71171)
FT                   /locus_tag="Tlet_0066"
FT   CDS_pept        complement(70140..71171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0066"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: tma:TM0912 basic membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32638"
FT                   /db_xref="GOA:A8F3A4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A4"
FT                   /protein_id="ABV32638.1"
FT                   /translation="MRKVFMFGLILILSLVAIGQETQPATAVVAEVNGVAITMEELNRE
FT                   ANVDRLLSQIQSVDATFYDVLVNTSEGVNLLLRYKREVLNNLIDQVLIKQIGEKMGVTV
FT                   SKDNIENMVSTELNKTLTQYGMTESDLDWYLKQAGLGDINSFKDRLRWIFTVQQTVSLI
FT                   QQQVTSSATVTEEEARQFYEQNREYFAVEEAAKLLRITVDSKEKADKALERIRAGEEFS
FT                   QVASDVSTDPLSKGKAGDLGWVERGSGLISEEIEEKIFVSPKGAILGPLQTSVGWEIYR
FT                   IIDKRPKGYENFEDVVNDIYQHLIQQKAQQLWQTWINEQFIPFKNSSVINIYLLSEGGQ
FT                   EDQ"
FT   sig_peptide     complement(71112..71171)
FT                   /locus_tag="Tlet_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.958 at
FT                   residue 20"
FT   gene            complement(71168..71944)
FT                   /locus_tag="Tlet_0067"
FT   CDS_pept        complement(71168..71944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0067"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; KEGG: tma:TM0913 mazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32639"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A5"
FT                   /protein_id="ABV32639.1"
FT                   /translation="MSEIGEQFQKLVSIMQKLRSPDGCEWDREQTHHSLKPYLVEEVFE
FT                   LIEAIDQSEDEKLKEELGDVLLQVIFHCQIASERGAFNISDVVTFLSEKLVRRHPHVFS
FT                   DSPGYSYEQWERIKSSEKGEQKSSAIGRLNHALPALSLARRIQENAAAVGFDWPDISGA
FT                   MEKVKEEVGELEDAIKSEGRQELEEELGDLLFAVVNIARFLQLDPEIALRKSTRKFVER
FT                   FQMVEEFVRERKLDLKKLSLDQLDELWEEAKGGKIK"
FT   gene            complement(71946..72593)
FT                   /locus_tag="Tlet_0068"
FT   CDS_pept        complement(71946..72593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0068"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   tma:TM0914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32640"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A6"
FT                   /protein_id="ABV32640.1"
FT                   /translation="MGWITGKKEQEIIAKVMNHLDMISVELSELRKLVEKYLNHEIDEI
FT                   DQCAEKVRYYEHQADIIRREAETSMYSGAFLPNFRGDLLGVIESVDKVANRAEYVADIL
FT                   ELEHPVIPDVLSSQLMKLLDICIETYEALKIAIGDLFEDLEKVKEHVLLVEQKEHEADN
FT                   VERCLIKQIYKLDISHGHKFELKELVQSIADISDRAEDCSDRVEVVSMKRRV"
FT   gene            complement(72595..73530)
FT                   /locus_tag="Tlet_0069"
FT   CDS_pept        complement(72595..73530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0069"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: tma:TM0917
FT                   phosphate permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32641"
FT                   /db_xref="GOA:A8F3A7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A7"
FT                   /protein_id="ABV32641.1"
FT                   /translation="MSIIYLMPGIFIGIILGANDAASIFGPLVAVGSVRYRTASIFSAI
FT                   FVILGATVGGANGLETLNTLTVLERDQSAVATLAAALTVILMILIKAPASVSQAVVGSL
FT                   IGVAFLNGAETIRWDILIKIVAIWIITPLSAILISFSLYRLVAYFFRKLKNVRVQDLVL
FT                   QYANLMALCYSAYSLGANNVANVARSFVTGESNLVVAQLLGGVSIAIGIMFFSKRMTFV
FT                   IGKSIIVLDHFSSLISGLALATNVFVFSMVGVPVSATQSAIGSVVGTGMSRGQRLSSRK
FT                   TKIKIILGLVLTPSVSGIISVLLHLILRGG"
FT   gene            73653..74264
FT                   /locus_tag="Tlet_0070"
FT   CDS_pept        73653..74264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0070"
FT                   /product="AroM family protein"
FT                   /note="PFAM: AroM family protein; KEGG: pho:PH1049 AroM
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32642"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A8"
FT                   /protein_id="ABV32642.1"
FT                   /translation="MLFITIGESPRDDVVPELIDIIGKRNISYREIGLIDNVDSRLYTP
FT                   LNSQDILVSRKRDGSIAYVSHKWVSERLANLKLNDLGILLCTDDFENDRLILPYRVVRS
FT                   FFKALPKLDKMTVVVPEEDQRENAIKRWNNISNRLSCIAFSPYKPQMKATSFDLRDEQL
FT                   VYLDCIGFSLQHEKFFKDLTKGIVISARRILGNYLRCLIS"
FT   gene            74278..75816
FT                   /locus_tag="Tlet_0071"
FT   CDS_pept        74278..75816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0071"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bcl:ABC0564 oligopeptide ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32643"
FT                   /db_xref="GOA:A8F3A9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3A9"
FT                   /protein_id="ABV32643.1"
FT                   /translation="MRKLAAFLFAVVLSVAIFASPNYNSVIRVGSDQNPTTMDPAMYQD
FT                   LASAQVMRNVFETLVAYDADVKEIHPLIAESWEVSADLKEWTFKLKKGVRFQKGKFQNG
FT                   REVTAEDVKYSFEREISISPMVRLYMVEKVEVIDRYTVKIVLKYPYAPFLTVLTDIGAA
FT                   IVPKEECEGWGEEFTLHPVGTGPFKLVEWVKDSHMVFERNEDYWDEKPYLKQIVYKFIP
FT                   DKSVLTVALLSGEVDITSDILDQDIPKVKSNPNVDPIMVGGCNVYAVYLNSSKGPTTDK
FT                   KVREAFFRGIDVQQLVKVIFPNGTAEAAYGPIPTGSWAYNPNVKSFYPNYDPEKAKQLL
FT                   KEAGYENQPVKLTIYTPEDPNRRKAAVIIQSMLKKIGFDIEVQSLEWGAFTATTSKGEA
FT                   DAYTIGWTWYPDPEFFIFYMFHSSRKGTYGNGGGYNNPEVDKYIELGESSVDQNERTEY
FT                   YRKAEELIMKDMYYFPLWHKLVVNGVNKKVHGYKPSPDMTIRLYAPGTNVWVEQ"
FT   sig_peptide     74278..74337
FT                   /locus_tag="Tlet_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 20"
FT   gene            75862..76824
FT                   /locus_tag="Tlet_0072"
FT   CDS_pept        75862..76824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0072"
FT                   /product="Nickel-transporting ATPase"
FT                   /EC_number="3.6.3.24"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC0565 oligopeptide
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32644"
FT                   /db_xref="GOA:A8F3B0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B0"
FT                   /protein_id="ABV32644.1"
FT                   /translation="MTKYIIKRLLQAIPTLFFVILTVFLIMKMIPGDPAMVLLGPQAGP
FT                   EDIARFRQQLGLDKPVIVQFFLYLKRILTGDLGTSLVYRQDVLSLIFERLPTTIILSIC
FT                   ALFIAIVIGIPAGILAAIKHNSFVDLLVTSLSLIGISIPIFWFGMVLIIIFSLQLGWLP
FT                   AVGTGDFSKSIWDGLSHFILPSLALGILSTGTIARFTRSSMLEVLNQDYIRTAYAKGLR
FT                   RHLILYRHALRNALIPVITVIGLQLGNLLAGAVLTETVFALPGLGKLMVDGIFRRDYML
FT                   VQGEVLFTAMMYIFVNLAVDITYAFINPKVRQTYRGVTG"
FT   gene            76821..77636
FT                   /locus_tag="Tlet_0073"
FT   CDS_pept        76821..77636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0073"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC0566 oligopeptide
FT                   ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32645"
FT                   /db_xref="GOA:A8F3B1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B1"
FT                   /protein_id="ABV32645.1"
FT                   /translation="MRVPNKQIIFGLIIIIVNIFAAIFAPLIATHSIDEMDFSYIFAKP
FT                   GEGGHVLGTDDYGRDIFSRIIYGSRISLMVGVIAVGIGSLIGTLLGVVSGFFGGFLDAL
FT                   IMRFTDALLSFPYVLLAIAMMAVLGPGLFNAMLAIGIVMVPSFSRVVRSSVINVKNEEF
FT                   ILAARSMGASNLWIIFHHVLPNIVPTLIIYSSLNFAGAVISEATLSFLGLGIQPPTPSW
FT                   GSMLSEAKNYLQTAPHMAIFPGLAILITCLGFNLLGDGLRDTLDPRLKT"
FT   gene            77645..78817
FT                   /locus_tag="Tlet_0074"
FT   CDS_pept        77645..78817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0074"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: bce:BC3176
FT                   N-acyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32646"
FT                   /db_xref="GOA:A8F3B2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B2"
FT                   /protein_id="ABV32646.1"
FT                   /translation="MILKEVISKQIDSIKEELVKMSKKIFELSELSYQEKKSSRLLSDF
FT                   LENNGFTVERGVGGLETSFVAKIGEKKPKIALLAEYDALPAVGHACGHNMIGVMSCGAA
FT                   VGFKNAVKNIDFTLMVIGCPAEEHGAGKKDLIKAGIFDDIDVAMMIHPASMSTGYDIAY
FT                   AIKRYKIEFFGKSAHAAADPSKGINALDAMILLFSSIGLLRQQLPEKVRIHGIITNGGQ
FT                   SFNTIPEYTSAEIGIRALTMEEVNFLEDKLRLLVQGASAMSGCKNKITVEEEMPEVYVN
FT                   VPLANTLEKNYKLLGEKVTSRTYEQGVGSTDMGAVTQIVPAIHGYINITDGKDIPTHTR
FT                   EFAQAANSEYGYKAMIRATKALAFTIYDISSNKELLTEIKEYFSQRRRDF"
FT   gene            78814..79776
FT                   /locus_tag="Tlet_0075"
FT   CDS_pept        78814..79776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0075"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: chy:CHY_1126
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32647"
FT                   /db_xref="GOA:A8F3B3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B3"
FT                   /protein_id="ABV32647.1"
FT                   /translation="MKSLLTVEDLAVEFRISNSKLRAPDGISFSVMENECVGLVGESGS
FT                   GKSVTALAIMNLVPAPQGRIIRGKIIFEGLDLLAINKHPRGTKISMVFQNPMNSLNPNI
FT                   KIGKQLTEVLQEHYNLNYREAMERVIRVMQELGIPDPEKMIDRYPFEYSGGMRQRTMIA
FT                   MAVLCNPKLLIADEPTTALDVTIQAQIIQLFKKLKEKSRTSILFISHDLSVISQIADRI
FT                   IVMYAGKICEISPTTDLFRNPLHPYTAGLINSIPGANERGTKLMAIPGNIPDLTNPPEG
FT                   CRFHPRCSRKLPICSRKEPPVILYEQRSVSCWLYEGVNT"
FT   gene            79778..80716
FT                   /locus_tag="Tlet_0076"
FT   CDS_pept        79778..80716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0076"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH3645 dipeptide transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32648"
FT                   /db_xref="GOA:A8F3B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B4"
FT                   /protein_id="ABV32648.1"
FT                   /translation="MLRVENLSKNFPVEFDIFGKPKRFLKAVQDVSFQVEKGSVFSIVG
FT                   ESGSGKSTIARILSGIYNPSSGKIYYEGKILKDAKRIKDIQIVFQDPETSLNPRKTISF
FT                   IVEEGLLVHRSASRFERKKIVRDAIKSVGLTSDILKKYPHQLSGGQKQRVAIARSLVLK
FT                   PKLLILDEPTSALDVSVQAQILNLLMELKELYNLTYILITHDLKIVNHLSDQVMVLYLG
FT                   QIMEMGRCDSIIENPFHPYTKSLIESIPKPGENNLENFSLSGEMPSPLNPPEGCAFQTR
FT                   CPVAFEKCSKKPPLMNFRGRKVRCHLYNQEV"
FT   gene            80722..81651
FT                   /locus_tag="Tlet_0077"
FT   CDS_pept        80722..81651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0077"
FT                   /product="protein of unknown function DUF1177"
FT                   /note="PFAM: protein of unknown function DUF1177; KEGG:
FT                   pho:PH1050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32649"
FT                   /db_xref="InterPro:IPR009561"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B5"
FT                   /protein_id="ABV32649.1"
FT                   /translation="MLSQVETITELLDSPYVDGKKVCELFENYQGVKAEYETITTSRGK
FT                   TDIVRITIEGQQNDAPVLGIIGQLGGVGARPEMIGLVSDADGAIAALASALKLAQMKQK
FT                   GENLAGTVFVATHICPHAPTIQHKPVPFMDSPVGVRQALKLMIRRKLDAILSIDTTKGN
FT                   RIAKKKGFAISPTVLKGYILKVSDNLLDIYERVTGKEPFVLPITFQDITPYGNGVYHIN
FT                   SIMQPCTVAIDVPVVGVAITTQVPVAGCATGASSEVDIEQAARFCVEVAKYFGRGEVRF
FT                   YDKDEFKKIESLYGNLTFLVYAGEECDE"
FT   gene            81648..82205
FT                   /locus_tag="Tlet_0078"
FT   CDS_pept        81648..82205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0078"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: fnu:FN0555
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32650"
FT                   /db_xref="GOA:A8F3B6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B6"
FT                   /protein_id="ABV32650.1"
FT                   /translation="MNSELDNIGEKIRSLRQSKKLTVRELAKLSGVTPGLISQIEHGKV
FT                   SPSLSTLKAILSALGETIISLVEQDVGDQIIKGIVRKEERRKVIVSPGLTYELLSSKNN
FT                   AYSMFISYLEPGADSRESFYAHEGIESGIVIQGEVEITVGDKSIVLREGDSITYPSTIP
FT                   HRWKNVGNVTAVGVWVVSPPSF"
FT   gene            82250..82627
FT                   /locus_tag="Tlet_0079"
FT   CDS_pept        82250..82627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0079"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB;
FT                   PFAM: flagellar basal body rod protein; KEGG: tma:TM1364
FT                   flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32651"
FT                   /db_xref="GOA:A8F3B7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B7"
FT                   /protein_id="ABV32651.1"
FT                   /translation="MFNENFQIIKTAMDVAILRQNIFAQNIANAETPGYKRKYVVFEEL
FT                   LNQAMSMKMKTTDENHIQTEKSAVKPQIKEEESFFYRNDENGVDLEIEIAQMTANGLKY
FT                   EVLSRLMSKNIEYYNTVLRSA"
FT   gene            82629..83042
FT                   /locus_tag="Tlet_0080"
FT   CDS_pept        82629..83042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0080"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: tma:TM1365 flagellar
FT                   basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32652"
FT                   /db_xref="GOA:A8F3B8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B8"
FT                   /protein_id="ABV32652.1"
FT                   /translation="MNEFLIMNVSASGMTAQRLRVDIISSNIANSETTRTDRGTPYRRR
FT                   VPVFSEYLISDGKSASTGVKVVRIEEDPSPFRLVYDPSHPDADENGYVSLPNVNVLREM
FT                   VDLISAQRSYEANISAFNTTKSMINSALQIGRG"
FT   gene            83046..83339
FT                   /locus_tag="Tlet_0081"
FT   CDS_pept        83046..83339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0081"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="TIGRFAM: flagellar hook-basal body complex subunit
FT                   FliE; PFAM: flagellar hook-basal body complex protein FliE;
FT                   KEGG: tma:TM1366 flagellar hook-basal body complex protein
FT                   FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32653"
FT                   /db_xref="GOA:A8F3B9"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3B9"
FT                   /protein_id="ABV32653.1"
FT                   /translation="MVDKISGINQDLNSLNQTSEKKKSENDFAEIFKSAINKVNQIQKN
FT                   AEQMSADFALGKISNIHEVIIEAEKASIALKLTTEVRNRIVEAYREIMRMQL"
FT   gene            complement(83334..84623)
FT                   /locus_tag="Tlet_0082"
FT   CDS_pept        complement(83334..84623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0082"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: tma:TM1230
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32654"
FT                   /db_xref="GOA:A8F3C0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C0"
FT                   /protein_id="ABV32654.1"
FT                   /translation="MKIALVHFRAGETDGVSLEMAKWKRVLEKMGHDVFYISGDLYEAG
FT                   GVQISTISMRNQVNLWIHRNAFEKLSVDEKFFIRIFQKYVQQIRSELEAKAPPADIFIV
FT                   NNIFSLGFNLAAAVAIDQYVRENKVKVIGHHHDFYWERERYSNSQMGFVEKILDDYFPP
FT                   KNSNMMHVTINNIARNELISRKGVNSFVIPNVFDFDQPQWVIDDYNRDLRDKLGISDKD
FT                   FVLLHATRIVERKAIEIAMDFAEYLQKFVKKEVHFVVGGFPEKESLGYFQKLQKKAANM
FT                   KVKTHFAYPLLRQNRSNREEKFYSFWDIYAISDAITYTSVLEGWGNQLIEAVFARKPLI
FT                   VFEYPVYKTDIKPLGFDFISLSDAVVWNEKTGFYEIDKNILQKAAKKLARLIGRTEELE
FT                   KKVKQNFDVGKKYLSLESLEKRLDELMKNL"
FT   gene            complement(84620..85447)
FT                   /locus_tag="Tlet_0083"
FT   CDS_pept        complement(84620..85447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0083"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: tma:TM1228 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32655"
FT                   /db_xref="GOA:A8F3C1"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C1"
FT                   /protein_id="ABV32655.1"
FT                   /translation="MIFDYLLGIFDRLSDSEKKVAMYILERPDDVIHYSITEFARVVDV
FT                   SETTIYRVIKKMKFKGYQAFKIELIRQTSGVKSVPLTNMETLDEYVEEIKSLAERMKTT
FT                   LKKDDLQKAADWIVQSQKTIFFGVGLSSVVAEYGSLLLSLLGFSSFCYNDPHVQVIVAT
FT                   GLCKKDLVISVSHSGNIRDTVKSTQVARDVGARTVAVTAGINSPLSSVVDIALYSPVAR
FT                   FEKYEFLRGNLGEMAVLEILFKMVLKKIYGEKESHLNDLSEVLKPKMYSGGEQ"
FT   gene            complement(85444..86628)
FT                   /locus_tag="Tlet_0084"
FT   CDS_pept        complement(85444..86628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0084"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tma:TM1229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32656"
FT                   /db_xref="GOA:A8F3C2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C2"
FT                   /protein_id="ABV32656.1"
FT                   /translation="MIVEYVNEVHDLKKYDVLVGIPSYNNAETIANVASVAAKGCLDLN
FT                   LKALIVNSDGGSTDGTIDAFMNSDTFGVEKMSFKYRGIAGKGSAVRALLEAAHKVRAEV
FT                   FIMLDSDLRSVQPWWIERLASPIIHGKTDYVAPFYLRHKYDGTITNNICYPLTSVLYGL
FT                   KIRQPIGGDFGVGRRLIETYLSKPVDTWQTNVARFGIDIWMTTIAINESNKKPLQAALG
FT                   AKVHDVKDPGKHLQNMFVQVVQTLFDLMLAYEDKWKNVNKVEKCYVYGEQPNQIVEKIV
FT                   IDLPGLKEKARNFLKNRLEHISYLPWKIVDSVVNSGQIKVDDWVEIVYQVALHYKKTAD
FT                   EQAIVDLLPFYFARIASFVEETGGVDDCVAEEVIEKQLSVFLQLKPSFSKRWFG"
FT   gene            complement(86625..89165)
FT                   /locus_tag="Tlet_0085"
FT   CDS_pept        complement(86625..89165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0085"
FT                   /product="glycoside hydrolase family 38"
FT                   /note="PFAM: glycoside hydrolase family 38; KEGG:
FT                   tma:TM1231 alpha-mannosidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32657"
FT                   /db_xref="GOA:A8F3C3"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C3"
FT                   /protein_id="ABV32657.1"
FT                   /translation="MNHIICHTHWDREWFATSNITNSWLRELFERLFILIEKTPEYTFV
FT                   LDGQTLIIEDLLENFPEFEKKLVAAIKSGNLIIGPVYSQIDFRIASEAAIIKNFEIGLK
FT                   DMEKFGDLPKIAWMVDNFGFISQLSQLLRMYGIAAVFLWRGVGIENPTIEFVHESIDGS
FT                   RVLCVFLIGGYRNLYGLSLTKDIAKKRLIHEIKKLEPFSLTKQIPLLDGYDLDLSPEDP
FT                   FELLSRNGETVRSSPEIFLSHIDESLNIPVVRGEMLSGKYACVFPGTLSSRSYLKVEAY
FT                   YIEKMLRYCDFLSIFGGESVEDLWRRYLKTLIHDNICGVAIDKVHENMEKTYRELYRDL
FT                   KKFLLSKIGNYLGASNFKSGSYALCFSPHEYNNWYCDGRRCFFLKSKGVGFYRIEKVDR
FT                   YRNDNTLVWKNDFYRAELKNNGIMKVNDFSVGYLELLKEAGDSYSSFTSPLDFSCSVKS
FT                   IEIESAGLNHKIIKMKRKLRSRNAVIETEEKIVFDKTPLIKWSIVTTSKGKNYVLNFSI
FT                   KMKNSGSEVFAKMPFEIVRREKETYEFIDEELLERLKHVLIAAREVGKVDEYPFQGFVS
FT                   LSFPGRTVALMAKGLRSYRIDDSKLSVTLIRSVEWIAKKNVKGRIGDAGPLIYAPGAKC
FT                   DRTTRFELAVCDVNVNVKSTEFMKWFNLFDDQPLKIELKNNSCCRNNKILFLSKLPWVC
FT                   VKESKVFVYNPFDEIVEHILPGKISTVPLNPRKTAGEKNSVLVRFVDFPSFPSRAGKKT
FT                   SSANMQKAIKDKINKINEEIKNVKTKLKNIEKNTKEYRFLLHRFFTLYRTMLELKLSLP
FT                   LLKGRLPEKLVWKLNEVRSKKRISDYIVELMEEE"
FT   gene            complement(89162..90235)
FT                   /locus_tag="Tlet_0086"
FT   CDS_pept        complement(89162..90235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0086"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: tma:TM1232
FT                   multiple sugar transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32658"
FT                   /db_xref="GOA:A8F3C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C4"
FT                   /protein_id="ABV32658.1"
FT                   /translation="MARVVVQNVKKYFGNVKALDGIDISIEEGSFVVLLGPSGCGKTTL
FT                   MRCISGLEKLTEGEILFDGKNITNLAPKDRNVAMVFQSYAVWPHMKVKENIAYPLKLKK
FT                   VPKKEIEERVRWASDLLHISELLDRYPSQLSGGQRQRVAVARAIVHKPRVLLMDEPLSN
FT                   LDALLRIKMRSELRKLHEQVKVTTIYVTHDQTEAMTMGDKIAVMNAGKIIQYGSPEEIY
FT                   KAPRTLFVAGFVGSPQMNFLPMKVISHKDKFFAEGFGLQIPLKKDPGIESVIVGIRPEH
FT                   ISVEKRQDSIGFEASVYFVEKLMSETVIHLSVADDKKIVVKVPGDVSFKESQLVQVHLD
FT                   LPFIHIFNPVTEERIEF"
FT   gene            complement(90249..91043)
FT                   /locus_tag="Tlet_0087"
FT   CDS_pept        complement(90249..91043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0087"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM1233 multiple sugar
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32659"
FT                   /db_xref="GOA:A8F3C5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C5"
FT                   /protein_id="ABV32659.1"
FT                   /translation="MRKFFYVLAFAAICLWFIGPIFFVFLASLTPASEFYQMDRIFPEK
FT                   LTFEHIYKLLVNLGGWRALLTSVQVALISIAVSFALGIPAGYAVTRYIFPGKNFIKLTM
FT                   LFTRSIPLVVIAVSLVTIYLRFNLADTMIGVALAHAAMILPFVVLITSSIFSGVFVEYE
FT                   EAGMIFGLSRFGAFLKITIPLALPGLAASAIFAFIMSWNEVFAASVLAITDRTLPAHIL
FT                   NTAMASPDYFKFAAGTIMAVPAMVFIFIIRKYLISMWGISLK"
FT   sig_peptide     complement(90963..91043)
FT                   /locus_tag="Tlet_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.682 at
FT                   residue 27"
FT   gene            complement(91040..91894)
FT                   /locus_tag="Tlet_0088"
FT   CDS_pept        complement(91040..91894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0088"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM1234 multiple sugar
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32660"
FT                   /db_xref="GOA:A8F3C6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C6"
FT                   /protein_id="ABV32660.1"
FT                   /translation="MRREGITPMLLILPALAYLAVFIGYPIFGTFQLAFTNEKGWLENF
FT                   RYVFSSKDFQNAFLNTIILGLIIIPVQFVFAIMLALLVNKKWKGYQSLLYIIATPLALS
FT                   DVTAALISYSIFAPNGYLNKILLKLNWIDRPLYFFGYLFKSREFLVVILTEVWRATPLV
FT                   FVILLAGLQSINTEYLEAADIFGFSAWKKFIKITLPLLKPSIVSALLVRTLFAFQIFGV
FT                   VWLLAGRDITVLAGETYYWYVFMNNRNIASTYALIIAVLTFVIGWFYIGTIRSKHLEEG
FT                   VRS"
FT   sig_peptide     complement(91835..91894)
FT                   /locus_tag="Tlet_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.294 at
FT                   residue 20"
FT   gene            complement(91945..93207)
FT                   /locus_tag="Tlet_0089"
FT   CDS_pept        complement(91945..93207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0089"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tma:TM1235 multiple sugar transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32661"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C7"
FT                   /protein_id="ABV32661.1"
FT                   /translation="MRRFLIVMILAALVVFSFAKVNFGSTQMTPAAEREFMIRKLGEFS
FT                   KASGVDVEFLNFEYTDLLSRLEAEQKAGKPVLNLVADLQSGLYTMGANGLLADLSGVLL
FT                   SGKTFVQTFEKYTYVGKEKVFIPWLQATYAMAINKKAFEYLPKGLTMEDVTNATEKWTY
FT                   DALLQWAKNMQEKTRQPQLGFPLGPKGLWHRFLHGYIYPSYTGAQAVKFDSVKAIEMWN
FT                   YLKELFKYVHPACTTWDNMDQPLLRNEVLIAWDHTARIKQAIVEKPNDFVVVPVPRGPM
FT                   GRGYIIVLAGIAIPKNVDMTEPLKVLDFLTSPETQIAILENVGFFPVVQEAAGLIPEGA
FT                   LKVLAQGVVNQSAAKDSVVCFIPGLGAKGGEFSETYRLAFTRIVFNDEDPVKVIGELGE
FT                   KIRQLFIEVDAPLPEPDASLF"
FT   sig_peptide     complement(93148..93207)
FT                   /locus_tag="Tlet_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 20"
FT   gene            93612..93699
FT                   /locus_tag="Tlet_R0002"
FT                   /note="tRNA-Leu1"
FT   tRNA            93612..93699
FT                   /locus_tag="Tlet_R0002"
FT                   /product="tRNA-Leu"
FT   gene            93738..93814
FT                   /locus_tag="Tlet_R0003"
FT                   /note="tRNA-Met1"
FT   tRNA            93738..93814
FT                   /locus_tag="Tlet_R0003"
FT                   /product="tRNA-Met"
FT   gene            94172..94678
FT                   /locus_tag="Tlet_0090"
FT   CDS_pept        94172..94678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tva:TVAG_030630 viral A-type inclusion
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32662"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C8"
FT                   /protein_id="ABV32662.1"
FT                   /translation="MGENKLEQFLAGAEEFDLKSIKTKNRLLKKKIKALEKYLLYAERA
FT                   KTLLSELNELELVHKSLATLDSETLFKKAKELKSQTEQMRTLVALLSEHIEQLNKIDEM
FT                   MVESKKLAHILEDAMSVDLNNLKQENHHLEALIPTLQQNVDLLESYKKLSEEIKEMRKE
FT                   IKDND"
FT   gene            95338..95774
FT                   /pseudo
FT                   /locus_tag="Tlet_0091"
FT   gene            complement(96217..96654)
FT                   /locus_tag="Tlet_0092"
FT   CDS_pept        complement(96217..96654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32663"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3C9"
FT                   /protein_id="ABV32663.1"
FT                   /translation="MIKQPERFSPSKSFFRMVNYFIEEARFWLKDAKGNFIDYQLELES
FT                   EFGEITRQNGSFSRSVILGVHIEGKQKDVQVHNIYVKIKGNFEANIEENNEDLFDKVCK
FT                   YNGLMNLLIIARSFIATTTAQMGVHPVLIPMVNLTKVEIKG"
FT   gene            complement(96651..97046)
FT                   /locus_tag="Tlet_0093"
FT   CDS_pept        complement(96651..97046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0093"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   tma:TM1330 LacI family transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32664"
FT                   /db_xref="GOA:A8F3D0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D0"
FT                   /protein_id="ABV32664.1"
FT                   /translation="MREFKKYSNVFELFEEIGFHHSEEEKAFIEAMSQIGGQLMAYRKK
FT                   HNLTQKDLAKKLGISQSMVSKIETGEKNISIRVLTKIVAAFGGRVRISLGILPEEEENK
FT                   VPEYKFREAFPNDIPYTSFETQGSVAA"
FT   gene            complement(97060..97419)
FT                   /locus_tag="Tlet_0094"
FT   CDS_pept        complement(97060..97419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM1329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32665"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D1"
FT                   /protein_id="ABV32665.1"
FT                   /translation="MGRKIVASEEFHKEFKELIERYVPKRRMNKLILKYETLIKILVDE
FT                   GEKAITQPYFEKLKGTGDVELYSLRLEKKNPNIRIIFSFWKNHVVLLSAFLEKEVSDYD
FT                   KAIDKAKKRSSNLHL"
FT   gene            97766..97975
FT                   /locus_tag="Tlet_0095"
FT   CDS_pept        97766..97975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32666"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D2"
FT                   /protein_id="ABV32666.1"
FT                   /translation="MEDETTYQIKEKLVTGYNLREPLKQKMIEDLQKAELTNRIKELKE
FT                   FLAENIIDVKLFENHGCMQNYIYF"
FT   gene            97994..98293
FT                   /locus_tag="Tlet_0096"
FT   CDS_pept        97994..98293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32667"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D3"
FT                   /protein_id="ABV32667.1"
FT                   /translation="MDLQALQWLDPLVGVVNATDIIDFILNFEDVIRRGKKVPDIFFFS
FT                   IVEYMLFSQTLSVQSLSYNLIDSLIYELFFKEKFHQDGLYPEPKNTCWKQSQNT"
FT   gene            98639..100621
FT                   /locus_tag="Tlet_0097"
FT   CDS_pept        98639..100621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32668"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D4"
FT                   /protein_id="ABV32668.1"
FT                   /translation="MNRNKFVPELHDIGKLVDDQVKKQLQNQIGQSWKGHVFAKFDFQK
FT                   FGIPQPTSPSWWGQYHHETSEVHKDINQWDLRDSLGKIASPEDKYHLFLLIIADHLASS
FT                   VSRAVGGRGPKSPSGIYKLWNNNFYQQQKIGRYWAAFKTIDDLKNLFDEIENCQSGEEF
FT                   LNKYKEHLLLTPEDKSIPRNVTSLYTHVELVGKIYRVLEKNTELATESDDPIAIVYNGM
FT                   KVKTIKEAEGGKRTTGTNDTDKGKWQARLAKCWIRFPHSFVRLQDINLLRKREELVNCI
FT                   ANYYKDEVIFAISDFIILFLPPNQNLKEILKPFLDWGFHIEVEETLANLGILNSILDRK
FT                   TLRARQTNDQARLSVFTNRRTKVYKRYLVSELPEEIEPPICDICQQRSGVERIKENIRE
FT                   WVCYRCQEIREMGEPFREYATVWEEEGVKVCWLKFSLNQSKLEKWLQNAFEEYIDHYMQ
FT                   ANDLKEEFRPLALQVDFNKDYKEMLKEFWEDFSRVDDIKKPIVEYDELGVFKYSPELAK
FT                   KVIDNFSTVFSKYFPDCISNENSPISLSLSIANIKYPIRDHWRFFEENNKSFLNVHYHK
FT                   VFTEKYTKDELDVIIGKALNVETSSSFLYKLVQLEEILQSEIHIAVEIFNNRKKYSEIY
FT                   ELFSKGIKPSKFLNLYRLLRGGECE"
FT   gene            100614..101240
FT                   /locus_tag="Tlet_0098"
FT   CDS_pept        100614..101240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32669"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D5"
FT                   /protein_id="ABV32669.1"
FT                   /translation="MNKELLELKLEIDSLIIGERVKGGIFRPCQDTIPSSTIEGALKHH
FT                   FGVEIPAVGFFEENTYEFDEFTYSVRDKFLNISKMPIITTYLRPKNDKIKAKVYIPLYK
FT                   GDNLKDELKDTEFQLGALKSKGFGKSKIVEVKKIESGIKQGILKVKVFEEEAKDFGIEL
FT                   ISSVYGYLFKPDSFSIGGTYKRALFPGSLVKAPEVLLKEVTYYDE"
FT   gene            101230..101814
FT                   /locus_tag="Tlet_0099"
FT   CDS_pept        101230..101814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32670"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D6"
FT                   /protein_id="ABV32670.1"
FT                   /translation="MTSKIDGVFRKVLNDREIFDSPYDRNKRNNIPKLFEKDSWKELER
FT                   LFNEGKRDEFISKVDSRITEIKNQEQTTNNWRREKINELKQRGEWLKLAFDNKPHLLKQ
FT                   LFESLEWYGLVNCNLPDMNSYGRVIERYNISTIEQYFLDGIRRTSYPQNKALEKVLEYV
FT                   KELYTAGISSEEIAYFVRKLESLTTYWEVIG"
FT   gene            101811..102659
FT                   /locus_tag="Tlet_0100"
FT   CDS_pept        101811..102659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0100"
FT                   /product="protein of unknown function DUF324"
FT                   /note="PFAM: protein of unknown function DUF324; KEGG:
FT                   cth:Cthe_2051 CRISPR-associated RAMP protein, SSO1426
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32671"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D7"
FT                   /protein_id="ABV32671.1"
FT                   /translation="MSEEINGQAKKIEFKEEGKIKISELPLKIEVAGGSFLHIGAAPSP
FT                   LTEKKGAIFKVDRTPVIPATSFKGALRHQLELLFAEKADEFAQLFNIPDDKKDLLKPCI
FT                   PSPRPTKAEEELVNAGKYRKEHCEIKVNEEQINVGNNGICPVCYFMGAAGLMGFLRFSN
FT                   FYPESEGDIIDQTNIRIDRKTGTAARGAKVEGEQVKPGTVFKGIISIVISEPILEQFGD
FT                   ARKIGNVVIDKWLEHWQETDKEKRAKALIEEILLPAIKNIKMLGGQKSRGAGKVNVEID
FT                   G"
FT   gene            complement(102942..103400)
FT                   /pseudo
FT                   /locus_tag="Tlet_0101"
FT   gene            complement(103920..104603)
FT                   /locus_tag="Tlet_0102"
FT   CDS_pept        complement(103920..104603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0292 putative HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32672"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D8"
FT                   /protein_id="ABV32672.1"
FT                   /translation="MVYVISKDSKPLMPTKRHGKVRRLLKQGLAKVVRREPFTIQLLYD
FT                   TTTYTQPITVGVDIGSKVIGVSAITDKQELFSAEVELRQDIKKLLLERREYRRNRRYGK
FT                   TRYRKPKDANHVSTIGWHIVNRLKQQYDVEITFGSITKAKRTEMGLEKTHRNDAFVIAG
FT                   GSKDVNRATEWYFGKYFRRQNTSLHKANLIKGGIRQSNTVKEVKGFKRFDRVRYNDQIG
FT                   MRWIL"
FT   gene            complement(104862..105692)
FT                   /locus_tag="Tlet_0103"
FT   CDS_pept        complement(104862..105692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0103"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: tte:TTE2419 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32673"
FT                   /db_xref="GOA:A8F3D9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3D9"
FT                   /protein_id="ABV32673.1"
FT                   /translation="MTGDVQTIIKANQKQFTKKENELAQFVIDHPDEVIHMSITEIVDE
FT                   LRIGQGTVVRFCQKLGFSGFHPFKIALAKSLGRQEEASEGSKDMLAMVKEDHIKAIEET
FT                   SKLLKLNEKVVYQCAEKISNCRRLYLLGVGASGVTALDAYYKFMRIGVDVKYMLDPHFQ
FT                   AMSLSGCNEKDCVVAFSQSGSTAVVVDMAQIAKQNKACVIAVTGYNKSPLTFYADFVLL
FT                   TAVRENPFQSGAIRSKIAQLHVLEVLFEQTKLLLADKAKQNVDRTARSVEKWIY"
FT   gene            complement(105698..106579)
FT                   /locus_tag="Tlet_0104"
FT   CDS_pept        complement(105698..106579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0104"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: sth:STH602 putative
FT                   glucose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32674"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E0"
FT                   /protein_id="ABV32674.1"
FT                   /translation="MSPLLLGIDIGGTAIKGGIVEKSTIVWKTVELIEMKNPFETLVYV
FT                   IGKLVEHADTRPEAIGIASAGRIDSEKGIVVYATSNLKNWSGLDLAQKINSRFHIPTFI
FT                   INDARAAALAEAGSRNVSNMVLLTIGTGLGGGIVVDGKLIEGAHWQAGEIGHTILYPDG
FT                   RRCNCGKKGCAEMYISMKVLHRYAKEKDRERLIEKFKQKDENTVIAVEKMCRDIAVLID
FT                   RIFLTIDPQVVAIGGGFCELGSNALEILRKCVEPYSSKSLYNTSQVDLSILGNDAGIIG
FT                   AVIYAKDRISRS"
FT   gene            complement(106585..108021)
FT                   /locus_tag="Tlet_0105"
FT   CDS_pept        complement(106585..108021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32675"
FT                   /db_xref="InterPro:IPR025394"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E1"
FT                   /protein_id="ABV32675.1"
FT                   /translation="MRIIFLPVDNRFCTKDYFMLLSKAFNFDVLCPEDLGCKKIPADTE
FT                   YISHWLLANAREGDLLILSLDMLLHGGLVPSRIDRLQIETLLGKLEILEKLKKIGTKIY
FT                   ASRSITRIPTYNSDEEEPDYWMYYGEKLYRYSLSLSNGDKRNFSDIPGWVIEDFLWRRK
FT                   RNLSVSKEIINLVKNGVIDYLSLMMDDNSEGSLVAKEAKELNDFVERSGLSKKVSIRNG
FT                   TDEISLVLLSRALCDHFDIRPRFTVKYTFPDCKNLIPPYESSPLEASVQSHISGSGGVL
FT                   SDSEADILLYVNNFNEYEKIREAPFQEKTRSTISNQTFDMQKVLGLADVRFANGSDRAF
FT                   VENLLDMKIDWTRACYYGWNTAGNTIGSTCAHTIFLYLSHKKLININEDEIKRYQAILI
FT                   LEHYGYQSDIRQRLVEFVRQKNSCSYFLPDENWAVNFVEREIQEYVEKLNKVFKRSWKA
FT                   SVYFPWHRTFEIGIVLNETR"
FT   gene            complement(108027..110912)
FT                   /locus_tag="Tlet_0106"
FT   CDS_pept        complement(108027..110912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0106"
FT                   /product="protein of unknown function DUF187"
FT                   /note="PFAM: protein of unknown function DUF187; KEGG:
FT                   cyb:CYB_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32676"
FT                   /db_xref="GOA:A8F3E2"
FT                   /db_xref="InterPro:IPR003790"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E2"
FT                   /protein_id="ABV32676.1"
FT                   /translation="MTVKRILVFLLVLLVTEQVVLATNVGIFYSPTSEKYYGSSTYKTI
FT                   IDGLIEALEFGKINYDIINSLDGYIPENIKVLIDPSNAALTDSEVSVVENFILNGGKLL
FT                   AAYESSLRFPDGKLRMNYAYGDFLSIKFKSWGSGKYYFLQPTDDGEKVFNVSNIINLPR
FT                   GFAFLVETTENSTPLALWVKEDKTIVDEKFPSAAVLTQFGIFFGENIYLHTSVSDEIKI
FT                   ILVNAVKFLAQMPPAEVDFMEYERKKLSSKIFDFEQAISEQYEAFPERARELEEKVKNF
FT                   KAKLYAASDINSIKELKKELDLLQIGLLKKYSIQTRGIWLDNQSIKKTGSPERLRETIR
FT                   KLHSIGFNMIIPEVIYKGKTMASKLSYFPQDDDFQRWSEDPLQVIVDEAKKLNIEVHAW
FT                   CWVFAASSGGEENYFIKNFPDWIEKDKYGNIFTKNGTAWFSHSNPQTREYLIDGILEIA
FT                   KKYEIDGINLDYIRYDGDEMGYDEHAVKSFMKETGVDPYKIEKYSKDQVIWHMWREEKI
FT                   NSFVEELYKRAKALNDRLLISADVYPSLSGARNEKKQNWEAWVRNKYIDALIPMNYKGS
FT                   IEDLKIVLEMQTKFKNMVYLYSGLQMINLKSTEDLIEQIKTSINYLSSGIVLFSLSYLD
FT                   RYDEDYIRNIFGVEAICAHSEINSLVKAFERKLHEDLALCQDLGLSESEVNIVLEKWEK
FT                   IEFGNDVGNIFSQLSEFFYYISDNIKNPKAALILSDEISWMMDILRPKVYKAMPVEKFV
FT                   PEKPVDMIVVDNIKPLPKVIVPFGHAKVDGIFDEWKDIDELSRFFVYDTGEIFQPYTSV
FT                   KVMYDDANLYVQFLCEEPYMNDVKKVSGPRDTRTYLGDSVEVFILKNERDREYYHFVIG
FT                   IDGTIYDEKGLDSKWNGDIEAITTLSDNLWCAEIRINLRTIGLEPVEGGILKANFTRNR
FT                   WRAGKPQYSCWSVTYGSYHTIERFGTLIFGE"
FT   sig_peptide     complement(110847..110912)
FT                   /locus_tag="Tlet_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.518 at
FT                   residue 22"
FT   gene            complement(110918..111742)
FT                   /locus_tag="Tlet_0107"
FT   CDS_pept        complement(110918..111742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0107"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM0812 multiple sugar
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32677"
FT                   /db_xref="GOA:A8F3E3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E3"
FT                   /protein_id="ABV32677.1"
FT                   /translation="MRGRKILRCIFTYLILIVVALFFTFPFLWVLSTSFKGAENIFTWP
FT                   PEWIPKKPTFENYKAVFERIPMIRYFLNTLIITAIGVVFQVVLASLAAYPLARLEWKGK
FT                   DLIFKLILLPMLIPMQGALIVNFITIIKMGLYDSYFGVVLPGAVSIFGIFLMRQQYFSV
FT                   PKEIEDAARIDGCNEFQVFWKITFPLVRPGTSALAIFAFTSYWNSLLWPLVVLRSPDKY
FT                   PIQVGLAQLSSTFEPNFRTASAAMVLAMVPILIFFYFTQRFFIEGYKGAVIQ"
FT   sig_peptide     complement(111632..111742)
FT                   /locus_tag="Tlet_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.341 at
FT                   residue 37"
FT   gene            complement(111739..112617)
FT                   /locus_tag="Tlet_0108"
FT   CDS_pept        complement(111739..112617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0108"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM0811 multiple sugar
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32678"
FT                   /db_xref="GOA:A8F3E4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E4"
FT                   /protein_id="ABV32678.1"
FT                   /translation="MALSRKKQVYLIVFAFLIAPLTLLAIFTYYPIFRGVFLSFTEYNM
FT                   LLQTGKWVGLKNYISLFQDRYFYMALGNIFKYLLVVPFIQFFSILLAVAVNQRIPGIKI
FT                   FRTLFYVPVITGAVIVSMAWKWIFNVDGILNNFLMNAGLIKEPILWLTDARFAIYSAMF
FT                   VTFWRGLGYYMVIYLAGLQNIPSEIYEAARIDGANRRQTFFRITIPLLRPTMLFCFIIS
FT                   SLAALKVFEEIYLLTQGGSETTTMMYLIYDYAFNRYRFGISAAASVVFSLILLVFTVIN
FT                   FKFFGIGGEKG"
FT   sig_peptide     complement(112540..112617)
FT                   /locus_tag="Tlet_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.563 at
FT                   residue 26"
FT   gene            complement(112675..113922)
FT                   /locus_tag="Tlet_0109"
FT   CDS_pept        complement(112675..113922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0109"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tma:TM0810 multiple sugar transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32679"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E5"
FT                   /protein_id="ABV32679.1"
FT                   /translation="MKRFLVFLMVLLVAVLLAKTVTVEFWTLSLSPTFDDYIKAIIEEF
FT                   ESQNPEIKIKWLDVPYGSAVQKLTAAIAARQAPDVVNLNTTWAIDFAAQGALRPLDDLI
FT                   NHEDKELYWEKLWKATVLNGNSYAFPWYASIPILMYNRDMFERAGLDPDNPPKTWDEVF
FT                   EYSRIIRAKLDAYGFEPNIIALDELLLEGIPIVTDDGKKAAFNTQEAVKKLEWFQKAYR
FT                   ENLMPRTLGGYGEAREFYQSGRLAMYPAGLTMLKHIEVNSPDIYKVTDVSSHPLGKGGM
FT                   IKVSLMNLAIPITSKCPKEAAKFALFVTSARWQIEFSKYATVIPSTKQGLETSEEFLNR
FT                   AKSGDLSAKAMLMASKSMQNAVDLNSVAVHGIPSEKYADVRKVIQDYWMKAIKGELSAQ
FT                   EALDLAEQEVNKILSK"
FT   sig_peptide     complement(113866..113922)
FT                   /locus_tag="Tlet_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.947 at
FT                   residue 19"
FT   gene            complement(113943..115190)
FT                   /locus_tag="Tlet_0110"
FT   CDS_pept        complement(113943..115190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC3582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32680"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E6"
FT                   /protein_id="ABV32680.1"
FT                   /translation="MNWDVAVFGGGLAGVSAAVNAKRAGKKVILIEQNSIIGGNATLGL
FT                   VNPFMRFWIDGKVLVGDFFQEIMADLESKGALFENCFDSEMLKIVLLEKLEGVTLLFRA
FT                   IPIDVLKEGKFIKKVVVKTSLGNCYTIEANLFVDATGDGTLSYLAGCEFQSGDEFGENQ
FT                   AVTLMFVLGNVDFEKIRNNIRKDPDNFYKWVSADSKVLSVAGYFKEIKHARKEGMDLPN
FT                   DFFFFTQLPGTGRVSVNTTHISIKTTDDFQLSSAIKNLHKQVNDVYRFAKKFVPGFENS
FT                   YIEKIATIPGVRESRRVVGLYIFSGKDVQLKMKFKDAAVKACYGIDIHRKNYTVTEEER
FT                   TAIPKYEDYYEIPIRSLISKDFENLAVIGRNFSSDFPGQSAARIMPSCIDMGEAIGKFA
FT                   GRVSKSFYEPAKVRGS"
FT   sig_peptide     complement(115125..115190)
FT                   /locus_tag="Tlet_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.796 at
FT                   residue 22"
FT   gene            complement(115203..115871)
FT                   /locus_tag="Tlet_0111"
FT   CDS_pept        complement(115203..115871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0111"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /note="PFAM: histidine biosynthesis protein; putative
FT                   N-acetylmannosamine-6-phosphate epimerase; KEGG:
FT                   gvi:glr2614 putative N-acylglucosamine-6-phosphate
FT                   2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32681"
FT                   /db_xref="GOA:A8F3E7"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E7"
FT                   /protein_id="ABV32681.1"
FT                   /translation="MRKLPRGIIISCQLEPGDPVQDVSFIVNMARSADYAGAVAVRTNN
FT                   ADHVRAVKDSVSIPVIGLVKDRNYQAFITPTFEHARDVIKAGADFVAIDCTRSERPVQL
FT                   KTLFEEIRSSFPDVGIIADIADEADAELVSALRPDFIATTLCGYTPYTLGCSLPNIELV
FT                   RGLSRKMSIPIIAEGGYTTLEEVQNAFQNGAYAVVIGTAITRPWITIKKFVDLFYKKFN
FT                   "
FT   gene            116091..116855
FT                   /locus_tag="Tlet_0112"
FT   CDS_pept        116091..116855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0112"
FT                   /product="protein of unknown function DUF169"
FT                   /note="PFAM: protein of unknown function DUF169; KEGG:
FT                   mta:Moth_1866 protein of unknown function DUF169"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32682"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E8"
FT                   /protein_id="ABV32682.1"
FT                   /translation="MNFSEIAVKLEQILRLDTFPVAIKMYKNAEELPRKPLNFKLNICQ
FT                   LVSMARYAKKSNSGIPEKMVCSMGAACVGLIKTPEPIRTGRAAVGPYTRDEKAGKRFME
FT                   NTFKIGDSGKKYDAIMVAPLESVDFEPDAVVLYATPAQIMRLIHANTYDTGEKTTADTV
FT                   AEAALCSSIGFAISKQKPIIGFPCAGDRIFGGTQNHELLMAIPFSEMNRILKNLEETAK
FT                   GGFSVYPVPPNMMWTPTMPSTYTIQEADLQDQ"
FT   gene            117045..118085
FT                   /locus_tag="Tlet_0113"
FT   CDS_pept        117045..118085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0113"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; periplasmic
FT                   binding protein/LacI transcriptional regulator; KEGG:
FT                   lla:L0146 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32683"
FT                   /db_xref="GOA:A8F3E9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3E9"
FT                   /protein_id="ABV32683.1"
FT                   /translation="MKPAYVLIMDYIKNKIFSRELKPGDKIPSENELAKIFNVSRLTAR
FT                   KSLENLEYEGIVTRIQGLGTFVASMQESLKGKRVGVLITNYQDTRASLLFGVVRTLQKF
FT                   SISVIPFNLDTFVTTPFHEEKMLKELLKLEIKGLIMEPRITSLADTLLISLIKENFPVV
FT                   FVDRTIEGFPQVPMVSSDNKAGGQLIGKHMKKHHVSKALFVTEEPFEVSSVKERFEGIK
FT                   EEIEDVCYKMIGDYDRDFEIVAEIIEKENIEAVFFCNDYLAIRGITYLKEQKRNIPQDI
FT                   SIYGFDNLRVSVYSHPRLTTISQDFQAMGELAALQIAKIFLRENIELQQQVPVSIVVRE
FT                   SCGCKQ"
FT   gene            118243..119547
FT                   /locus_tag="Tlet_0114"
FT   CDS_pept        118243..119547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0114"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcl:ABC3282 sugar ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32684"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F0"
FT                   /protein_id="ABV32684.1"
FT                   /translation="MKHALTFLLIAGFAICFFAQSVEITFWHSMTNPVDRESIAEAVAE
FT                   FNKTHPNIKVNIVIVPGSETEITKLMTAVAGGTGPDVYYLDRFTVAQRAAYGVLEPLED
FT                   YLVQLGYDISKLKEEFFNFAIEECQWNNKMWALPWDTDNRALYYNKKLFKEAGLDPNKP
FT                   PVTLEELEIYAEKLTKKTAGRYTQVGFIPWAFQGWHYTWGWAFGGNFYDAQSQKLVFAD
FT                   DPRIVKAFEWLGEWAKKYNIKELEAFVSSFGMSFSGASIGGAEPINPFLAGKLAMVVDG
FT                   NWLLAQILQLAPKDFEFGIAPIPAPAYGEKNSTWAGGWSLVIPKGAKHPKEAAEFIHYM
FT                   TTKGQIKFAIDTQHLPTLKEAVPGLLSASPAEQKIFADLLPTAHVRPVIPVGALLWDEL
FT                   TNAMQAVVYGEKSATEALRSAQEKVQKELDKWLTK"
FT   sig_peptide     118243..118308
FT                   /locus_tag="Tlet_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            119623..120492
FT                   /locus_tag="Tlet_0115"
FT   CDS_pept        119623..120492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0115"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3281 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32685"
FT                   /db_xref="GOA:A8F3F1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F1"
FT                   /protein_id="ABV32685.1"
FT                   /translation="MKKHKRFWTAMFFVLPGIIGLLVFRIYPIFASFFFSFTEYHITLP
FT                   PKWIGLTNFKELFHDPLFVKSLQNTFVYFIGLVPIGLIVGILLALLLVRDFKGVSFFRA
FT                   VMYMPSVVPIYAFAVVALNFFNPYLGLVNGFLAKFGIPGPLWTADDKLVKLTIILIAQW
FT                   GAGQQAMILMAAMKDIPKEFYESALIDGANKWQIFRKITLPLITPAILYYFITSSILAL
FT                   QFFELPQIMFGGGPNNASLSIAIYLYRHAFRYGNMGYASAMAWFIFLISLGICILYFKT
FT                   SRKWVFYS"
FT   gene            120506..121336
FT                   /locus_tag="Tlet_0116"
FT   CDS_pept        120506..121336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0116"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC3280 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32686"
FT                   /db_xref="GOA:A8F3F2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F2"
FT                   /protein_id="ABV32686.1"
FT                   /translation="MNRKFSIQALFRVIFLILITLIYMAPFFWMISTSLKPNYELYEFP
FT                   PKLIPSIAEFNNYSKALQRFPFFTYFRNSLIIAGGAVLGALISCPLIAYGLSVLKWKGR
FT                   EIVFYAILATIMLPNAVTLIPTFLIFSKLNMVNTFWPLILPSFFGHPFYIFLIRQFFLT
FT                   LPRDLFEAAKIDGASEFQTYFKIALPLIKPTLVIVGLFQFIASWNDYLGPLIYLTDEKK
FT                   YPLALGLPQFLDRYGTLWNQMMAAATIAVVPTLIFFIFAQRHLLESIKFTGLKG"
FT   gene            121357..124419
FT                   /locus_tag="Tlet_0117"
FT   CDS_pept        121357..124419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0117"
FT                   /product="Alpha-mannosidase"
FT                   /EC_number="3.2.1.24"
FT                   /note="PFAM: glycoside hydrolase family 38; glycosyl
FT                   hydrolase 38 domain protein; Glycoside hydrolase family 38
FT                   central region; KEGG: tma:TM1851 alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32687"
FT                   /db_xref="GOA:A8F3F3"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F3"
FT                   /protein_id="ABV32687.1"
FT                   /translation="MDKKFFYRLLKSISEILPYTISEQRPLKAWYFTNGPIEEKPLDYE
FT                   KTITFPFKWDFEKSPVWFMKDLEPVLLQENQRAYLKLWFGGESLILVDGKPYGEINEYH
FT                   KLLNITPLCDGKTHRVEAQVMPRGLFGKPQEPVFSEAFLLIIDEEISEILKTVEITVRA
FT                   ANILEEPVSKKLSDICDEFLSNVWVPRDTKTYLKTAQQDIGVKGEIESVWNTPKFEEFT
FT                   GIKLQEELKEQLINKYKVFKSKLEKLKREHPPVGTIHLVGHSHIDYAWLWPVEETKRKI
FT                   ARTFANAVMLSKMFPEFVFSQSSAQIYQDLKEKYPELYETVKQLVEQNKWEPVGGMWVE
FT                   SDCNVPTIESLIRQFYYGQKFFEREFGKKSRVCWLPDVFGFSWVLPQILKQADIEYFVT
FT                   TKLNWNDTTEFPYDLCIWRGIDGSEVLYCSFNNPNEGYNGRIDPDTVYKTWKNFRQKEL
FT                   TDKVLLSFGYGDGGGGPTEEMLQNYRILKEFPDLPKLEIQSVEKYFESLELQKNLPIWD
FT                   DELYLECHRGTYTSQSNIKKLHKDAEDALYFSEVVSVFCKHNYSDELDELWKIVLRNEF
FT                   HDILPGSSIKEVYQDAERELSYVKEKATEIFEKAINSITKKNKSIISILNLSSFPKRCV
FT                   FSLNENLKLSLDREVVFSQKTFDGRYIYFVDRKIEPFSKIELKISGADDEQPEQSLTKD
FT                   NLSMENEYLKISVKEDGSVQVYDKELGKFAFDKCGNILKMHKNIPYYWDNWDIADGVEK
FT                   TGFTLKASKIMKIESGPIREIIRVEYEAEGSKIIQDYILAKKSKRLDIKTKIDWHTRRA
FT                   LLRAYFPVNVLTRKAIFDISGGFIERSSHKNTKYEQARFEVPAHRWADLSQTDFGVTIL
FT                   NDGKYGYSVHQNTIALSLIKAGIFPDFFADEGLHEFTYSVYTHHSEIKAIVEESEDLNK
FT                   PLTVIKGELEIPHTILKITPNNFKVTCFRKNTQGNIVLRLVEIFGTSGKLSLEMPWHKG
FT                   NISLSDILEEKRQQVSFPMNYHPFKIYTLIL"
FT   gene            complement(124468..125466)
FT                   /locus_tag="Tlet_0118"
FT   CDS_pept        complement(124468..125466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0118"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: tma:TM1057 potassium
FT                   channel, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32688"
FT                   /db_xref="GOA:A8F3F4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F4"
FT                   /protein_id="ABV32688.1"
FT                   /translation="MKNRLYILILMLVMVFLFGTYGYHFTENWSLFDSLFFTLVTVSTV
FT                   GYSMPENITEAGKVVSAILIGAGITVVLYGFTSITSLIVEGHMKEYFKIRRMRKMLDSL
FT                   RDHFIIIGADKTGRHTAAELKKAKKMFVVVEDSEESIHRLREFLNMEFPFVLGDAAEEE
FT                   VLIKAGIKRARSLIITLTNDAKNILVVLTAKSLNPDLEIVSQASDAKTMTKLIYAGAHK
FT                   VITTTELAGVRLAQLAINPQQVRFLDILSLGEEAFRIEEIVISQDSPVSYKTLGEINLS
FT                   RITGTIVIAIKREDETIFNPTGTTQILPGDRLMVIGKNEHFEKFHRIIEKS"
FT   sig_peptide     complement(125398..125466)
FT                   /locus_tag="Tlet_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.717 at
FT                   residue 23"
FT   gene            125496..126302
FT                   /locus_tag="Tlet_0119"
FT   CDS_pept        125496..126302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0119"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: cph:Cpha266_1424
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32689"
FT                   /db_xref="GOA:A8F3F5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F5"
FT                   /protein_id="ABV32689.1"
FT                   /translation="MKSRFKKIIIHSDLPLADRNAEREVLGMSKDLLKSQWGKVNDLLT
FT                   DQKLGKPQPSFEEPFDNNMVILELEKPENLKFGNISFREVVEKRSSKRKYSKDPLSIDE
FT                   LSYLLWLTQGIRKITNGITFRTVPSAGARHPFETYIFIFNVLNLNVGLYRYIASQHKLL
FT                   LIDEGDFRELLNDACLGQNFVAQSAAVFVWSCVSYRTTWRYADLSYKAILLDAGHVCQN
FT                   LYLACESINCGCCAIAAYDQEKLDKLLHVDGEKQFAIYLAAVGKIP"
FT   gene            126362..126787
FT                   /locus_tag="Tlet_0120"
FT   CDS_pept        126362..126787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32690"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F6"
FT                   /protein_id="ABV32690.1"
FT                   /translation="MQTWMEKYVVNEEERNQLKHLLKNGHLSELEKIFGDDFVQELIDN
FT                   SEYVEPYGDYEIFKFTDEGVVRLVAISYDKKHGTPYVIEESLIAEDEFGEESVEEFKEM
FT                   IDSQYLDFEEDLEHDEDIEELVDLDDFEEDDDEDYEW"
FT   gene            complement(126807..127436)
FT                   /locus_tag="Tlet_0121"
FT   CDS_pept        complement(126807..127436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0121"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: tma:TM0721 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32691"
FT                   /db_xref="GOA:A8F3F7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F7"
FT                   /protein_id="ABV32691.1"
FT                   /translation="MKNLHVVDHPLIKHKLTIMRNKNTGPKEFRELLREITFLLAYEAT
FT                   RNIETVEIEIETPLEKIIGFAIEDKKVVVVPILRAGLGMVDSILELLPNASVGHVGVYR
FT                   DPETLKPVQYYCKLPPIDNSSTVFVLDPMLATGFSGVHAVKILKDRGAKNIVFVSLIAA
FT                   PEGVQQFNIHCPDVPIYTACLDRQLNEHGYILPGLGDAGDRLYRTK"
FT   gene            complement(127477..128331)
FT                   /locus_tag="Tlet_0122"
FT   CDS_pept        complement(127477..128331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0122"
FT                   /product="signal peptidase I"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24
FT                   S26A and S26B; KEGG: tma:TM1572 signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32692"
FT                   /db_xref="GOA:A8F3F8"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3F8"
FT                   /protein_id="ABV32692.1"
FT                   /translation="MSKRSIKKEAIEWGKALLYAIVAATIIRLFVFETMLVPTGSMIPT
FT                   INVGDRLFIEKVTYTAREPEIGDIVVFWSPFIDERAQTMLRWFDKFMDLFAPARFKGHV
FT                   KYVKRLVGKPGDVLQIKLSEDGNYHLFINGEIPDVLKDVVYSPEGIFSNPELLNLFIKA
FT                   SRLRDNSNEYKVFLQNIARQDAYTANLVFSVVGGMYPVPLGIPFAETYDKLYENIDLSK
FT                   YIRKTIDGVEVEIPQGFYFFMGDNTKDSFDSRYFGFVPKDHVIGRPILRIWPLKEFGPV
FT                   QGR"
FT   gene            complement(128334..128684)
FT                   /locus_tag="Tlet_0123"
FT   CDS_pept        complement(128334..128684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0123"
FT                   /product="ribosomal protein L19"
FT                   /note="PFAM: ribosomal protein L19; KEGG: tma:TM1571 50S
FT                   ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32693"
FT                   /db_xref="GOA:A8F3F9"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3F9"
FT                   /protein_id="ABV32693.1"
FT                   /translation="MSMDNLVRLVEKDQYKQLPDFRPGDTVKVHVKIVEGGKERIQIFE
FT                   GIVIKIRGSGLGKTFTVRKIASGGIGVERTFPYHSPVVQKIEIVKKAVTRRAKLYYIRD
FT                   IRGKIRLKERKE"
FT   gene            complement(128687..129256)
FT                   /locus_tag="Tlet_0124"
FT   CDS_pept        complement(128687..129256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1570 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32694"
FT                   /db_xref="InterPro:IPR019230"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G0"
FT                   /protein_id="ABV32694.1"
FT                   /translation="MLNDVRIALIHYPVLGKDGKIISSAVTNLDVHDIARTARTYNLRK
FT                   YYIVTNLRAQQEVVKTVLEYWIDSYGRERNFSRTQALELVDIKSYLEEVIEEIENETNK
FT                   KPVMFFTSAKKRPNTLTYAQAREFIKKTDRPVLILFGTSWGLPNEVLQICDYALEPIRA
FT                   DSDYNHLSVRAAAAIIIDRLIGEKEG"
FT   gene            complement(129246..129986)
FT                   /locus_tag="Tlet_0125"
FT   CDS_pept        complement(129246..129986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0125"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; PFAM:
FT                   tRNA (guanine-N1-)-methyltransferase; KEGG: tma:TM1569 tRNA
FT                   guanine-N1 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32695"
FT                   /db_xref="GOA:A8F3G1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G1"
FT                   /protein_id="ABV32695.1"
FT                   /translation="MRIIISSIFPEFVRVIKEYGVIAQALRQQMLQIEVLNLRDFTHDK
FT                   HRTVDDYPYGGGPGMVMKPEPFFEVYRHCLDKYSNLYTIMTSPQGVQFNNRIARHLSEK
FT                   ENLLIFCGRYEGVDERVMKIVDMEISIGDYVLSGGELAAMVICDAVSRFVPGVIDEESA
FT                   KRDSFYNELLDYPHYTRPAEFDGMKVPDVLLSGNHEKVELFRIAESLKRTAFRRPDLFV
FT                   KRDFSEDEKKALIWLIKELAKDAE"
FT   gene            complement(129986..130492)
FT                   /locus_tag="Tlet_0126"
FT   CDS_pept        complement(129986..130492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0126"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: tma:TM1568
FT                   16S rRNA processing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32696"
FT                   /db_xref="GOA:A8F3G2"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3G2"
FT                   /protein_id="ABV32696.1"
FT                   /translation="MSDYVVIGKITKTHGLFGSVKVLPLTNALEVFQKLENVFIKNDAQ
FT                   SNTHRLQIEEIRKAGKGFLIKFSGIDDEERARKIVGLSLAVRVTDLPKPKSPNEYYYYE
FT                   LLNVEVLDQSGNFIGRVEDIIQTGSNEVAVVKNGSFEMLIPVIHDYIIKFEKRKRLVVK
FT                   VPEWI"
FT   gene            complement(130489..130713)
FT                   /locus_tag="Tlet_0127"
FT   CDS_pept        complement(130489..130713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32697"
FT                   /db_xref="GOA:A8F3G3"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G3"
FT                   /protein_id="ABV32697.1"
FT                   /translation="MKELVEYILKGIVKHPQDVVVVEFNDDGNRVLEIVVNEEDVGQVI
FT                   GKDGRTIKSLKVLLAALLEDENFTLRVIR"
FT   gene            complement(130697..130993)
FT                   /locus_tag="Tlet_0128"
FT   CDS_pept        complement(130697..130993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0128"
FT                   /product="ribosomal protein S16"
FT                   /note="PFAM: ribosomal protein S16; KEGG: tma:TM1566 30S
FT                   ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32698"
FT                   /db_xref="GOA:A8F3G4"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3G4"
FT                   /protein_id="ABV32698.1"
FT                   /translation="MVRIRLTRMGKRHMPFYRIVVVDSRKRRDGAYIESLGYYNPLRKP
FT                   AEIKVNVERAVEWILKGAQPSETAANILSKAGVLAKVHEMKYGKREKSDEGVS"
FT   gene            complement(131008..132309)
FT                   /locus_tag="Tlet_0129"
FT   CDS_pept        complement(131008..132309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0129"
FT                   /product="signal recognition particle protein"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase; KEGG: tma:TM1565 signal
FT                   recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32699"
FT                   /db_xref="GOA:A8F3G5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G5"
FT                   /protein_id="ABV32699.1"
FT                   /translation="MFENLQERLSKIFRSLTGQGRLTEKNINEAVRQVKLSLLEADVNF
FT                   KVVKEFIDSVKAKALGEEVLKSFTPDQQFVKIVRDELINIMGKSAATLNLRHHPSVIML
FT                   VGLQGSGKTTTAAKLANYLRKSGRTVLLVAADTYRPAAIDQLEKLGKSIQIPVLTGDRK
FT                   NPLIIVQQALEYSKNSQYNTLIFDTAGRLHIDEEMMEELQQIKQLSNPDEILMVVDAMI
FT                   GQDAVNSALEFDKRLNVTGFIVTKMDGDARGGVILSITHITGKPVKFIGVGEKIDAFEQ
FT                   FHPDRVAARILGMGDVLSLIEKAEKELDKEKMEKVGKKILQAEFTLEDFQEQLKEMKKL
FT                   GPLSSLIEMLPGAPKIDVETSEQQLKKVEAIINSMTIEERRNPRVLNASRRQRIAKGSG
FT                   TSVQDVNKLLKSYEEMKELMKRLKHGKLKLPFKI"
FT   gene            132547..134154
FT                   /locus_tag="Tlet_0130"
FT   CDS_pept        132547..134154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32700"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G6"
FT                   /protein_id="ABV32700.1"
FT                   /translation="MSRKILVLFMLLLSSLLIFATQFSRNIEEKITILRDGTAEVVRTE
FT                   YIPSSDLAKIFIEYFENMKKSREIFANYLYEVSKEYYFIYGTTPKFSSSDVKFEENSKG
FT                   FTLTVKMKIPGIVRKDGNVLILSRKNFSDEKLLPKYFEEQIDGKIFESAFLQSEKNYLV
FT                   TKRLTTIILPENSKIEDLKPIYAKKFDEKWFVDMGGGTTYKAHIEKIEKGVIIEEEIRT
FT                   SASTPKNLLDEKNNIETLNNLRDYTAFQLLFTNEKMEEKLSQPVDHKIKNDFSGSWSFS
FT                   VSSGELLSYTFTYGVINVTPKITVTLSFSASLLWEHQWVRTGWFSWSYKFKRFESTITF
FT                   SPSLTPSITVQSGGSVSKEWSKNLFSKGKTVTFYVSCVPVILYMQAKLDAEAEASISAS
FT                   IGFTAAATFGLNTSLSMKYQNGWSAPLSYNIHYSGVSFTASAKANASAEGRLPFTLAAY
FT                   VYYVAGPYVKLTPWIKGETNASVGNANQVSYSITGGIKAEGGVAMAGWLKNLCGNIPSF
FT                   SYQFFDWNRTLASGTKTF"
FT   sig_peptide     132547..132609
FT                   /locus_tag="Tlet_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 21"
FT   gene            complement(134200..135045)
FT                   /locus_tag="Tlet_0131"
FT   CDS_pept        complement(134200..135045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0131"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB3422 sugar
FT                   binding-protein dependent transporter system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32701"
FT                   /db_xref="GOA:A8F3G7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G7"
FT                   /protein_id="ABV32701.1"
FT                   /translation="MSRIASAIIDIFIWIFLIGFAIFILIPLVFMFTASFMPSRDIMQV
FT                   PYPWFSKEFQWQNYWQAIRGNDGKYLYLRSIWNSFLVSSLTTVGTVFLCSLTGFGLAKY
FT                   RFRGRTIIFFVILSTMMIPFEAIMIPLYLIVTEMRMQDSYAGLIVPLLMNAFGVFMMRQ
FT                   YLLTFPDELLDAARIDGASEFGIYWRIVLPNSLPAIATLAILTFRSQWDNLLWPLLIVQ
FT                   SPEKKTIPLFITQFAAEKYTNEGAMMAAAVIASIPMLILFFTLTKYFLVGAQLFAARKD
FT                   "
FT   gene            complement(135057..135941)
FT                   /locus_tag="Tlet_0132"
FT   CDS_pept        complement(135057..135941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0132"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: syn:slr1202 putative
FT                   ABC-type lactose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32702"
FT                   /db_xref="GOA:A8F3G8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G8"
FT                   /protein_id="ABV32702.1"
FT                   /translation="MERKKATWGFIFTVPAIIFFAIFNFYPMINAFWMSFFRKELLSLK
FT                   PPKFVGLGNYLYLFTSESFWNSVKATAIFAFGTFVPMLTFSLFLAALIMTRKRFQKFLQ
FT                   MAYYSPAVLSSVVAATIWLLIFDPRGLSNQFLNFVFSTDGVDYRWLANENMLRLATIIV
FT                   YFWKYVGYFTVIFVAGMASIPKSIHEAATIDGASKWQDFFYITFPLLKPTTLLVSVMSL
FT                   IQCLRTFSTQYLFVQGGAPIKPIDVITLNIYNTAIRDHRIGRASAMSVILFLIIMFFTY
FT                   LQFKISKSEDVSY"
FT   gene            complement(135986..137251)
FT                   /locus_tag="Tlet_0133"
FT   CDS_pept        complement(135986..137251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0133"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: lmo:lmo0768 similar to sugar ABC transporter,
FT                   periplasmic sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32703"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3G9"
FT                   /protein_id="ABV32703.1"
FT                   /translation="MRKFLIFVLSTVFILSFAAKIEIVFWTHEDPNRTPLEEKYIQQFE
FT                   QMYPDVKITRVTYPSAKIREVVLTAFAARKGPDIFNMEIQDAFPYIVNGRVAPINLKAI
FT                   GLENYDELKNMYIEGTFDAVTYENKIYGLPLELTNWCVFINKKYFKEVGLDPEKDYPKT
FT                   WEEMVQVSEKIVIKEGQIIKRRGFDFRYPYYLTFFLPMVEQLGGFLFSDDGKEAIINDE
FT                   AWLKALNFMKQWGPNGKNLGSPTYTPARKEFNKDNNTVAMCLSGLYQIDRIRAENPEFY
FT                   NSNEWMVVPFPVFENAVREVRCNYYGHYYMVNAESSREKQEWAWKFVNFMLSHPQDYLL
FT                   NVGLIQPRRDLIESDVFKNYPYAKVFLEDMEKSHIVPLHPKGPQFEQLIREAVESVMLT
FT                   NTTAEDALKTLKRKANELLKED"
FT   sig_peptide     complement(137195..137251)
FT                   /locus_tag="Tlet_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.872 at
FT                   residue 19"
FT   gene            137364..138320
FT                   /locus_tag="Tlet_0134"
FT   CDS_pept        137364..138320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0134"
FT                   /product="peptidase M19 renal dipeptidase"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   cdf:CD1646 putative dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32704"
FT                   /db_xref="GOA:A8F3H0"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H0"
FT                   /protein_id="ABV32704.1"
FT                   /translation="MKVFDGHSDIWYDAFLKNHHKENILLSYHIPRLKAGNICGVNAAV
FT                   WTNPKSENPMEKFMQMIAIRSKYMRETENNELIFAENGLQINKAIKSEKIFVISSIEGL
FT                   IGIGNNIDFIATLYDLGFRVISLTWNEANTLAAGCGCNDDSKGLSDFGRQAVKIIENIK
FT                   IVLDVSHLSEKSFWDVVKIAQKPFIATHSNAYSLCPVPRNLKDDQIKAIAESGGLIGIS
FT                   ALPQIVDRENPSLEKVVKHIIYVTNLIGVDHICLGFDFFDYLTTDNIIQNQKQTTGLED
FT                   VTRVPTLIECLKKSGFGEKDIEKIALLNFLNFLQKMI"
FT   gene            complement(138323..139093)
FT                   /locus_tag="Tlet_0135"
FT   CDS_pept        complement(138323..139093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0135"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ava:Ava_1011 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32705"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H1"
FT                   /protein_id="ABV32705.1"
FT                   /translation="MSLTDFKWALITGASSGIGKEFAVQLSKKGLNIIAIGRNEERLIQ
FT                   TVETVKKSSNVEIISYTADLSRQENVKSLVVDLSKYQVDLLINNAGFGLYGEFTKLELS
FT                   EIEKMIEVNIKALTSLSHIFSKEMIARKFGGIINIASVAGHIPLPYFSAYAATKAYVYN
FT                   FSLGLWAELRKYNVHVLCVSPGPTETRFFERAFKNQSLQKFGSRMKPDEVVAGTLKAFE
FT                   KGSVVYTPGMKNKFITFIGKKLLPDRFIAMVAGG"
FT   gene            complement(139111..140685)
FT                   /locus_tag="Tlet_0136"
FT   CDS_pept        complement(139111..140685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0136"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate transcarbamylase regulatory subunit;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: tma:TM1642 aspartate
FT                   carbamoyltransferase, catalytic and regulatory chains"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32706"
FT                   /db_xref="GOA:A8F3H2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H2"
FT                   /protein_id="ABV32706.1"
FT                   /translation="MRSFRGRTLALIRDFTIDEQLFLYQKTKELKQKWLNREDMSEFQI
FT                   KGDVNIYIVFVEPSTRTKESFINAAKFHKNARVNIFDAEHSSFNKNESYVDTFNMLTGY
FT                   GIYSIFVVRTRLEGVPRLLERKVGEFAQRHGIERPAFINGGDGKHEHPTQELLDEFTFL
FT                   EQNNFDNSHIRIALIGDLLHGRTVHSKVDGLKIFKNVEVDLIAPQQIQMPQHYIEKMKS
FT                   NGFEVRKFSSIDEYLSNKDVAKIWYFTRLQLERMGEDILEKEHILRKAVTFRKDMLDKV
FT                   KEGTKFYHPLPRPKIDPEIPTFLDELPLNGWEIQARNGFWVRVVLLSLLGGAVEMECDQ
FT                   SITFQKEEDEYEFIIPTQIVHGTKGVAKEGKRGIKPIENGTVIDHIAKGKSTEEIFNTI
FT                   VKIRKILKLHDCDSADGIFKSADGSYKGYISLPDRYLSKKEIKKLAAIAPNTTVNIIKG
FT                   ASVKEKYRIKLPPKIYNFDEIRCKNENCITHPKNGENVGASFIRIDDRLVCEYCETPHE
FT                   YSEIWVI"
FT   gene            140932..142686
FT                   /locus_tag="Tlet_0137"
FT   CDS_pept        140932..142686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0137"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tte:TTE0540 ATPase components of ABC transporters
FT                   with duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32707"
FT                   /db_xref="GOA:A8F3H3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H3"
FT                   /protein_id="ABV32707.1"
FT                   /translation="MSHVATLSNVSISFPEKTLFTEFTVNISKKDRIGLMGKNGSGKST
FT                   LLKAIAGIFLDYTGQISVSGKILYMDQLRSFNARTPFEYYASTADTPRKLRDVRSILKG
FT                   FGFEEKDWHRDISTFSGGEKTKLQLGKLFLEEPNFLLLDEPTNFLDVQAIEFLKNLLRK
FT                   FPGGYIVVAHDRNFLRNVCEKFWEINNGQIWIFDMDFDRYRKERETILKTQERRIENIQ
FT                   KEIDRLKHIIDQYRRWNREKFFKQAKSREKLLNKMYEELENMPNLYLQEEEKNIKIPIP
FT                   DNTGHVVLEVIDVSWNSLLKKINFTVYQKDKIAIIGPNGSGKTTLLKIITGHLRHNGTI
FT                   KIGHNVKMVFVDQFISQLDPENTVFDEIFEEMPDHPDYVIRSYAGRFGFKGENVFKQIS
FT                   QLSGGERQILAIAKILLRKPNLLILDEPTNHMDLQTVEALEKALKEYEGSVLLVSHDLE
FT                   LVSNVCNRFFSIINGEIVEVDSPVILFEKKPTISKTKNLPFEEKKKLRNQLKNLQEILE
FT                   NLSKKEEDLCGNIEQIDNKLSLTNDYNEITSLIKEKEKLEQDLLTVMEEMQKTREKIEN
FT                   LQAHLSEF"
FT   gene            142940..144940
FT                   /locus_tag="Tlet_0138"
FT   CDS_pept        142940..144940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0138"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   tma:TM0918 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32708"
FT                   /db_xref="GOA:A8F3H4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H4"
FT                   /protein_id="ABV32708.1"
FT                   /translation="MKTIRGKMLALILLPVVVLTIVIAAVAYLQIKSSIVTSVEQSSFE
FT                   IAKKSSLVVNEWINGLVKELQAFAERNVVVNALKTGDWKDLMADLNLKLKSRPEIEMFL
FT                   IAYPDGNAPTTLGSTAQISDRDYFIQIMKQGKNFAVSNALVSRVTGKNVFVIAAAVKDE
FT                   NNKTIGLFGATVLLDTISNIASSIKIGEAGYGWVVDSTGLVLAHPNKEAVMKLNITQAS
FT                   KEGYKGVEEIAKQMLAGKNGIAKFTRPDGSVDYAFYSPIEIASGWAFAVSVPENQVLSE
FT                   VNRLLTIVIAIFAILIAIVAVLIIFVSTSISKPIKKLAENSVKFGKGDLTIKFEAKGRD
FT                   EVAQMAQALEQMAESLKESMKAIQEGSNQIHSSAENLAATAQEVSATSEELSSQMEEIN
FT                   RSAQNASASIQEVTSGVQEVAASAQNVSRSAQNLTERAAQVDSAAKEGEKAVQAIVEII
FT                   NQTKEKANVTESSVMELSNKAKNIGEIVETINSIAEQTNLLALNAAIEAARAGEAGKGF
FT                   AVVADEIRKLAEESKSATDKIGQMLTQIQQGAQQASTVTSETVKVVDKASEQSEVVRER
FT                   LMNILREVEGISTMIESLAASAQEQSAAAEEMSGAMDTATRSITNIAHQIEEMTQAVKQ
FT                   QAEVSQNVSSLSEELSSIAESLVEQVKKFKM"
FT   sig_peptide     142940..143023
FT                   /locus_tag="Tlet_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.515 at
FT                   residue 28"
FT   gene            144996..147137
FT                   /locus_tag="Tlet_0139"
FT   CDS_pept        144996..147137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0139"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain; KEGG: ter:Tery_5016 glycogen debranching enzyme
FT                   GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32709"
FT                   /db_xref="GOA:A8F3H5"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H5"
FT                   /protein_id="ABV32709.1"
FT                   /translation="MEYFQYTNPDSKTILKTKRGYPRPGATCDDAGTNFALFSRNGRKV
FT                   ILELYQNYYDETPSHRFVLDPNQNRTGDIWHIYVYNVGHGQYYGWRVDGEYDPLSGKRF
FT                   NVNKLLTDPYAKAISGSYEWDEDSVYGYDRNSSLKDLSFSTIDSAQSPTKSIVIDDSKY
FT                   NWNNDRRPKIPWKDTIIYEMHVRFFTISPTSKVKHPGTFLGIVEKLDHLKELGVTTIEL
FT                   MPIFEFCANANTNINPLNGKKLKDMWGYNPLGFFAVTGNYSAGMKLGEQVFFFKDFIKE
FT                   LHNHGFEVILDVVYNHTGEGNELGPTLSFRGIDNEIYYMLNPSNKRLYLNYSGCGNTLN
FT                   CNHPVVKEMIIDSLRYWATEMHVDGFRFDLASILGRTPDGRWIGDLSLLKDISEDAILH
FT                   DLKLIAEGWDAAGGYFLGQFPPGWAEWNGKYRDTVRKFVRGDEGTIQDLVMRISGSQDL
FT                   YGSKSPHASINFITCHDGFTMRDLVSYRHKHNEANGENNRDGTDENFSCNNGAEGETNN
FT                   PQINRIRKQQVKNFIAILMVSHGTPMILMGDELYRTQRGNNNAYCHDDETTWLDWTLKE
FT                   KHYDIFRFFKKMIQFRKIHPSLRRPHFFSGAPTSRGIPDLTWHGIRPYEPDFSYYSHSI
FT                   AFMINGETYLDGSDDDIYVILNQWREPLRFILPFIHGKTWYLVVDTSKESPEDFLDKPE
FT                   QVGYIYTASPKSTVIFIGK"
FT   gene            147173..148852
FT                   /locus_tag="Tlet_0140"
FT   CDS_pept        147173..148852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0140"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   tma:TM0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32710"
FT                   /db_xref="GOA:A8F3H6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H6"
FT                   /protein_id="ABV32710.1"
FT                   /translation="MFLPTTSEEIKKLGWKQLDIILITGDAYVDHPSFGVALIGHYLFS
FT                   KGYKVGIIAQPDWNSDKDIKRLGRPKLFFGITAGNVDSMVANYTASMKKRKIDDYTPGG
FT                   TSGKRPDRATIVYSNLVKRFFPNVPVILGGLEASLRRFAHYDWWVNRVRKSVLIDSKAD
FT                   LLVYGMAEKTILRISQILEKYADLDRCKQLPGVVWWTSRKPESGIELPSFEEISEDKIK
FT                   YAEAVKLQLSSTDHLKNVVLYQKQDNRYIVQNPPEKPLDQTELDNLYLMDFERKTHPYY
FT                   ESMGHVPAIETVQFSITSVRGCFGRCSFCALSCHQTAHVVSRSDESIIEEARKITRHPD
FT                   FKGIITDVGGPTANMYGTSCNVRDSKGTCRKFCLHPEICSSTQMNHAKYIDLLEKLRQI
FT                   KGVRHVFVSSGIRHDLALSDPEGEYFIKELVNYTPGQLKLAPEHAHPYVLKLMRKPPVE
FT                   LFLEFKRKFEKHARHQGKNRYVIGYFIVAHPGETLRENNYLKNFINEKLGYHPQQIQIF
FT                   TPSPGTISTAMYYSGIDPFTHERIHVEKSLKVRNQMKKNLFK"
FT   gene            complement(148874..150196)
FT                   /locus_tag="Tlet_0141"
FT   CDS_pept        complement(148874..150196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0141"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: Alkaline phosphatase; KEGG: tma:TM0156
FT                   alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32711"
FT                   /db_xref="GOA:A8F3H7"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H7"
FT                   /protein_id="ABV32711.1"
FT                   /translation="MRKLTVLIMVLVTVMSFAYVKNVILLIGDGMGINHVYLTQLLEGQ
FT                   PLAMTKTPCIGLITTYSANSWVTDSAAAGTALATGFKTNNRMIGLLPSGENVPTLAEVL
FT                   KKYGVKIGLVVTCRITHATPASFYGHVEDRDMENELAEQLADSDFDVIFGGGYRHFFPE
FT                   SVKGSKRTDDKDLIALMKGQGYVYVSKKSELETVDEGKVIGLFAPSHLSPASNRPEEQP
FT                   MLYEMVNKALQLLSRDGEPFFLMVEGSQIDWEAHDNDVYGVWKETVEFDKAVKVALEFA
FT                   EKNPDTLVVITADHETGGLSISSGNQMIEINKLRQYKMNTETFLSRFSIDKKEEFINAA
FT                   RNYYGIDISDEEYRFLLSKKNSLNSSEFVKEFGRFLSGKSLVGWTTFDHTGMPVPVFSF
FT                   GPGAENFTGWFDNTEIPRIIARLMGYPLTYPIYKEPVTVNN"
FT   sig_peptide     complement(150140..150196)
FT                   /locus_tag="Tlet_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.601 at
FT                   residue 19"
FT   gene            complement(150297..150722)
FT                   /locus_tag="Tlet_0142"
FT   CDS_pept        complement(150297..150722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0142"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bce:BC3465 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32712"
FT                   /db_xref="GOA:A8F3H8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H8"
FT                   /protein_id="ABV32712.1"
FT                   /translation="MDFYIGDKEEVLIETRDLMYFSETRLINIPRKIVMNFFQEDRPVG
FT                   FVSFDVRWINRNAYITYYVISEARGIGLGKKMLLMAMDFAFNELNLNRLTAEVYEYNKP
FT                   SIKLLESTGFELEGVIKNGKFYNGKYHNIRIYGYLRR"
FT   gene            150844..151506
FT                   /locus_tag="Tlet_0143"
FT   CDS_pept        150844..151506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32713"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3H9"
FT                   /protein_id="ABV32713.1"
FT                   /translation="MQIFWQKNCTCPVCGKQFQAVRLFSEAIKVKERDTDLKPAYEGIN
FT                   ALLFQPITCTHCYYTAFEDDFEKPVTEKKRIQELCDRIKNSLSIDLSENRSLKDGAMIF
FT                   AIAAAVYTLTEKHLKAAEAYLKLSWIHRDMHSKDENNALEQAMKCFLESYKNDELAPEK
FT                   EIMVIFYLGEINLRLGNKKEAVRWFSSLIQKFGNTNSIYIKLARKEWQQAAAGKRGL"
FT   gene            151503..153224
FT                   /locus_tag="Tlet_0144"
FT   CDS_pept        151503..153224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0144"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B; 3D
FT                   domain protein; KEGG: tma:TM0568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32714"
FT                   /db_xref="GOA:A8F3I0"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I0"
FT                   /protein_id="ABV32714.1"
FT                   /translation="MKKLLLLLPLVIIVISCTPYDQDLLEQINRRLDELEYRIAQIEKS
FT                   TYNNQKNIEKLQQEVSKINNEVSSAKKLLDEQKNLPAVSPDEINEIMARLTSLEMRYNQ
FT                   LSVALNVSDIRELIYKLGDIEAAQKQQQINYEKFVQQTEQLLNQVNAEQIAAKLSGLEN
FT                   SVHSISNQIAEVMELSSRIKSIETTIENLAIENPQIQQNIDLFGLETQINQLKTEIKNT
FT                   ESALKKELEEKLSKLQIKSGEIMPSDLQQYIANTTALTRQLATEIETLRGIVREYDRDR
FT                   FLRLDQGYVTYVVKSGDTLSSIAQAYGLKLDKIKQLAELNGIEDANRLLVGQRIQIPVE
FT                   DTNSLFKYPLDSPLNPQDIAGAFSEPTGSGARTGIDIRINTPRKVRSMLPGRVVNILQD
FT                   NDGYHIRIDHGNGILAVYGNLKAIEVVQGQWISGGNNVGTVENIFHFEIWIDGEPRDPL
FT                   RILLKYAGKFEATYYSEWEDGKLPEHPTFRITAAGTVPKEWWTIAADPSVIPLGSVVYI
FT                   PQFCGGPNYGFFKVEDTGAAIKGNKIDIYTSNIKQALVNMRSYVDVYVVPIQMNWR"
FT   gene            153231..153635
FT                   /locus_tag="Tlet_0145"
FT   CDS_pept        153231..153635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0145"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   cdf:CD1278 RRF2-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32715"
FT                   /db_xref="GOA:A8F3I1"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I1"
FT                   /protein_id="ABV32715.1"
FT                   /translation="MGITIKSEYAFKILLQIANCQANEPVSLSLILTDVNVPKEFAEKI
FT                   MVSLKEAGIIESTRGRKGGYRLTKSADQITALEIVRAVDDPDKLIKCTMDENCCSDPTS
FT                   CTIRLKIWDNLKKSVEDTLSSIKLSDLFEA"
FT   gene            153651..154607
FT                   /locus_tag="Tlet_0146"
FT   CDS_pept        153651..154607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0146"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: tma:TM0519 GAF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32716"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I2"
FT                   /protein_id="ABV32716.1"
FT                   /translation="MRNIVQNIADDFFKILRFDKNDWYSYWKKYRAKYSPLIENYETSM
FT                   GLTEDDIRQLLQSMSRPLLDKLMQYWQSVSRDQKLFSSKLVSKKHKILELHREDFTIFL
FT                   TGLLGLKDWTVVNGNKEKVILIDILSLWKKNIVDQIAEVAFQSVKSFRRGETMGSYTSK
FT                   KQLFEELTNQIEEIIFQNNIHESMEEICNLLYENISYYNWVGFYLTDFDEKNTLVLGPF
FT                   VGEPTEHVKIPFGKGICGQAAEKKTTFIVQDVSKETNYLSCSPKVKSEIVVPIMIDGII
FT                   YGELDIDSHISNAFDKDDELFLKNICDKISQKIRNEE"
FT   gene            154614..155744
FT                   /locus_tag="Tlet_0147"
FT   CDS_pept        154614..155744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0147"
FT                   /product="Ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG: tma:TM1873
FT                   ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32717"
FT                   /db_xref="GOA:A8F3I3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I3"
FT                   /protein_id="ABV32717.1"
FT                   /translation="MEVTDIVKKAARTFETPFLIIDLDIIEENYRKLAAAIPDCKIFYA
FT                   IKANSHPRILERLRDLGSNFDVASIGEIKKLMNLGVTADRMIFANPIKREKDIAEAYDL
FT                   GVYLFAADSTMELDKIAENAPGSQVVIRVAVENTHSDWPLSRKFGVDLLVAVDLIAYAQ
FT                   KLRLTPVGVSFHVGSQNYDPHSWSNAIERVAKIFYWAERNFGIHLRVLDIGGGIPIKHV
FT                   KPIPTVEEIGEIVLQSISEHLYGVRNLQIFAEPGRSMVGNSGILVSKVLLRCQRGSEEW
FT                   VYIDAGVFHGLMETIENFRYEIEVDGKESEQKIPFVLAGPTCDSVDKIYDDALLSYNIT
FT                   LDDIVYFINAGAYTVEYGTNFNGIPSPKVYFLQDLL"
FT   gene            complement(155745..156140)
FT                   /locus_tag="Tlet_0148"
FT   CDS_pept        complement(155745..156140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0148"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   tma:TM1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32718"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I4"
FT                   /protein_id="ABV32718.1"
FT                   /translation="MKSFTVKSTQREQFLDITHEVQRIVDESNTKEGLCVAFVPHTTAG
FT                   IIINEGADLSVRSDILSKLSRLVPSNENYSHLEGNADAHIKSAIIGSSVAIPISEGRLT
FT                   LGTWQKVFLCEFDGPRVRSVIVQVIGK"
FT   gene            complement(156153..156425)
FT                   /locus_tag="Tlet_0149"
FT   CDS_pept        complement(156153..156425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32719"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I5"
FT                   /protein_id="ABV32719.1"
FT                   /translation="MWFFGLFKKKKREKSRETAYKRLETILERRRPVAVTEVIPKQEFE
FT                   ENSEKIKERIVDWVSDTFKVDRERVKVEFEEHNGYIVIITNVLFE"
FT   gene            complement(156432..157247)
FT                   /locus_tag="Tlet_0150"
FT   CDS_pept        complement(156432..157247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0150"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: tma:TM1870 septum
FT                   site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32720"
FT                   /db_xref="GOA:A8F3I6"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I6"
FT                   /protein_id="ABV32720.1"
FT                   /translation="MAKVIVVTSGKGGVGKTTITANLGCTLAKLGEKVCLIDADIGLKN
FT                   LDVVLGLENRVVYTLVDVVNGKINAQEALVRHKQMRNLYLLAASQVATKEMVSPEDMKA
FT                   IAKTLYPVFDYILIDSPAGIERGFRNAVAPAEIALIVTTPELPAISDADRVVGLLENFG
FT                   FSDKSMKVILNRFKIKMVKAGEMLTQQDVESTLALEILGVVPDSEEVIIATNKGLPVVL
FT                   NGDMTVSKVFENIARRLKGESVPVDNDISQMSEKGFMTFFRNLFNRKRG"
FT   gene            157756..158499
FT                   /locus_tag="Tlet_0151"
FT   CDS_pept        157756..158499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32721"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I7"
FT                   /protein_id="ABV32721.1"
FT                   /translation="MKTVVATIVTLLLSITVFPAAINVESRLIEYRSHRMEKEMWQLIQ
FT                   ELEEMPQDGKTLAILCEALTEYANWAKISQEEREKIYERAVEVGKKSVELLPESSYANY
FT                   VTGAAIGRLAQYKGIIQSLFMLGDFDKYILKAIELDPNNYTALVAMGMRYRDTPWPFRD
FT                   FRKSEQYFLKAIEVEPAYVNSYYELAVLYEQWSEIARKSEDREKYFQKAKQLYEKIILM
FT                   EPHPQWIAQGEETKQIASNWLKEHD"
FT   sig_peptide     157756..157827
FT                   /locus_tag="Tlet_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.864) with cleavage site probability 0.429 at
FT                   residue 24"
FT   gene            158522..159124
FT                   /locus_tag="Tlet_0152"
FT   CDS_pept        158522..159124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0152"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; amino
FT                   acid-binding ACT domain protein; KEGG: tma:TM0892
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32722"
FT                   /db_xref="GOA:A8F3I8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I8"
FT                   /protein_id="ABV32722.1"
FT                   /translation="MFVKYWMNQDFPSIRINSTVQEALSVMRKYKVDYCVTTDEAGKFQ
FT                   GFVYKSNLADSELDSSVFDHVVFPDFYAYEDSYIEEAALTFRESHEACLAVVDQELNVK
FT                   GIITLSEILEAFVAITAMDEPGTRVLMKLEDKPGQLKEIFDVLAQNKMNVLSVNTIKED
FT                   GFRRVSIKVDTCEPEELAKTLKIFGIEYDRITREEGF"
FT   gene            159211..159837
FT                   /locus_tag="Tlet_0153"
FT   CDS_pept        159211..159837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0153"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   tma:TM0893 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32723"
FT                   /db_xref="GOA:A8F3I9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3I9"
FT                   /protein_id="ABV32723.1"
FT                   /translation="MKTDINIAFAAMLHLGTLAAVFIFAIYSIIRALKNIKIIFNLFIS
FT                   TLPAALIGITFENKIEQTFSNIELLPIFFCTTSLLLMLSSSKNGEKTLEQMSFIDALFI
FT                   GLFQALAILPGISRSGSTIAGALLLGFKREDSLSYSFLLALPVTAGAGLMKISEMRMSQ
FT                   IHLALTAFVVGIIALFILKKSVLTGKLKLFSYYCLLAGFLSFLVR"
FT   sig_peptide     159211..159270
FT                   /locus_tag="Tlet_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.594 at
FT                   residue 20"
FT   gene            159844..160461
FT                   /locus_tag="Tlet_0154"
FT   CDS_pept        159844..160461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0154"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   tma:TM0894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32724"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR039344"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J0"
FT                   /protein_id="ABV32724.1"
FT                   /translation="MRVDILVVGGTLRSAPYVMAPYSTVCLLYDENKKMLIDPGSFVTW
FT                   QSLEQSLKARNILPEDITDIILTHVHMDHIFNSIFFRNAMVHVHQKYRARDYSSFGPIT
FT                   GQLYSMVVSGWNHVNMLSGGEKLFGFVEIFYSPFHSSDHVSLVIESENMGKIFMPGDIC
FT                   YTKVDYYEIAKGYRNDEAAHFVRQASKNCDWIVFTHDEPLKL"
FT   gene            160473..160835
FT                   /locus_tag="Tlet_0155"
FT   CDS_pept        160473..160835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0155"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   tma:TM1620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32725"
FT                   /db_xref="GOA:A8F3J1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J1"
FT                   /protein_id="ABV32725.1"
FT                   /translation="MLKDFISYRQKLNDLINKKGNLHTKRFMNLDSQVYEQGALDTKTK
FT                   EMLGLVASMVLRCNDCITYHMIRLFQLGTTDEEYFELFNVALIVGGSIVIPHLRKAVEI
FT                   LEELREYEKDGKTISL"
FT   gene            160813..163491
FT                   /locus_tag="Tlet_0156"
FT   CDS_pept        160813..163491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0156"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tma:TM1619 DNA-directed DNA polymerase I;
FT                   TIGRFAM: DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 5'-3' exonuclease; 3'-5' exonuclease; SMART:
FT                   Helix-hairpin-helix domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32726"
FT                   /db_xref="GOA:A8F3J2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J2"
FT                   /protein_id="ABV32726.1"
FT                   /translation="MAKLFLFDGTGLAYRAYYALDQSLSTTSGIPTNATYGVLRMLIRF
FT                   LKDYVKIGDYTAFAMDTKTRTYRHELLEEYKAHRPQTPDAMIQQLPYIKRGVQALGIKV
FT                   LEYEGCEADDVIATLARMGEKEFEDIFIISGDKDMFQLVNDKIKVWRPSKGITDLEFYD
FT                   KKKIIEKYRVEPSKIVDLLALMGDSVDNVPGVKGIGMKTAAELIEKFGNLDEIYGKIDE
FT                   NSRIGKLLSRGKDDAFKSKQLVTLMTDLDLRLTWDDLKYAGYKEKELVEFLREMEFSSI
FT                   MKELGLYTQQDQKTPYIAVKDNNSLNELFEKIKKSQYFVLDLETDSLSPIDAEIIGFSI
FT                   SLPSKESYYVPLAHKNGPNVDKKSALNNLKSILENQSAKIIGQNLKYDYSVLKMHGIEP
FT                   VRPSFDTMIAAYLLNPDEKRFNLDELAMKFLNYKMISFEELFKDTSPLFGAVTFADVSV
FT                   EDATKYSAEDADITRRLYEILNIKLHEADLLEVLEKIEMPLIPVLVHMELEGVYMNIDY
FT                   LKDLSSKYAARMNELSQQIYNHAGEAFNLNSPKQVAHILFDKLKIQPTKKTSTGEPSTR
FT                   ADVLEELSEEHPIVRLILEYRKYQKIKSTYLDVLPKLVHPETGRIHSSFHQTGTATGRL
FT                   SSSDPNLQNLPSKQEESREIRKAVVPQRDSWKILSADYSQIELRVLAHLSNDQNLIEAF
FT                   KKDEDIHNFTSSRIFQVPENQVTPQMRSIGKMVNFSVIYGVSPYGLSQRTGLSYDQAQK
FT                   FIGEYFSLYPSVKEYFAKIVSYAKTHGYVRTMFGRRREVPQLRSKNASVRQEGERIAIN
FT                   TPIQGTAADIMKLAMINLYDKIKQMRLQSKMILQVHDELVFEVPDEEVEIVKNLVRDSM
FT                   ENVVRLSVPLKVDLKISDSWE"
FT   gene            163507..163986
FT                   /locus_tag="Tlet_0157"
FT   CDS_pept        163507..163986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0157"
FT                   /product="CheC domain protein"
FT                   /note="PFAM: CheC domain protein; KEGG: tma:TM1618 cheX
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32727"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J3"
FT                   /protein_id="ABV32727.1"
FT                   /translation="MDARVINALIAAIVNTLEVLIGEKPTVGKPGVLKEIKPKFDLITL
FT                   IGFVGGVEGNLIYSFNPDTALKIVSKMMNMPYENLDELAMSAIGELGNMIAGALAMNLE
FT                   KIGCKIVISPPTVVTGRELKISVEGLTLQLPVSVASDDDVETILSVKGSVKCGKT"
FT   gene            163971..164231
FT                   /locus_tag="Tlet_0158"
FT   CDS_pept        163971..164231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32728"
FT                   /db_xref="GOA:A8F3J4"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J4"
FT                   /protein_id="ABV32728.1"
FT                   /translation="MRKDLNKYSVVLNFGVTVISNIIVGTLIGYYIDKWTFKNGVFLIV
FT                   FVLLGIASGLYNGFKYLLKEADKYDKHDKEDDNKRDDSGIR"
FT   gene            164176..164505
FT                   /locus_tag="Tlet_0159"
FT   CDS_pept        164176..164505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32729"
FT                   /db_xref="GOA:A8F3J5"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J5"
FT                   /protein_id="ABV32729.1"
FT                   /translation="MTSTIKKMITNVMILGSVEIVVFFMLFGYRGAMGVLAGTIGACVN
FT                   IVSLWYDVKKCVKKRRKMSLTGYLSRYTFSGAVMVFGSIFSLPALFGAFFGLMNEKIAA
FT                   FLSWR"
FT   gene            164510..165367
FT                   /locus_tag="Tlet_0160"
FT   CDS_pept        164510..165367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0160"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   tma:TM1616 ATP synthase F0, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32730"
FT                   /db_xref="GOA:A8F3J6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J6"
FT                   /protein_id="ABV32730.1"
FT                   /translation="MKISLDKRAKVLLAIFLVVYIVVGVLNAIYLSKQNMGEAFKNVAN
FT                   RWVVDLPFGKGIFSRINPLTIFMTWGIMAAIILIALRLRKPQVVPDRKQSLVESLLEFV
FT                   YNMVEDAVPDQRFVRPTFYIACTLFIFIVFSNILGGAIPGISIEANAQGTVEKIHLFSD
FT                   TWFSPTADINTNAFLAVFVFIISQVFAIKSKGIKSWAKSWFEPIPFMFPMNVIGELSKP
FT                   ISHSLRLFGNIAGGALLTYLLAYMAKYLFLPVILWGFFGLFVGVIQALVFTVLAIAYIS
FT                   SALS"
FT   gene            165383..165643
FT                   /locus_tag="Tlet_0161"
FT   CDS_pept        165383..165643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0161"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   tma:TM1615 ATP synthase F0, subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32731"
FT                   /db_xref="GOA:A8F3J7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3J7"
FT                   /protein_id="ABV32731.1"
FT                   /translation="MENVSPSLAEALIQMGKFIGAGICMGAGAIGPGIGEGHVGDGAMQ
FT                   AMARQPELIGVLTTRMLLSQAVCETTGLYSLLISILILFVL"
FT   gene            165656..166144
FT                   /locus_tag="Tlet_0162"
FT   CDS_pept        165656..166144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0162"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   tma:TM1614 ATP synthase F0, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32732"
FT                   /db_xref="GOA:A8F3J8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3J8"
FT                   /protein_id="ABV32732.1"
FT                   /translation="MGFVELNLTGIIQLLNFLILLFVLYKFLYKPFLQIADKRREKIQS
FT                   DLASAEKELKEAQEMKKQAHDALESARKSADGIISEARQKSEEIINQAKVKAREEAEKV
FT                   LNSARNEIEREKKQALQEIEKRAGEIAVTLALKILQGVLDEKAKREYLINILNKEKEK"
FT   gene            166141..166689
FT                   /locus_tag="Tlet_0163"
FT   CDS_pept        166141..166689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0163"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: tma:TM1613 ATP synthase F1, subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32733"
FT                   /db_xref="GOA:A8F3J9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3J9"
FT                   /protein_id="ABV32733.1"
FT                   /translation="MRYSQIAAKYARALLNVAVELEKTEEYGDILAVVVQLYQKAKQFF
FT                   DDPTIGAAEHVDRITKFINQIGAHFDKPFWNFLKIVFEKRRQSVLPAILQYYKNMKIES
FT                   EMKVPVFLTTAYELSEEELKVITDFVRKYTKRNPVFETRIDESLIAGVVIECEGKTFDA
FT                   SVAGRIRNVTRHVLQREVM"
FT   gene            166690..168201
FT                   /locus_tag="Tlet_0164"
FT   CDS_pept        166690..168201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0164"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; KEGG: tma:TM1612 ATP synthase F1, subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32734"
FT                   /db_xref="GOA:A8F3K0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3K0"
FT                   /protein_id="ABV32734.1"
FT                   /translation="MRISPGEITKVLEDRIKEFKEEIDLQETGRVVQIGDGIARVYGLN
FT                   SVMADELVEFVETGVKGLAFNLEEDNVGVILLGPYSQIKEGHIVKRLKKIIEVPVGEEL
FT                   LGRVVNPLGEPLDGLGPVEAKHTRKIEIKAPGVIYRRPVNTPLQTGIKAIDAMIPIGRG
FT                   QRELIIGDRQTGKTAIAIDTIINQKGKGVYCIYVAIGQKTAAVARIVDKLREFGAMEYT
FT                   TVVVASASDPAPIQYIAPYAGCAMGEYFMYNSKDALVVYDDLSKHAAAYRQLSLLLRRP
FT                   PGREAYPGDIFYLHSRLLERAARLDDKMGGGSLTALPIVETQANDVSAYIPTNVISITD
FT                   GQIYLEPGLFYSGFRPAINVGLSVSRVGGSAQIRAMKQVAGMLRIDLAQFRELETFAQF
FT                   ASELDPATRAQIVRGQHLQELLKQDQYSPLPVEEQVVVLYAGVRGYLDELPVESVRKFE
FT                   KEFLDYMRTSKSSLLKLISEKKELTQEVEDELKKSIQEFLEGWHE"
FT   gene            168201..169013
FT                   /locus_tag="Tlet_0165"
FT   CDS_pept        168201..169013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0165"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   tma:TM1611 ATP synthase F1, subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32735"
FT                   /db_xref="GOA:A8F3K1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K1"
FT                   /protein_id="ABV32735.1"
FT                   /translation="MSRGKLRSVKARIQSTSALMKITRAMEMVARARVRKLEEGFRKAK
FT                   TFASSVEVLKDRIDFSSCDHPFVIGSGKPVLVVVSSDMGLCGSFNAEIIRETERRLKDF
FT                   EILITVGSKATAHFSSNKKLAKSYQRIYETPAFNVAAALMEDLLKISGNVHIIYGKFVN
FT                   RLVQRPTCVQLTPIAGGKNIERYEYEPFSEELAANFANFYVATKIFSLLYETKVSEMYA
FT                   RQNAMRNATENAREMIRTLTLEYNKARQASITQELIEIVTGAEALKEE"
FT   gene            169027..170436
FT                   /locus_tag="Tlet_0166"
FT   CDS_pept        169027..170436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0166"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase; KEGG: tma:TM1610 ATP
FT                   synthase F1, subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32736"
FT                   /db_xref="GOA:A8F3K2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3K2"
FT                   /protein_id="ABV32736.1"
FT                   /translation="MAGKGYIVRIIGPVVDVKFDEKELPDIYNALEVTNPQNGEKLILE
FT                   VEQLIGDNTVRAVALDSTDGLTRGLEVVDTGKPIVAPVGKGVLGRILNVVGKPIDEKGD
FT                   IQAEDYWPIHRPAPKITEQKTEIEVLETGIKVIDLLAPFPKGGKIGFFGGAGVGKTVLV
FT                   MELIRNIAIEQKGFSVFAGVGERTREGNDLWLEMQEAGVLENTVLVFGQMNEPPGARFR
FT                   VGLTALTIAEYFRDVEGRDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLATDMG
FT                   ELQERITSTQKGSITSVQAIYVPADDITDPAPATTFSHLDASVVLSRKIAELGIYPAVD
FT                   PLDSTSKILDPAVIGWEHYQVARGVQEVLQRYKDLQDIIAILGMEELTEEDKLIVQRAR
FT                   KIQRFLSQPFFVAERFTGANGKYVPISETVKGFKEILEGKHDSLPEQAFFMVGTIDEAV
FT                   QKAERLKGSAA"
FT   gene            170433..170801
FT                   /locus_tag="Tlet_0167"
FT   CDS_pept        170433..170801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0167"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: tma:TM1609 ATP synthase F1, subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32737"
FT                   /db_xref="GOA:A8F3K3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K3"
FT                   /protein_id="ABV32737.1"
FT                   /translation="MIEVEILSPSTVCWIGKAKFMSFRTVDGSMGILPKRAPIVAQLAI
FT                   DYVRVVTESEEKTFATYGGYIHCDGQKVTVVSSIVVPVEDLDPHVFKNAQERAKKLLEY
FT                   QDQLYRNTKIEADVRAGK"
FT   gene            170966..171631
FT                   /locus_tag="Tlet_0168"
FT   CDS_pept        170966..171631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32738"
FT                   /db_xref="GOA:A8F3K4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K4"
FT                   /protein_id="ABV32738.1"
FT                   /translation="MIVEKFVLPFFNRKTLPSSDFYSYSMLIFFISNILGLIASIIVVS
FT                   ADYLLALSANRFLGLTQGMSIFSGLSLLFVVIRWSFVIKELRRELIEKIPEYASIAIRS
FT                   DETLINLGTAVTTAGLVISLFVPFGFLVTLVGLSLAYYFFFNSMKEYENDELIFFSKMP
FT                   KIAEFSKTKIFNFEVDANVIIYSLITLFGYLTFHQEQYISSVESYVKSRKQLLEEVSV"
FT   gene            171628..172161
FT                   /locus_tag="Tlet_0169"
FT   CDS_pept        171628..172161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0169"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   tma:TM1607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32739"
FT                   /db_xref="GOA:A8F3K5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K5"
FT                   /protein_id="ABV32739.1"
FT                   /translation="MNYIFSTKGFDSSPAIEEYLEKRFQKVDRVLKENDIVSAEIRAEK
FT                   DAINYVLKANINFKGNIIVVQEKDPDLYTAIDRLSDALEKRVKKIKSTVRERHRMPVEK
FT                   IPSISDTYEFEEEGSEVYEAKRVPLSVMPLEEAILQFKTMERQFFVFRNSETNEINLLY
FT                   IRKDGKIGLFEFVD"
FT   gene            172177..173589
FT                   /locus_tag="Tlet_0170"
FT   CDS_pept        172177..173589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0170"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; KEGG:
FT                   tma:TM1606 cytoplasmic axial filament protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32740"
FT                   /db_xref="GOA:A8F3K6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K6"
FT                   /protein_id="ABV32740.1"
FT                   /translation="MANQLVINIQEEKVNVAILSDGVLQEIFSEEDESLSGNIYVGRIE
FT                   KIIPGLNAAFVNIGGNRNGFLKLTDITKQYISEVTKSPVKEGIKILVQVKHDAIGTKGP
FT                   QLTGKISLAGRFLVYFPLSKVRGVSKKVQEPKERVRLQELSRSLAKNDGVVIRTAAEFV
FT                   PEEYVAEEFNQLKSEWRKVLQSFKRARKIKLLRREPTTVDYILRERLNKDIDEVHVNTR
FT                   EIYEKVKEVSKRLAKKPMIYFFEGDLFDKLCIYSQIGQLQERIIHLPSGGYIALDTTEA
FT                   MTVFDVNSASFVSEKNHADLAYKTNVEAAYEIARQLRLRNIGGIVIVDFIDMPSKTYYD
FT                   RLTKELQQAIRNDSAHIELIGFTKLGLLEMTRKRRSPSIDQLLFSGCPICKGTGRVVSP
FT                   HIVVRRVINELSKIENISEYSSVKVILHQRLSGYTEKIKKSLSSTIVEKIRFSFEGSNP
FT                   GDFSVVFTKKTS"
FT   gene            complement(173586..175394)
FT                   /locus_tag="Tlet_0171"
FT   CDS_pept        complement(173586..175394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0171"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; KEGG: tma:TM1123
FT                   flagellar hook-associated protein 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32741"
FT                   /db_xref="GOA:A8F3K7"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K7"
FT                   /protein_id="ABV32741.1"
FT                   /translation="MDLSSIASTINYNYQSSSSRIQFGGLFSGLDTSSIIDALLATDIE
FT                   AAERLNTKYKQLDLKQKAYQQLDDKLEQFMNFLSNFKLQSNLLSKNVETSSTILSASAN
FT                   ASTANGTYYVKVLSLATRSSLTGGGTIGPDNISSSATFSSLMYRYTPADSTLKVQKGSS
FT                   TYDLSISTTDTIDDIIAKFETIFGSGNVIFSDGKLNITSDEAFAIRQTQGTFMQVFNLV
FT                   DAPVELNGSTYSMQSTAHIGAISANKKLGDIASYRGLSLNDGQISINDVSISFTTTTTL
FT                   SELISAINNSDAGVTARYDENSDKLILTSDSTGANTISIDDGGSGLSQLLRLDTSTFNV
FT                   GSSAHVQISTDNVNWTDLYSSSNSFKYNGLTIDVQNTSESTQTITVENNVDATVEQIKE
FT                   FVNQWNDIMSYLYEKLNETEVTDKDEEEMTEEEKMQGILNNDSFLRTVFNKLRNYITTS
FT                   MPGEIKYLWEIGISTGSYGYENMVVGKLEIDEDKLRSKIEENPEAIWEFFGQNEENTEG
FT                   FAQQIQQYVKELTKYGGQIDQVAGLNGSINREKRVLAQQLADWIERIQKKEEDLWSKFA
FT                   TMEQIIAQMQAQSSYLSQISSSSSSS"
FT   gene            complement(175400..175732)
FT                   /locus_tag="Tlet_0172"
FT   CDS_pept        complement(175400..175732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0172"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   tma:TM1124 flagellar protein FlaG"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32742"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K8"
FT                   /protein_id="ABV32742.1"
FT                   /translation="MRINPVNDVNTHNVPQQKTAQAEIHIKNRENYDKTNIETVLDGIE
FT                   KSLEKIRSFLKAEAQFTIDRDLNMIIIKIKNTETGEIIRQIPPEVAVKIAKNLQELIGI
FT                   LFDERA"
FT   gene            175911..177188
FT                   /locus_tag="Tlet_0173"
FT   CDS_pept        175911..177188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32743"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3K9"
FT                   /protein_id="ABV32743.1"
FT                   /translation="MRRFIIAFLLFCFFVCGLSGVQLKIEFKSSADTKILVEDVSKVIS
FT                   SLLPEKTYLEITLDGSNLLATGDSTQIDTVYELTFIATYDATQNKYNASWYDQTQLAYS
FT                   CSYSPKDQRPYSDFVRECAHYPLEKVSLWLLKNDQFEKYLRITYHPSVDEYGSFSPDGK
FT                   YFAFITDRLSGNRNIALLDLQAGKITVLPVAGSSEYFPRFSPDGKRLLFQGSLHGFWNI
FT                   YVMPLENYSKNIVLISAGNNPAYNPCWYDDGTVLYVQDSEYGNRLLLSTIAKKRKQIEI
FT                   PYPFEMVFSPTVYKDTIYFVGLKESDFGIYALTSDGTVTVVENTVFNEHDPAISPDGRY
FT                   LAYSCNITGYYTIWVKDLFTQEKWCITQDIPHDAFYPVFSPDGKVVAFSVYEGNFEPDI
FT                   WFVRFRPVSSTLQAESVPRSSRAPCH"
FT   sig_peptide     175911..175973
FT                   /locus_tag="Tlet_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.328 at
FT                   residue 21"
FT   gene            complement(177121..177579)
FT                   /locus_tag="Tlet_0174"
FT   CDS_pept        complement(177121..177579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0174"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein; KEGG: tma:TM0718
FT                   purine-binding chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32744"
FT                   /db_xref="GOA:A8F3L0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L0"
FT                   /protein_id="ABV32744.1"
FT                   /translation="MELKVVSFLLGEEKFALDIMSVDSIVEMGKIVKIPESADYVEGIM
FT                   NLRGNVIPIINLKKKFKMKITDRAPSSKIVVINLDDRKIGLLVDQVHEVLTITDKQIEQ
FT                   PPADLGKTKTNIVLGIAKFEEDLLIILNGKELLTSEEQIQLEGLTKLA"
FT   gene            complement(177593..178006)
FT                   /locus_tag="Tlet_0175"
FT   CDS_pept        complement(177593..178006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0175"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: tma:TM0717 methylmalonyl-CoA decarboxylase
FT                   gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32745"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L1"
FT                   /protein_id="ABV32745.1"
FT                   /translation="MARKFRVVVNGKEYIVEVEEIGLSGVQQPIIRQSTIPVEKSAEKT
FT                   VIEHSKPERIEPQPAQPSATVSGVEIKSPMSGLILKVHVSEGQKVTRGQKLIVLEAMKM
FT                   ENDILSDHDGTVTKVLVKEGDNVETGQILLQID"
FT   gene            complement(177982..178317)
FT                   /locus_tag="Tlet_0176"
FT   CDS_pept        complement(177982..178317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32746"
FT                   /db_xref="GOA:A8F3L2"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L2"
FT                   /protein_id="ABV32746.1"
FT                   /translation="MSLATYVLVGITAVFSIFVVLYTIFRLMEFLSRDSKTKQKKSETA
FT                   DEKKTVEKHDDTHIAIISAVINEIFGEPVKIKSIHLSKNYSFDDRTVQWRRYGWKGARR
FT                   WRASSGW"
FT   gene            complement(178327..179868)
FT                   /locus_tag="Tlet_0177"
FT   CDS_pept        complement(178327..179868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0177"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: tma:TM0716
FT                   propionyl-CoA carboxylase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32747"
FT                   /db_xref="GOA:A8F3L3"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L3"
FT                   /protein_id="ABV32747.1"
FT                   /translation="MEEFINKLHQLDQHIEKGGGDDRIAKQHAQGKLTARERISLLLDA
FT                   GSFVEIDKFVRHRSTLLGMDKEDLPADGVVTGIGRIDGRSVAIFSQDFTVMGGSLGEMH
FT                   AKKIMKIMDLAMELGIPLIGINDSGGARIQEGVDSLYGYGGIFYRNTIASGLIPQITLI
FT                   AGPCAGGAVYSPAITDFVVMIDKTSRMFITGPNVIKAVTGEEISQEDLGGGYVHNAKSG
FT                   NAHFLASDEQDAVNIVRKLLSYIPQNNLEEPECIPGNYETTISEEILSTVPVESNKGYD
FT                   VRNVINLVVDQGSFFEVHKHYAKNIVVGFARIFGKSVGLIANQPSVLAGALDIDSSDKA
FT                   ARFIRFLDAFNIPIVTFVDTPGYLPGVQQEHGGIIRHGAKLLYAYSEATVPKITVILRK
FT                   AYGGAYIAMGSKHLEADFVAAWPTAEIAVMGPEGAANIIFRKDIESAPNPEEKRKELVQ
FT                   MYKETFANPYVAASRGYIDAVIDPRQTRDWLIKVIDICQTKVRSLPKKKHGNIPL"
FT   gene            complement(179881..180288)
FT                   /locus_tag="Tlet_0178"
FT   CDS_pept        complement(179881..180288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0178"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: afu:AF2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32748"
FT                   /db_xref="GOA:A8F3L4"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L4"
FT                   /protein_id="ABV32748.1"
FT                   /translation="MITKKIDHVGIAVRDASKRLSVYRDFFNLQNIHVEEIAERGIRVY
FT                   MIQVGESKIELLEPMNENSEISKFLDSKGEGIHHIAFNVLGIDQAAELAKSNGLQPLSD
FT                   KPKAGAEGTKVLFLHPKTTGGVLIELVEGNH"
FT   gene            complement(180332..180571)
FT                   /locus_tag="Tlet_0179"
FT   CDS_pept        complement(180332..180571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0179"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family;
FT                   KEGG: tma:TM0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32749"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L5"
FT                   /protein_id="ABV32749.1"
FT                   /translation="MPFYRYVCENCNSQKTVFHSINEDPEIFCECGKQMKRAISRVGII
FT                   FKGSGFYSTDSRKNGVQSSESSSESKKKSEEKVA"
FT   gene            complement(180652..181809)
FT                   /locus_tag="Tlet_0180"
FT   CDS_pept        complement(180652..181809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0180"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   tma:TM0111 alcohol dehydrogenase, iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32750"
FT                   /db_xref="GOA:A8F3L6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L6"
FT                   /protein_id="ABV32750.1"
FT                   /translation="MFNIFLPTKIIFGQGSVEHLPDSIKNLGNKAMIVTGKKSTKQSGL
FT                   LDRIVSLLKKTDVESVIYDKIQPNPVSNDVDEAAEIAKKENVKFVIGLGGGSAIDSAKA
FT                   IALTAAMGGKFWDYVEVGGGKKPDKALPVIAIPTTHGTGTEADPFAVITNPETNEKVGI
FT                   GYSVIFPKISIVDPEIMITLPKNQTAYTSLDAFYHSLEAFLNIDANPYSDILAIDSMKR
FT                   IVANLPIAYRNGADIYARTNLAWASTEAGITETLTGVIANHAIEHGLSGFHPELPHGLG
FT                   LCITGPYLLEYIFDEIRERLAILAHEVFNIDEYNTTTAARIFIDMLFEFQELFSLNQKL
FT                   SSLGFKEKELENIAKVAYRAMKGVVVKTPKKLQENDLLQIIKKAF"
FT   gene            complement(181821..182264)
FT                   /locus_tag="Tlet_0181"
FT   CDS_pept        complement(181821..182264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32751"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L7"
FT                   /protein_id="ABV32751.1"
FT                   /translation="MLRIPEMEFIEYFNAPIEKTWTTFVNHCGWDPWFTDGMKIDLYEG
FT                   GQIYFRWKRLTQGQIVEDKGIVISIIPHKIMEFWWYEYDDGYRSRVKMTFQSDAARGTW
FT                   VKIEDRVFVSNVNELDIAFGCAFGWGQMLCLAKAYIEKGVILI"
FT   gene            182478..183443
FT                   /locus_tag="Tlet_0182"
FT   CDS_pept        182478..183443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0182"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ctc:CTC00907
FT                   D-ribose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32752"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L8"
FT                   /protein_id="ABV32752.1"
FT                   /translation="MRKFLLVLAMVFTLSALVFGAYEIAFVVKATDSDFWQYTIVGAKN
FT                   AEHDLQGLVKVTVYGPPSEADIDKQVAILEDVIRTKPDAIVISSTSSHATAPALNKAYQ
FT                   QGIKIILIDNFVYDTGYHSFLATNNKVGGGLAAEKVVELLKKSGRPLKGKVGLISSMAG
FT                   VQVLIDRDDGFTARLKELAPDLEILPTRYVDNDIAKAAAAAEDLITAYGDQLVAIFADN
FT                   NHTGDGVARVIEEQNLQDKVIAVAYDSDPQEVEALRNGSLKALIVQDPHGMGYKGVMFA
FT                   FMAINGETLPSYFDTGVYVVTKENMDNLQWVLDPYKRKKY"
FT   sig_peptide     182478..182540
FT                   /locus_tag="Tlet_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.821 at
FT                   residue 21"
FT   gene            183505..184203
FT                   /locus_tag="Tlet_0183"
FT   CDS_pept        183505..184203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0183"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   tte:TTE0975 Deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32753"
FT                   /db_xref="GOA:A8F3L9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3L9"
FT                   /protein_id="ABV32753.1"
FT                   /translation="MFIKFSERDFAKLFDSTLLKPETSWDEILNFVDESIKYDVRAIAI
FT                   PWYALTYAIKKVSTTDIGIVVGIDFPFGYSSIERKLDEIKFYLSFSEKITDFDVVVNIS
FT                   AVRSNNWEYVQEELRILSQEIKKHDKICKIIIETSRLSDNEIVRLCQLISNESSIDYVK
FT                   TGTGFGPAPTTYKDVQLMKKYLGGKKIKVSGGIKTLDQVKRFLDMGVSLFGSSAAIEII
FT                   DEFVERHRRK"
FT   gene            184207..185718
FT                   /locus_tag="Tlet_0184"
FT   CDS_pept        184207..185718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0184"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rxy:Rxyl_3003 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32754"
FT                   /db_xref="GOA:A8F3M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M0"
FT                   /protein_id="ABV32754.1"
FT                   /translation="MRELLRVDNVSKSFPGVKALDGITFSLNSGEVRGLVGENGAGKST
FT                   LIKIITGAYSKDSGKLYFLGKEIKRNDPVLSRKLGIYAVYQDVMIAPDISVAENFFLGS
FT                   QPGFFGFVNWRKMRSESRKFLNEIDLAVDVDISTRSLSLANKEMIAIAKVMLFNPKLVI
FT                   FDEPTAVLTDNEKRLLFDLIRKLKKKNIGVIYISHNLEEVFEICDTVTVLKDGKVVGTY
FT                   KTEEIGNVNSLIPLMVGRKIEEMYYKEKVEIGEEILKVEGLTGKKFKGVSFSLHSGEIL
FT                   GLYGLAGAGRTEIARAIFGADKIDAGSVFVKGKKVAINNAKDAIKLGIGYLPEDRRNQG
FT                   VFPPQSVEFNVNIVNYQDILSKFFVFVNQKKAKRISKELINKLSIKASSITQSVYQLSG
FT                   GNQQKVILARWLSRFAQVLILDEPTNGIDVGAKAEIYRLIGEIVNQGKSVIFISSYLPE
FT                   LIGICDRIIVISNGAVAGVLERSNFSEERLLTLAMSNVRKKEGAS"
FT   gene            185715..186686
FT                   /locus_tag="Tlet_0185"
FT   CDS_pept        185715..186686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0185"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psb:Psyr_2570 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32755"
FT                   /db_xref="GOA:A8F3M1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M1"
FT                   /protein_id="ABV32755.1"
FT                   /translation="MKQKSKMVIRGTSFAERNLIIIFLVLAVFLAFATKGTFLSFGNIT
FT                   NLLRQTSINGVVALAMLFVIITGGIDLSVGSVVGLSGMVFAMLTSSRLQFQFSTFQAVV
FT                   IALLVSIFVGVGDGFAVHDLKVPPFIATLGMMTFVRGLVMYISSGRMITGIPYSFVNFS
FT                   SENILDIPKLVWLWVVMAVIVTIVLKYTKFGRNLYALGSNKEAARLSGISLRLNYYGAY
FT                   AVSGLLSGIAGIMLASRLAAGVPTAGQGYELDAIASVVIGGASLSGGTGTALGTVIGAL
FT                   LIQTLRNGGNLLGIDPFVMQMAIGLIIIAAVFFDQYVKARRG"
FT   sig_peptide     185715..185816
FT                   /locus_tag="Tlet_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.959 at
FT                   residue 34"
FT   gene            186691..187335
FT                   /locus_tag="Tlet_0186"
FT   CDS_pept        186691..187335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0186"
FT                   /product="Transaldolase"
FT                   /note="PFAM: Transaldolase; KEGG: lmo:lmo0500 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32756"
FT                   /db_xref="GOA:A8F3M2"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M2"
FT                   /protein_id="ABV32756.1"
FT                   /translation="MKIYIDGCDKQSIDLAEKFEIGITTNPTIIVNKCAKRSLFELIGF
FT                   FSQIKVPEIFLHVEKSYEDIVECLDTKKFVIKLPWVEENYELSVLLKKKGFRVCATAVY
FT                   ELSQLITALTLNVDFVAFYYDRASKKGIDPEKRICEFMEIISKNHSDTRVIVASLKNAN
FT                   QILSAVKTGVSHITIPVDLFKEFVKVPEYVLVDVRKFSEDLKKISISERKK"
FT   gene            187332..188276
FT                   /locus_tag="Tlet_0187"
FT   CDS_pept        187332..188276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0187"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mlo:mlr8492
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32757"
FT                   /db_xref="GOA:A8F3M3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M3"
FT                   /protein_id="ABV32757.1"
FT                   /translation="MNVNRVSVLGSFVVDLAVFSSHIPNPGETVFSESFKMGPGGKGFN
FT                   QAVAAKRSGADVLFITKIGQDLFSILAEQAFEKYDLCKKYLLKSKTYGTGVALIIVNET
FT                   NGNNAISVVPNACVDITLEDVEKNSEIFEKCDVFVAQFESNLQATYRAIELAKRSGAVT
FT                   VLNPAPVREFDYEILKYVDILIPNEIEACLLAESFSNCNKVSKIAAKLEKFVDTVIITL
FT                   GEKGVFCSKISHEIIPAIRVNTVDTTGAGDAFVGIFASYLSRNYSLRECVNFAITGAAL
FT                   STTRYGTSPSMPSQKEIELMYRSVFSNEEGQDL"
FT   gene            188273..189796
FT                   /locus_tag="Tlet_0188"
FT   CDS_pept        188273..189796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0188"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bth:BT_4423
FT                   xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32758"
FT                   /db_xref="GOA:A8F3M4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M4"
FT                   /protein_id="ABV32758.1"
FT                   /translation="MSYIISYDLGTTGNKATLFKNDGKLLASVFHPYETNYFNINWVEQ
FT                   DPNDWYESVKISTQKLFKLSKINSDDVKVISFSGQMMGIVPIDRNGNPLRPAIIWADQR
FT                   SITQADRLKKLGDEKVYSITGSRITPTYAGPKISWIKDNEPDVYSNAFKFLFAKDFIIY
FT                   KLTGIAGTDFSDASLSLIFDIRKKQWSAELAEILNIDIGKLPEVSASTSIVGTVIPSVA
FT                   SELGLSEKTLVVRGAGDGSAATIGAGVFDSCEAYVYLGSSSWISTCTSEPFFDSKARTF
FT                   NFCYPIPDFYCPTGTMQSGGGSYQWAKNALCQFEEKLAKELNLNVYSIMDDLVDSTNPG
FT                   AKGLIFLPYLVGERSPHWNVNAKGAFIGLSVTHNKNDMLRAVLEGVSFNLKMILDVFEK
FT                   SGGYNFKKIRLIGGGAKGRNWRQIIADVFQKPIAVAKFPEEATSIGAAIIGGIGTKIIT
FT                   INDAKNFVKDLCLVEPRSMYFKRYEKMYEVFQKSYYSLLESFDLLAKID"
FT   gene            189816..190238
FT                   /locus_tag="Tlet_0189"
FT   CDS_pept        189816..190238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0189"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: bha:BH3729
FT                   D-ribose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32759"
FT                   /db_xref="GOA:A8F3M5"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3M5"
FT                   /protein_id="ABV32759.1"
FT                   /translation="MKKNGILNRELSYLIASMGHGDILSIVDSGFPISEDVFCVDLSLI
FT                   AGKPKIVEIIIPLLEELEIEKVLIAEEIKMISPKYHQKLLSIFPKNVQIEYIPHEKFKD
FT                   RVRESKGVVRTGEQTSYSSVILVGGVTYHGEKEEGL"
FT   gene            190235..191209
FT                   /locus_tag="Tlet_0190"
FT   CDS_pept        190235..191209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0190"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sfu:Sfum_1762
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32760"
FT                   /db_xref="GOA:A8F3M6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M6"
FT                   /protein_id="ABV32760.1"
FT                   /translation="MKYRSTSRFPEQISVIGLGCWELSGSNVWQGSNDEDSIKVVHKAL
FT                   KAGINFFDVAPVYGFGHAEEILGRAIEGFPRDKILIATKCGLIWDEHKRIKRCLKPESV
FT                   FQEIDQSLKRLKTDYVDLYQLHWPDPNTPIEETLDALTKLQKEGKIRYIGLSNFSRDIA
FT                   SKVLPYISSMQGLYNMFERNATSYHSIPLEYRSEKEILPFCERNGLAFFPYSPLMQGIL
FT                   TGKFLENEVFVDVRSANPKLSGEEFKKYIGVVRKLMEISREIGKPLSQVSINWLLKHEA
FT                   ITSIIAGATNPSHIEENVKALDWEMDDEVYRHIEKIISESGLE"
FT   gene            191228..192067
FT                   /locus_tag="Tlet_0191"
FT   CDS_pept        191228..192067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0191"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   bce:BC4053 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32761"
FT                   /db_xref="GOA:A8F3M7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M7"
FT                   /protein_id="ABV32761.1"
FT                   /translation="MKFHISEPLKKDSPVPLYYQVERALIKWISQNLKPGDLLPSEKEL
FT                   CEAFQVSRIVVRQALGNLVNRGLIQRQRGIGTIVIQPKINEHLVSKLTGFYADMKSQGL
FT                   NPKTKLLSSEIIRADDFLAYYLNLLAGEKVMRVHRLRYVNDDPILTVTTYIPCKICPKL
FT                   LEKDLENRSLYEILEQEYKIRLIWGERVIEAVAADLQDAKLLNVEKGSPLFFLRSITYT
FT                   ENNIPVEYYEAKHRADRTRFITRLFKTTYPDSEEINNVFNSELRLTRFFNKDFESTT"
FT   gene            192083..193519
FT                   /locus_tag="Tlet_0192"
FT   CDS_pept        192083..193519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0192"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mtp:Mthe_0395
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32762"
FT                   /db_xref="GOA:A8F3M8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M8"
FT                   /protein_id="ABV32762.1"
FT                   /translation="MFKCIINNKFVESPSGEVIQVKNPANIENIVGEIPSLSADEVEQA
FT                   IEAAHKAFNSWSQMSPVKRTEIIKHGVNIARSKIDEIAHLLTLEHGKTLREAKEEVASS
FT                   IDSIEYFANNALSILGETYPANKKDRFSIVIKQPVGVVVAIVPWNYPLLLLSWKIGPAL
FT                   ATGCTVVAKPSYYTPLSTLKFSECFIEAGLPEGVLNVVTGRASKIGKVLTEHPLISKIA
FT                   FTGSTAVGKEIMKSAANTVKKLTLELGGNCPMIVFEDADLHEAVKGGVRRAFRNAGQIC
FT                   NAVNRIYVHKEVFDEFVQRFVESAKKIKVGNGLDDSVEMGPMTTKEGWETVRKYVEEAS
FT                   NMGAKILCGGKKPDGEEYQNGYFFEPTVLVDVNHSMKVVRNEVFGPTAPIMMFETFDEV
FT                   IQKANDTEYGLVAYVYTKDLSKALKSAQLLQCGTVGVNNVSGGEFAYPYGGWKQSGFGV
FT                   ENSHHVYDEYLRLKHIRIDF"
FT   gene            193536..194066
FT                   /locus_tag="Tlet_0193"
FT   CDS_pept        193536..194066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0193"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: glucose-6-phosphate isomerase; KEGG:
FT                   pab:PAB1199 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32763"
FT                   /db_xref="GOA:A8F3M9"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3M9"
FT                   /protein_id="ABV32763.1"
FT                   /translation="MRPFTVSMNLDNINFNGNHIVRRYEDIKSIFKSTDISLEGKNPVI
FT                   YEVFESPVPEQQGHLIFLVTILYPGKVNEEFFMTKGHYHTVENTAEVYLGIKGKGLILC
FT                   QTKSGDFEVAEISENRVVYIPPFWAHRAVNIFDEPLIFFGIYPAHAGHDYETIAQSGFV
FT                   KRVFSKNGRVVIE"
FT   gene            complement(194071..195039)
FT                   /locus_tag="Tlet_0194"
FT   CDS_pept        complement(194071..195039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0194"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: sbl:Sbal_3086 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32764"
FT                   /db_xref="GOA:A8F3N0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N0"
FT                   /protein_id="ABV32764.1"
FT                   /translation="MGKKQQMKYKTLLLSSNPEKYVSFQISDQTPFEITMDFEVAWRLI
FT                   NRNLHSYANIVLDAKSFPAEVIKDFVSSLRKEIACVYPIVTIIAPNSAEKEFMSCGADK
FT                   VVENFSRFDLSLPVSMCDLEKLSPMAFIEFLIQTIKLKDKMLFDHLINVKTYTTVLAKL
FT                   CLERGLITDKELEFLSIASFFHDIGKLFIPDAVIRKPGKLTNEEFDIIKMHTLHGASLF
FT                   EKILRYEPKNQLVYTSFFVAKYHHEKFDGSGYPCKLKGEEIPLSARIVAIADVFDALTT
FT                   DRYYRSAYSPSEAIDIMKSCANHFDPEIFNIFLNNIDYFIK"
FT   gene            complement(195292..197460)
FT                   /locus_tag="Tlet_0195"
FT   CDS_pept        complement(195292..197460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0195"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: tma:TM0258 DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase type IA central domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I ATP-binding; DNA topoisomerase I
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32765"
FT                   /db_xref="GOA:A8F3N1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N1"
FT                   /protein_id="ABV32765.1"
FT                   /translation="MANKIIIVESPAKAKTIKEILKGEYDVLSSKGHVRDLPEKEFGVN
FT                   IEKDFEPTFKIIYGKEKIVQELKKKAKNKQVLLGSDMDREGEAIAWHLADILGVANEKN
FT                   RIIFNEITPQAIKNAVKEPRNIDMNKVHAQLARRILDRIVGYKISPLLWKMLKTSSSAG
FT                   RVQSAALKIVCEREIQRHKFQPKKFWKVQGYIGSLKFYLTHIDGKKIDMQQIDEKLAKE
FT                   IEKNVKVLKVIQIKTRKIQKKAPSPFITSTLQQEAANKLGFSVKKTMQIAQQLYEGIDT
FT                   PKGHRAFITYMRTDSTRVSEIAKQKAIEFITDKFGKNYLGKKVRTEKAKQNVQDAHEAI
FT                   RPVNIDLTPDQVEGDLGKDQYRLYKLIWERFMASQMADAIYEETTIQFQSDRYTFESKI
FT                   ERRIFDGFEIILKKDKEQEITIPSGEIRISKWQIEEDETKPPARYTEASMVRALEIRGI
FT                   GRPSTYATIISTLLERKYVIKSSNQLIPTVMGFVVNHYLEKKFPEIVDLQFTAKMEEAL
FT                   DKIEQGQKDYKELLRDFYNDFSKYLDEAQQKWLSIDMNTNLECDCKSKYKLKVGRYGLY
FT                   LLCENCSKTTSLALETPAVFYENTMYFTHQEKESIETVCPVCGGKLEQMSGRYGNYIKC
FT                   QNCGKTYTGFARGKCPKCSAVVEKKISKNKRIFFKCTSDNCDFISWLEPSNETCPECSQ
FT                   RLYYKKYRSKEVLYCQNCKKTFQLKTKK"
FT   gene            complement(197479..198897)
FT                   /locus_tag="Tlet_0196"
FT   CDS_pept        complement(197479..198897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0196"
FT                   /product="Phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: mta:Moth_0221 phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32766"
FT                   /db_xref="GOA:A8F3N2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N2"
FT                   /protein_id="ABV32766.1"
FT                   /translation="MKIKFGTSGWRAIMGDQFTFSNVKIVTQAIAEYLKKNGGRKVIVA
FT                   RDTRFMTENYAQLVAEVLAANGIKVLMPENPTPTPVVSYAIRHYKLDGGINITASHNPP
FT                   EYCGIKFNPSDGSPAPTEVTSEIEKLIEKIDERKIPLMNLREASSKDLFEIIDPKPDYF
FT                   KALSELIDIERIKSAGLRVIADLLYGSSIGYLDDLCQTICSDLDVVHNYRNPYFGGGRP
FT                   EPDETRLSEFSSRIKNLNWDVLISTDGDADRFGILDNNGEFVKPNEIIALLAYHLYKNK
FT                   GKIGPVARTIATSHAVDAVAHTFKQKVLETPVGFKFLATVLMSENAVIAGEESGGLSIA
FT                   NHVPEKDGILACLLVLEMIAYEKKSLSEIRKQFEKEYGKFNNTRIDIDFQSDEEKKQFL
FT                   DKFKNIEDYLVNLKIVDEDSVDGMRYFFDKDGSWLLVRPSGTEPIVRIYLESRDLQTLQ
FT                   TMLSAVRKISRYAE"
FT   gene            complement(198887..199939)
FT                   /locus_tag="Tlet_0197"
FT   CDS_pept        complement(198887..199939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0197"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   nucleic acid binding OB-fold tRNA/helicase-type;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; KEGG:
FT                   aba:Acid345_4294 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32767"
FT                   /db_xref="GOA:A8F3N3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N3"
FT                   /protein_id="ABV32767.1"
FT                   /translation="MKLGDRIPKEIFNELKPSKEPDFPYLEDLGSKVNENVQVIAKVTS
FT                   RKLQEARDQKKFLLMTLSDKTGSIRAIDWYNADENFLKINDGDVVVARGRIVYFEDHIQ
FT                   LNLEKSADSIKNLNDSEYDFRRFLEVTSRDIDKMYEKLIVFVKEISDSDLKKLLEKIFI
FT                   EDTEFVKLFVQCPAGVSVHHAYIGGLLEHTVDVVSSCKKIWQVYDSMLNKDLLLAGAMI
FT                   HDIGKVREYRVTQKGFEVTTEGELKGHIVLGVEAIREVAYKIGLTGSKLLHLEHIILSH
FT                   HGEIEWGSPVVPKTAEAFVIHSLENMDAKLARFRYLQEKGKKNGNEKIWTDYDRHLQRR
FT                   LWLGGQENED"
FT   gene            complement(200036..201010)
FT                   /locus_tag="Tlet_0198"
FT   CDS_pept        complement(200036..201010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0198"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: smr:Smar_0342
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32768"
FT                   /db_xref="GOA:A8F3N4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N4"
FT                   /protein_id="ABV32768.1"
FT                   /translation="MEILKVEKLVKTFSVKKGFFGKYFQIKPLDEVSFSLREGETLGVV
FT                   GESGCGKTTLGRTVIKLQKPDGGKIFFDGNDVTDIPEKDFQKYRRNIQIVFQDPFSSLN
FT                   PRMTVYETLARPIRIHKTVPKSEEKKTIVRTLESVGLKKEHMNRFPHEFSGGQRQRIAI
FT                   ARAIITRPKFIVLDEPTSALDVSVQAQIINLLKKLKKDLKLTYMFISHDLSVIKFLSDR
FT                   VAVMYLGQIVEMGKTDLVINNMLHPYTELLFNSVPIPDPAKKMNFELDASEVPSLINSP
FT                   AGCPFFDRCHLRLKECNRLRPKLEEVEKDHLVACFLYHKTVHR"
FT   gene            complement(200998..201987)
FT                   /locus_tag="Tlet_0199"
FT   CDS_pept        complement(200998..201987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0199"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: sth:STH2824 oligopeptide ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32769"
FT                   /db_xref="GOA:A8F3N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N5"
FT                   /protein_id="ABV32769.1"
FT                   /translation="MNELLKIENLKLYFNTEEGVVKAIEDVNLTINTGEIVGIVGETGS
FT                   GKSVTAMSILKLIPSPPARYLNGEIWFDGQKIDNLSEEAMSNIRGKKIAMIFQEPMTSL
FT                   NPTFTIGEQICDVIMAHMQIRKEEAFKKAIETFKLVKMQDPESLMIKYPHQLSGGMRQR
FT                   VMIAMALVCNPKLLIADEATTALDVTIQAQILGLLKKMNKELGLSILIITHSLGIVAQI
FT                   CDRVVVMYSGYTVESGNVYEIFNRPLHPYTRGLLNAIPSVENKLETLKAIEGTVPDLID
FT                   PPVGCRFHPRCGRVIKGLCDEHVPELTGFDHKVACFNPYDGGDENWRS"
FT   gene            complement(201996..202844)
FT                   /locus_tag="Tlet_0200"
FT   CDS_pept        complement(201996..202844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0200"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: drm:Dred_2452
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32770"
FT                   /db_xref="GOA:A8F3N6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N6"
FT                   /protein_id="ABV32770.1"
FT                   /translation="MPKKSSLVMFKRISKNKGALFGMFIVILMITVSIIAPLIAPYDPY
FT                   KQDLLSSLQRPSLKHVFGTDIFGRDVLSRVIYGARTSISISFFAVLIAIFIGTTAGTFA
FT                   GYFGGTIDEVLMRFLDILMAFPDILLAIAIVAALGPGKSNLIMAIAIYSFPQFARVMRA
FT                   SVLSVKNSEYVEAAKAIGESNISIMIRYVVPNAITPIIIQATLRMATAVLTISGLSFLG
FT                   LGVKPPEAEWGTDLAMARVYIEIAPHLGIFPGLALFLTVMGFNLFGDGLNDALNPRLKD
FT                   R"
FT   gene            complement(202847..203764)
FT                   /locus_tag="Tlet_0201"
FT   CDS_pept        complement(202847..203764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0201"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fnu:FN0397 dipeptide
FT                   transport system permease protein dppB"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32771"
FT                   /db_xref="GOA:A8F3N7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N7"
FT                   /protein_id="ABV32771.1"
FT                   /translation="MIKFVSRRLLLLIPVIIGVSLISFSIMHMIPGDPARIIAGEGATK
FT                   EDIEVIRTKYGLDKPLIEQYIRFMRGVLINDLRSIKTEKPIFGEILPRFSNTVQLAAVS
FT                   IVISSLAGIFLGIISAVKRNTWVDNFAMIFSLTGVSMPIFWLGILLIIIFSVVLKWLPS
FT                   GGKGGIQHIILPAITLGLATSAVIARMTRASMLEVLNQDYVRTARAFGLPERKIVYKYT
FT                   LKNALVPVITVIGLQFGYLLGGAVLTESVFGWPGLGKYIVDSIFSRDYIAVQVGIMIIA
FT                   VSFVLVNLIVDILYVFVDPRLRRG"
FT   gene            complement(203817..205367)
FT                   /locus_tag="Tlet_0202"
FT   CDS_pept        complement(203817..205367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0202"
FT                   /product="4-phytase"
FT                   /EC_number="3.1.3.26"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: ttj:TTHA1336 peptide ABC transporter
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32772"
FT                   /db_xref="GOA:A8F3N8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N8"
FT                   /protein_id="ABV32772.1"
FT                   /translation="MRKTVSWCILLLFTSFFAANLGGTLRFLIGVDITTLLGPNIPDSV
FT                   SNIVASHIFEGLIDVDENLKIIPSLAERWEIQENGTAYVFFLRKGVKFHDGEIFNAYAV
FT                   KKHFDYVLGSSLRNVGMFKGIIKEVQVVDDYTVKIILFRPYPPILYRLATSSAAWIISP
FT                   KAIDEFGSDPALFGKNPIGTGPFMFKSWKAGEKVELVKNPNYWREGLPYLDSLVFSIVS
FT                   EDISRVTQVRAGDADVMYNPPPALVPALEKDPKLNVITIPTVRVIYIGLNSLVPPLNDV
FT                   RVRQALNYAVDKEKLCSIIMRGMARPSDSPLSSITYGYTSTGGYPYNPQKARQLLKEAG
FT                   YENLKLELITPKGRYLNDYETAVAIQGMLSEVGIDLDVKPMEWGTYVAKILSNKPEDWD
FT                   YQMFLLGWAPGTAEGHWVLFPLFHSVNQMGNPEGTARYNNFFYRNPEVDDLIDKIGKEL
FT                   NEEKLMEYYAEAQKIILQDAPWLFLYEMKIATVSRKEIRGLKIYPTERFNMTYAWIEK"
FT   sig_peptide     complement(205302..205367)
FT                   /locus_tag="Tlet_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.393 at
FT                   residue 22"
FT   repeat_region   complement(205528..208416)
FT                   /rpt_unit_range=205528..205558
FT                   /note="CRISPRs"
FT   gene            complement(208843..211077)
FT                   /locus_tag="Tlet_0203"
FT   CDS_pept        complement(208843..211077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0203"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3;
FT                   CRISPR-associated HD domain protein; SMART: DEAD-like
FT                   helicases; KEGG: tma:TM1799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32773"
FT                   /db_xref="GOA:A8F3N9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3N9"
FT                   /protein_id="ABV32773.1"
FT                   /translation="MLDGLKSHPERLLLDHINGVKKRALEKANSIKWNNFGITEKDAIK
FT                   LIEICALCHDFAKASSGFQKYITSSKKGVHVSHAPLSSIITYHIAKNTGFEPKYASFAY
FT                   FVVRCHHESMKDFQAFGENLEALEKQMSSIPKEFIDWVESKLNTQVTPKISEIYGKLEK
FT                   DVAKLNFFRPFSLKDYLFVHTLLSILVSSDHEDAALHDTPLILKTRLTLENLRKYMHAI
FT                   PEDNPLYSLRKEFHIDLDNSLKYLDDSKIYSITAPTGLGKTLANLKVALSLSDESLIVY
FT                   ALPFINIIDQTVETFQKIMQDTEFDASTILPYHHLANPKYEEDIYGEKAIQKVLIESWH
FT                   SQIVVTTFVGLFESLLTSKRVPFFYKLLNATIILDEVQSIPHKYWNPLADILSCLSEFG
FT                   TKIIFSTATQPMIITKTRELINKNYNSKLNRTRIHYCGEIDYPSFMKQVEEEANKCLEK
FT                   NQRLLVVVNTIRQSKELFNHLRSTIDISKLVYLSSNVIPKQRLERVSGLKKLKNQGIIC
FT                   ISTQVIEAGVDLSFNKIIRDEGPIDSVIQVAGRCNRNFETPISSAHIYRVIDKERNRSF
FT                   SSYVYDHFLLDMTRELLSSKKEFEEKEFPEIVSRYFNMVKERGNTDRENLTEQLRLLKF
FT                   EEISSKFKLIEKRYDTVPVFIEYDEYAQFLRKKLNETLNSKMEKFEKLAQISELIRQMS
FT                   LYTIDVPLKSEDLRGALLIENGFLVVTKDNLNYWYDEYTGFQRSQELMIF"
FT   gene            complement(211062..211754)
FT                   /locus_tag="Tlet_0204"
FT   CDS_pept        complement(211062..211754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0204"
FT                   /product="CRISPR-associated protein Cas5, Hmari subtype"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5, Hmari
FT                   subtype; CRISPR-associated protein Cas5; KEGG: tma:TM1800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32774"
FT                   /db_xref="GOA:A8F3P0"
FT                   /db_xref="InterPro:IPR013421"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P0"
FT                   /protein_id="ABV32774.1"
FT                   /translation="MKVIVFDVKGKYALFRRNYTTSSSTSYNFPPRTSICGLLGAIMGI
FT                   QNEATQFSKHLRIFDNAHIALRVLVPIRKTTMGVNYAETKSGKNQRTQIILELIKEPVY
FT                   RIYVSEFSQFDQLRNHLENNTCVFTPYLGQAQFIAKISHVGVFEAKSVFPPVVVHSVLK
FT                   ITDGIRIQPQENSILLREQMVLNMDDERHPVAFASYWVEKNARPLEVIKHPNIFRIEEL
FT                   DENICWMD"
FT   gene            complement(211751..212635)
FT                   /locus_tag="Tlet_0205"
FT   CDS_pept        complement(211751..212635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0205"
FT                   /product="CRISPR-associated protein, Csh2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, CT1132 family;
FT                   CRISPR-associated protein, Csh2 family; PFAM:
FT                   CRISPR-associated protein TM1801; KEGG: tma:TM1801
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32775"
FT                   /db_xref="GOA:A8F3P1"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013419"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P1"
FT                   /protein_id="ABV32775.1"
FT                   /translation="MNSRSEILFLYDVKWANPNGDPLDENKPRIDEETEKCIVSDVRLK
FT                   RTIRDELQENGEIIWVSGESVNPDKRRGELGIKDKTDALKCIDVRLFGAVIPISKQADT
FT                   SFTGPVQFRPGTSLHAVKVVFQQGTAAFTSGEQAQQRSFREEYLIPYALICFYGIANEN
FT                   AAKITKLTEEDIKKLLNAMWNGTKNLITRSKMEHNPRLLLRVVYKEGINYHIGELDSYI
FT                   KLLSDIEEKSIRDTAQIKLDISELLTKLSQNKEKIDHIEYKEDGRLKLVKNGEDIILKN
FT                   ELDNLGLRAVALQ"
FT   gene            complement(212619..214346)
FT                   /locus_tag="Tlet_0206"
FT   CDS_pept        complement(212619..214346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0206"
FT                   /product="CRISPR-associated protein, TM1802 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1802 family;
FT                   CRISPR-associated protein, Csh1 family; KEGG: tma:TM1802
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32776"
FT                   /db_xref="InterPro:IPR013389"
FT                   /db_xref="InterPro:IPR013420"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P2"
FT                   /protein_id="ABV32776.1"
FT                   /translation="MLTKIIKIGKLYQQEELFENFAKTFKSNLLVALYFDLGPPVQYIS
FT                   SHIIEPPENLQKLLYYDQKGNVSGKSPTVSITFKNEDGSEKIRKGVEKAILKLKSFFKH
FT                   PMLKDFENCINDEFESIVLDVEKLLTDQKNLKGVYLTVKLLRHDSELFPSEHGEFVKAF
FT                   IDNILKKSVEGGEEGICTFCGRKKIVSATVNEVFKFATFDKPGFCPSLKKDDSIKVLPI
FT                   CDECKSQLQNGANKVIQELSFNFLKNQNPLWVIPSIIEENSEEILKNVIQRIADTSKKL
FT                   KDFANSEREIELVLSEEKSTVHYDFLFMELNQNQQRIELHLTEISPTRLKKIVQSIDDS
FT                   KRRIKIDDLPEPSLGMLWKLYEKPSGSDKSRKDYLALVKSIFQEEPYSYSRLLWYFMRK
FT                   IRKSAITEGAWWRKLTYVSFAAILHLNQINVLNLRRGEYIVSSSEIDQFFNSYPEFFNL
FT                   PWKKAVFLTGVLAGKVLSVQYAKRQATPFFKKFKGLKMNMQDVMGLLADIRNKLQQYDA
FT                   YGKKSDELLKTAAEYYLQSSKSNTTIDELNFIFTLGLAYAGKEPFKKYEEVEEYEQQI"
FT   gene            complement(214358..214621)
FT                   /locus_tag="Tlet_0207"
FT   CDS_pept        complement(214358..214621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0207"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196; KEGG: tma:TM1796
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32777"
FT                   /db_xref="GOA:A8F3P3"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P3"
FT                   /protein_id="ABV32777.1"
FT                   /translation="MYLIVTYDVGEKRVARVLKVCRKYLNWVQNSVLEGEITIAKFEKL
FT                   KLELERSIDKSEDSVRIYILKNKSFFDLKTLGNEKGTVDIIY"
FT   gene            complement(214628..215611)
FT                   /locus_tag="Tlet_0208"
FT   CDS_pept        complement(214628..215611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0208"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1; PFAM:
FT                   protein of unknown function DUF48; KEGG: pth:PTH_1914
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32778"
FT                   /db_xref="GOA:A8F3P4"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P4"
FT                   /protein_id="ABV32778.1"
FT                   /translation="MAEPVYIFSDGTLKRKENTIMLETQSGKKHIPVENVSEIKIFGEV
FT                   DINKRLLEFLTQKNIIVHFFNRYGYYVGSYYPREFLNSGMIILRQAEFYLNSVKRLELA
FT                   RLFVEGSLKNIINTIKKYNENGRFSNTINAIESHIKNLKQCISVEQLMALEGNAREIYY
FT                   HCFDNFVKSGDFHFEDRSKRPPQNELNALVSFGNSLLYTTTLSEIYKTHLDPRIGFLHT
FT                   TNDRRFTLNLDISEIFKPIIVDRLIFTLINRKQIKKSDFHEITGGISLKENARRTFVQS
FT                   FEEKLKDTIYHSGLKRKVSFRTLIRTEAYKIEKHILEDEPYSPYLG"
FT   gene            complement(215622..216113)
FT                   /locus_tag="Tlet_0209"
FT   CDS_pept        complement(215622..216113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0209"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4; PFAM:
FT                   protein of unknown function DUF83; KEGG: tma:TM1798
FT                   putative RecB family exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32779"
FT                   /db_xref="GOA:A8F3P5"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P5"
FT                   /protein_id="ABV32779.1"
FT                   /translation="MITGTVLLSFTVCEREAWLIAHQIEPEQSNPFIEIGRLIHTESYR
FT                   KNQIREIALPGIKIDMIYSQGQVTVVGEIKKSSKFLKGARLQLLYYLSELKKRGVHAAG
FT                   KIMIPKEKKQIDINLDDQGIKDLNQAIENVEKLISLPKIPQKIRNAFCTKCGYEQFCWS
FT                   "
FT   gene            complement(216130..216891)
FT                   /locus_tag="Tlet_0210"
FT   CDS_pept        complement(216130..216891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0210"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   protein of unknown function DUF57; KEGG: tma:TM1814
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32780"
FT                   /db_xref="GOA:A8F3P6"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P6"
FT                   /protein_id="ABV32780.1"
FT                   /translation="MRLEIVFKTANSFIPINYQYMLCSFVYKRLKYTDENFASFLHEEG
FT                   FNGFRMFTFSQLFFENSHVKNGSIIISEGKGKWYISSLSEDFIRNFFSSIIENPFIELE
FT                   GVLFNILQVRVLDEPKITDQMKFILISPLVVSIPVENQGKLSHKYLTPEDDFFQNAINA
FT                   NLIKKYSAFFGKEISSKVYIQPDWNYIQRKGRITKLIQIKNTFVRGTVFPFLITGDPGL
FT                   IKVGYEAGFGEKNSLGFGMVKVCRNDNNLNF"
FT   gene            complement(217129..218934)
FT                   /locus_tag="Tlet_0211"
FT   CDS_pept        complement(217129..218934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0211"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: tma:TM0288
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32781"
FT                   /db_xref="GOA:A8F3P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P7"
FT                   /protein_id="ABV32781.1"
FT                   /translation="MPEIVRRPPHEIPVNKPDLKNPRGTLKRFLNYLKPHTILLIVVFL
FT                   FVVLSSLMNVVTPYLIGKIIDEVFIPMAFEKLFRYLLILGSFYAIISLSFWIQGKIMLK
FT                   LSQEIVFDLRKELFEKLQRIPIGFFDKTSHGDVISRIVNDTDNINNVLANSITQTFSGI
FT                   ITLAGAAFMMLKVNILLSLVTFSVIPLTLLATRIISQRTRRYFYENQRVLGELNGIIEE
FT                   DISGLSVIKIFTREEKELEKFNKSNENLREIGVKAQIFSGILGPIMNMINNLGFAMVSG
FT                   FGGWFALKGIVTVGTIATFIGYSRQFTRPLNELSNQFNMIQMALASAERIFEIMDVEEE
FT                   NDDEKSVIISEAKGEIEFRNVWFSYDKEVPILKNVSFHIKPGQKVALVGPTGSGKTTIV
FT                   NLLMRFYDVDAGQILIDGVDIRKIKRVSLRSIIGIVLQDTILFSKTVKENIGYGNPDST
FT                   DNEIEKAAKLTHADHFIKHLPHGYNTILTDNGEDLSQGQRQLLSITRVFLANPKILILD
FT                   EATSNIDTKTEKSIQTAMWKLMEGRTSIIIAHRLNTVKNADLIIVMKGGEIVEIGKHEE
FT                   LLQSKGFYHELFTNQYGILLEENES"
FT   gene            complement(218927..220660)
FT                   /locus_tag="Tlet_0212"
FT   CDS_pept        complement(218927..220660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0212"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: tma:TM0287
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32782"
FT                   /db_xref="GOA:A8F3P8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P8"
FT                   /protein_id="ABV32782.1"
FT                   /translation="MKVFLRYLKPYWLSTVLAPLFMVIEVICDLAQPTLLARIVDEGIA
FT                   RGNLQLVWKTGIFMLLVALIGAVGGIGCTIFASHASQNFGADLRRNLFKKVLSFSITNV
FT                   NKFHTSSLITRLTNDVTQLQNLVMMLLRIVVRGPLLFIGGILMAISINAHLSSIFIFLI
FT                   PPIIFLFLWLTKKGDLLFRKIQDSVDRVNAVVRENLLGVRVVRAFRREEYEKENFHKNN
FT                   ELLKNSMIKAFSLIVFALPVFIFIVNAGTIGVLWFGGVLVKKNQMEVGNIIAYTNYLMQ
FT                   IMFSLMMIGNILNFVVRAGASAKRVLGVLDEQPAIHELQNALYVPEIKGRVDFEDVEFR
FT                   YSGDTSPVLKNVNFSVKSGEVIAILGETGSGKTTLMNLIPRLIDVTSGDVKIDDSDVRV
FT                   LKLQNLRKYIAAVPQETNLFSGTVKENLKWGKEDATDEEVIKAAKIAQIHDFIINLPQG
FT                   YDSYVERGGRNFSGGQKQRLSIARALVRKPKILILDDCTSSVDPITERKILEGLREYTK
FT                   GCTTFIITQKISTALLADRILTLQEGKMVGFGTHEDLLRNCRAYREIYESQLGNGMIND
FT                   A"
FT   gene            221025..222176
FT                   /locus_tag="Tlet_0213"
FT   CDS_pept        221025..222176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0213"
FT                   /product="isoaspartyl dipeptidase"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: isoaspartyl dipeptidase; PFAM:
FT                   amidohydrolase; KEGG: cpf:CPF_2665 isoaspartyl dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32783"
FT                   /db_xref="GOA:A8F3P9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3P9"
FT                   /protein_id="ABV32783.1"
FT                   /translation="MIKLVKNVEVFSPNFLGKKDILIAGSKIVVIEDFINVDSLPVEKI
FT                   DGSGLIAVPGFIDSHVHIAGGGGEGGFKTRTPGIVFSDLVKAGITTVVGCLGTDGVTRN
FT                   LKDLYAKAKSLEEEGINTYIYSGSYRVPLITFTGNLIEDFILIDKVIGAGEIAVSDHRS
FT                   SQPSVDELKRIVADARVGGILSNKAGIVNIHVGDGKSMLDILYEVVETTEIPVTQFLPT
FT                   HINRNKKLFEEGLNYAKIGGFVDFTTSVGDLLEEDLQAWKAVKIYIENGFENQVTMSSD
FT                   GQGSLPKFNEKGQFIGLGIGKVSSVMEQFKSAVKNGVPFEKILKAITQNPAKILKLSSK
FT                   GVIAPGKDADILLFNSDLNLDSVLCMGKLLMSKEQILVKGTFE"
FT   gene            complement(222452..223567)
FT                   /locus_tag="Tlet_0214"
FT   CDS_pept        complement(222452..223567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0214"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: bha:BH0491 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32784"
FT                   /db_xref="GOA:A8F3Q0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q0"
FT                   /protein_id="ABV32784.1"
FT                   /translation="MKLKELFRQRVELLRNFIKENDFDGLILSRCDNFSWFTFGARNHI
FT                   TLNSETGDAHVLLTEENIYILTNNIEKERLRKEEFHDDLLPEVEFAEYIWSKDMTDVLK
FT                   PFVSGKKFASDTGRFETICVKDMLDQYRYVLTEFELNTYRTLGKLCDESVNHVMAKINP
FT                   EMREIEVQGMVASALIEKGIEPIFVMVSGEESAKLYRHNLSRNVKLGDKVFVSICARKR
FT                   GLVISLTRSVLFKKDTNVIEQHKQNCYVDAVAITNSKPGVKLNQVLDKIRKAYAEIGRP
FT                   YEWMLHHQGGITGYNAREIIAKEWTDYTLCFGNAVAWNPTITGTKSEDTVLITEKGLEI
FT                   ISYPQTSNWPFIEFEIDGQIIRRPDILLANV"
FT   gene            complement(223608..224459)
FT                   /locus_tag="Tlet_0215"
FT   CDS_pept        complement(223608..224459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0215"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lin:lin0219 similar to
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32785"
FT                   /db_xref="GOA:A8F3Q1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q1"
FT                   /protein_id="ABV32785.1"
FT                   /translation="MSKKKKITCILLEIVRYAIIIFGAFWMILPFFWMFSASLMTPQEL
FT                   LSDVPKWLPEKPQWGNYVEVLRRIPLFNYYKNSFLVSGSVTLITIITSSLSGYAFSKLK
FT                   FAGRKILFGFVLSTMMFPVFIFLIPVYYLMRLFGWLDNYLSLIIPFAVSGYGIFLMRQF
FT                   IMTIPDELLDSSRLDGASEFRIYISIILPLLKPAIATLAILTFIGQWNSFLWPLIVTST
FT                   AQKLMTLPVGISRLSLAFSTTETQHLILTALVYQVVPMVIIFLYLQRYYVRGFVLSGFA
FT                   NV"
FT   sig_peptide     complement(224340..224459)
FT                   /locus_tag="Tlet_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.678 at
FT                   residue 40"
FT   gene            complement(224452..225348)
FT                   /locus_tag="Tlet_0216"
FT   CDS_pept        complement(224452..225348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0216"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sma:SAV2362 putative sugar
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32786"
FT                   /db_xref="GOA:A8F3Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q2"
FT                   /protein_id="ABV32786.1"
FT                   /translation="MKGRKIAKQHSGVGYFFLAPIMIFYSMFFVYPVLFSLLASTRRWN
FT                   MLVPLSNARKIGFSHYSYLLNDEMFVSVFRNTLIYALLTVSATIIIALILAVLINGARF
FT                   SVLWRFIYFTPVVTPQVAIGTIWGYLYRPNNGLLNSILGLFGMKPVYWLTDPDIALFSI
FT                   IIAAIWSGIGGSMLIITAGLRNIPKDYYDAAKIDGAGPFKQFFHITVPLLSPTLLFLTA
FT                   TGFIGAWQVFDLPFTMGRNAPAKSVMTVSWYVYETAFQSLRMGRASAGAFLLFCVIFSF
FT                   TLVILWIFKRGGIKGYE"
FT   gene            complement(225367..226653)
FT                   /locus_tag="Tlet_0217"
FT   CDS_pept        complement(225367..226653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0217"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sma:SAV2361 ABC transporter sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32787"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q3"
FT                   /protein_id="ABV32787.1"
FT                   /translation="MKKSLLIVLISIFVIITSGFAKTKIILAVHWSDYQVEGIKDENGN
FT                   IMVKGLRQYVEEYQKLNPDTEIEIQSVPFDEYLKRILISHTSGVISDVYILYSLWGVQL
FT                   SDSMILDQVPKDIVEKVKSDFVRPAIDGATIDGKIWGVPIEVDNYALVFNKKLLKEAGF
FT                   TNPPETWDELVEMAPKLTKRNPDGTISQYGFAFLSGWDSAVVHPYLALLYSNNGKLFED
FT                   DFSRCLLDSKEAIETLEAELKLFKNGGTDPAASVWNFPAGKVAMMIMATWYETSLKLGF
FT                   KDQYEEIVGVAPIPYLKKPATAGYTWFIAVDNASKNKKQAWDFVRWLTLDKSGGYTRMG
FT                   ELMAKNIGSIPPNKADINFFQSELNDLYTSIFVKELEHTHQEPNVAQGQEIKTILMREI
FT                   IEAWNGRKTAEKALKDAKLEIDKILSEFY"
FT   sig_peptide     complement(226588..226653)
FT                   /locus_tag="Tlet_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.953 at
FT                   residue 22"
FT   gene            complement(226680..228835)
FT                   /locus_tag="Tlet_0218"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(226680..228095,228095..228835))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Tlet_0218"
FT                   /product="Glycoside hydrolase family 42 domain protein"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   KEGG: sus:Acid_7597 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32788"
FT                   /db_xref="GOA:A8F3Q4"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q4"
FT                   /protein_id="ABV32788.1"
FT                   /translation="MKDFFPVSVWYGPNKSRAPMTAKVKGLSEIKSEISRIKKIGFNTI
FT                   RFWYDWATAEPEPDVWDFSSIEELLNITDELKIKAILQIYTDSAPNWVERDYPDSLFID
FT                   RSGLTIHSQSAPGYCSDHPQVRKHITSFLQNLAKVVSRHDSFLAWDIWSEPHIVQWSWI
FT                   DYIKDPWFCYCEYSKNRFIEWLKTKYETVQKLNEIWYRKHGSWEEITIPRYVSLSSFRD
FT                   LLDWIQFNIEKISEDLFWKTSAIKKIDPSHPVSSHAAISSVYGIPGIGYGSSDDWKLSE
FT                   KVDIWGTSFYPKHTGAWMPLKPHHMGVALDASRSSCESKNKPFWIGELQSGHGVTGLRF
FT                   SVPVDEFDVERWSWLAISHDAKGLNYYAWLPMSCGYEVSGFGLANYDGSINNKVIRAGK
FT                   VSEIISKNMNLFLKAKALQAKVGILYNIETHKTLACLRAESAEIIREDIFGMYKAMMQM
FT                   GVNVDFLHISDLLREDLKQYHLIMIPFSIVIDQKSADAIEKYVRSGGVVLADGRLGWMK
FT                   EDGTLQEKIPGSGLEKVFGCEELYTREIQEQAIDYEDCKLSAYRYLTVYRKTTGIPKAF
FT                   FNGQPVIVENKYHSGLAIMVGMLIGLAYEKTENRNNLEFLKQIAQRAGINPDYSTSITS
FT                   GQEDYLEVRISRSEEKTIVFLFNHGDEAIEFDLLIPSNNLPALVNNVKCINADQKFEYQ
FT                   ACSKALSIKNIFIQGNHTVVLLIE"
FT   gene            complement(228841..229620)
FT                   /locus_tag="Tlet_0219"
FT   CDS_pept        complement(228841..229620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0219"
FT                   /product="SIS (Sugar ISomerase) phosphosugar binding domain
FT                   containing protein-like protein"
FT                   /note="KEGG: ace:Acel_0562 uncharacterized protein
FT                   containing SIS (sugar isomerase) phosphosugar binding
FT                   domain-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32789"
FT                   /db_xref="GOA:A8F3Q5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q5"
FT                   /protein_id="ABV32789.1"
FT                   /translation="MSAFEAYIEKVTDILKRIKKEQNTNILKAANIMAECIEKNGMVHL
FT                   FGSGHSILPVLDAFPRYGSFIGFNPLIDPRLMWFSPTGPASAPGLLLVERKEGYVENGF
FT                   LRYQPIAKDDVLIIYSHGGINAAPVEAALYGKKVGAKVIAIVSVSNQVAAIASHSSGKK
FT                   LSDIADLIIDNCTPPEDALIELSGKKERIAASSTVAVVAITMSLIAETGAILHDHGKDL
FT                   KIFVSPNVEGFDVDYNVKIFDFHQKTINRHYWKIQER"
FT   gene            complement(229627..230502)
FT                   /locus_tag="Tlet_0220"
FT   CDS_pept        complement(229627..230502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0220"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: det:DET0049 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32790"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q6"
FT                   /protein_id="ABV32790.1"
FT                   /translation="MYSFACDIGGTNLRIAIVDSDGKIYLKRKFSTPKKQDKLFENISQ
FT                   EFEKMNEKFEISHCIFSIAGAVFEDGSVLIPNVFPQRIKLKETIRSFIPNVQIYIIDDR
FT                   TAGLIGEICSGCARGFKEVAYLIIGTGVGLGIFSQGQIIFGNQGIAGSAGWIHIKDPLT
FT                   EEYRDIESLISGPAIAKMFSRICGKEIESSESVLRLYLQKNTCATEVVKNVSFAMGYLL
FT                   STITNILNPEIIVLSGSVGLNWKVFEEEAVKTLKKFTSPFITPPIIKVSSLGEDAQLVG
FT                   CSKYTSLRKE"
FT   gene            complement(230508..231239)
FT                   /locus_tag="Tlet_0221"
FT   CDS_pept        complement(230508..231239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0221"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   gka:GK2275 transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32791"
FT                   /db_xref="GOA:A8F3Q7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q7"
FT                   /protein_id="ABV32791.1"
FT                   /translation="MIQKIDPYSTEPLYYQLKEILRKNILSETWKSGEKIPTEKQLSKM
FT                   FGVSTAVVRQAVSLLVEEGFLIKRQGKGTFVVDARIRQGPRKLTSFTEEMISMGFNPTS
FT                   VILEKGIREADEKISEALKLETGSKVIMVRRLRLANGDPFGIQTFYTPEYIAPDFLEND
FT                   LTQSLYKLLELKYGIKISSAQEKYYATILDKYECKLLKAKWPFAGFIVERVAYDTNNTP
FT                   IEYTESIIRSDRYSVQVQLRK"
FT   gene            complement(231345..232640)
FT                   /locus_tag="Tlet_0222"
FT   CDS_pept        complement(231345..232640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0222"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: tma:TM1172 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32792"
FT                   /db_xref="GOA:A8F3Q8"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q8"
FT                   /protein_id="ABV32792.1"
FT                   /translation="MDMFCYMCSQALNNEGCVRAGVCGKSPLVTRLQDNLVYILDGISA
FT                   YYYHARELGYKDEEIASFLSKGLYSTLTNVNFDPESYVQLALEAGMMNLRVMKLLKKAH
FT                   IETYGEPVPAEVETGTKKGHAIIVTGHNLKALEELLKQVEGTNVYVYTHSEMLPAHGYP
FT                   VLRKYRNLAGNLGAAWYDQKMLFDEIPAAILGTSNCVLLPKESYRNRMFTTSIARLPGV
FT                   THIDGYDYSPVIEKALSLPELEEKPSTYKLTTGYSTGVVASIADKIKALVESGKIRHFF
FT                   VIGGCDTPTQKGNYYREFAKKLPEDTVIITLACGKYRINDINFGTIDGVPRLLDVGQCN
FT                   DTIVAIEIAEALSKLFDKPINDLPLTLVLTWMEQKAVAILWTLLALGIKGIYIGPVLPA
FT                   WVNQDILNVLQSNYDLRLISDPENDIKAILKA"
FT   gene            complement(232724..234373)
FT                   /locus_tag="Tlet_0223"
FT   CDS_pept        complement(232724..234373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0223"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   csc:Csac_1286 protein of unknown function DUF342"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32793"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Q9"
FT                   /protein_id="ABV32793.1"
FT                   /translation="MDRKPQKRIVQIENVEELLSLLEKDYGQNWHEKVSFRISKADPAN
FT                   MEVIIEPVHESHRESILKELSNVVEIIEPALSDLSDLEEKYPDPHIQVEISEDKMIASI
FT                   FIVPGLKRVLPTFDELKEALKKSGVIYGINEDALRKIIDESKVFAHIPVASGKKPIYGS
FT                   DASIEFLFPESGMIFEKIGEKDSVDMAALYKIFTCHEGDVLAVKVPLRESYDGIAVTGE
FT                   IIKVEKAKDLNLQNFVGENTKLSEDGTKIIATCDGQPYVQNSKVCVRNVLLIDKDLGYD
FT                   TGNIDFNATVIIRGNAEGPFKIKADGDISIMGVLGEIQVTCGGSLKVQGGIFGRGKGII
FT                   KVSKDLTAKFINESQIFCEGNIFVEYYIMNSVIICRGDITVKGRGVIAGGAVKTSGNVE
FT                   AAELGSESGVRTEIAAGIDYENEKEIAQLERNLLEAMRSIMLLSEIESSARAKTTETKE
FT                   IPKKEELMKILQKTAEKKKRIELEVRKIHETLKILKHNLQVKYSDTSRIRVRKICYPNV
FT                   RIAIAGRKKLISDKIGPCDFFLNKNTGEISFL"
FT   gene            234489..235361
FT                   /locus_tag="Tlet_0224"
FT   CDS_pept        234489..235361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0224"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: tma:TM0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32794"
FT                   /db_xref="GOA:A8F3R0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R0"
FT                   /protein_id="ABV32794.1"
FT                   /translation="MYKIFIWLVVFFWGMSFVATKVVVSYIPPATAALIRFLIALVFLI
FT                   FVNRKFPKILNLHGFFAGFWGITMYFYFENAGLVHTFPTNASLIVSSAPILHILFSHII
FT                   QKKKATMMEYIASFIAFSGVAVVILNGKFALKINPVGDIMLFGAASVWVLYTYHVEKMP
FT                   NSDSLEGVAAITFWGVVTLIPFSLVEKNSWVSFNPASFVSLMYLGVVCSGIAYVLWNKG
FT                   IKKVGSRYTTNTIYFIPVLTSIAESIFLKRLPNLYTIFGGAMVLVGLWLFNFSRRRLVY
FT                   ENISEGEDE"
FT   gene            235330..235728
FT                   /locus_tag="Tlet_0225"
FT   CDS_pept        235330..235728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0225"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   tte:TTE0718 acyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32795"
FT                   /db_xref="GOA:A8F3R1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R1"
FT                   /protein_id="ABV32795.1"
FT                   /translation="MKTFLKVRMSEHDAHYAGGLVDGARILQLIGDVATELLIRFDGDE
FT                   GLFRAYDSVEFLNPVYAGDFLEVHGEIVSAGNTSRKMRFEVYKIITNSRIPGHESACDV
FT                   LNPPILVAKASGTCVVPKERQRVVKKDG"
FT   gene            235721..236548
FT                   /locus_tag="Tlet_0226"
FT   CDS_pept        235721..236548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0226"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   fnu:FN1868 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32796"
FT                   /db_xref="GOA:A8F3R2"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R2"
FT                   /protein_id="ABV32796.1"
FT                   /translation="MDKLIITVAVCGAEVTKQHTPYIPVTPEEIVQQSYEAFLEGASIV
FT                   HLHVRDENGNPTQNAEIFKKVVTMIREKCRGMIVQVSTGGAVWMTAEERLQSLESDPDM
FT                   ATLTTGTVNFGNDVFMNSIPMIERFAEEMKKRNIMPEFECFDMGHITNALNLVKKGLVH
FT                   GHLHFDFVMGVPGGIAANGRNLIAMVDNLPAGATWSVAGIGRHEFPMAAMAIAMGGHVR
FT                   VGLEDNIYVKKGELAKSNAELVKKVVKIAREIGRDIASCQEARQILNLKEVRK"
FT   gene            236545..238059
FT                   /locus_tag="Tlet_0227"
FT   CDS_pept        236545..238059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0227"
FT                   /product="GMP synthase, large subunit"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; KEGG: tma:TM1820 GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32797"
FT                   /db_xref="GOA:A8F3R3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R3"
FT                   /protein_id="ABV32797.1"
FT                   /translation="MKVVIVDYGSQYTQLIARVIRELGYYSQVVQYDEPLDTDEVGAVI
FT                   FSGGPESVYEENSPGLPEWFERYNGKVLGICYGMQLVVHALGGAVEQGKTAEYGRTELE
FT                   IIKDDDIFSGIEKHLTVWMSHGDHVKKLPKTFKTIAKSKDGIIAAATDEKKFWLLQFHP
FT                   EVRHTSYGREIIENFLSRVCKLVPNWSLEDFIKQKINELREHLSGKKVVAALSGGVDSS
FT                   VACVLVHRAIGENLLNVFVDHGLLRKNEEEEVPRIFRQVLGLNLLKIDARKVFLEKLRG
FT                   IVDPEKKRKIIGEQFIRVFEKEAKRYGATHLIQGTIYSDVIESAKSGKKTAAIKSHHNV
FT                   GGLPQRMDLEIVEPLKNLFKDEVRIVGEMLGIPRSIIHRQPFPGPGLGVRIVGEITEEK
FT                   LEILKEADDVFIQVLKETGWYEKTWQAFSVLLPVRSVGVRGDKRAYDYVLALRSVDSVE
FT                   GMTADWSRLPHEILDLASRRILNRVKGIGRVVYDISSKPPATIEWE"
FT   gene            complement(238090..238476)
FT                   /locus_tag="Tlet_0228"
FT   CDS_pept        complement(238090..238476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32798"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R4"
FT                   /protein_id="ABV32798.1"
FT                   /translation="MKKGEKFLSFVKFEKEIESAYREKLSATKRPEETADVFIEFAINF
FT                   LSKIKPEITRNHIDQIYFDPDSENGYKLSPNLEKILGNEILNNSDLPAILKRLALSAVH
FT                   RRKALVSNNERTNMFRMQEKPDQH"
FT   gene            complement(238494..239174)
FT                   /locus_tag="Tlet_0229"
FT   CDS_pept        complement(238494..239174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0229"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   tma:TM1380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32799"
FT                   /db_xref="GOA:A8F3R5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R5"
FT                   /protein_id="ABV32799.1"
FT                   /translation="MPHIFYGKQTGDFVILDEHESRHLRVIRVSVGQKLFVTDGKGNLY
FT                   NCELIELGKLESKAVVRNVEQTEINKLSKITLCIASQNWERLRFLLEKAVELGVDELII
FT                   YKTKRSKLYIDKEEKIRLIIRDAAKQSVRYLFPELRIFRDMSFLQNESMKTVVLHQSGR
FT                   AAKIDDFKGSLRIVVGPEGDFESEEINQLSQVGTFLNLGKKILRFETAAILAAGLSSFL
FT                   NGKI"
FT   gene            complement(239175..240449)
FT                   /locus_tag="Tlet_0230"
FT   CDS_pept        complement(239175..240449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0230"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); seryl-tRNA synthetase
FT                   class IIa; KEGG: tma:TM1379 seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32800"
FT                   /db_xref="GOA:A8F3R6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3R6"
FT                   /protein_id="ABV32800.1"
FT                   /translation="MIDIRLIREKPDFVKKALEKRNYEKKMVDDLLSLDAQFRELTNQI
FT                   NQLRAQRNSISKMVAQAKSSGKTEEIENLTEEGKKIGRQIDSIEDQLKEIKVQMEKLML
FT                   LVPNIPDDSVPEGKDETSNREIRKWGDPKKFDYNPQAHWDLGPSLGLMDFDRAAKLSGS
FT                   RFTVMYGMFAKLERALTNFMLDMHTKEHGYTEVWLPHIVKRETMTITGQLPKFEEEAYR
FT                   IEADDLFLIPTAEVPLVALRSNEILEEKDLPLLYTAYTPCYRREAGSYGKDVRGMIRQH
FT                   QFDKVELVWITTPERSFEDLETLVSHAEEVLRRLELPYRVIQLCSGDLGFGAAKTYDLE
FT                   VWLPSYNSYKEISSCSNDTDFQARRGNIRYRRKDGKISFVHTLNGSGVAVGRTLVAIIE
FT                   NYQRADGRIDVPKALQPYLGCEVLG"
FT   gene            complement(240456..241091)
FT                   /locus_tag="Tlet_0231"
FT   CDS_pept        complement(240456..241091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0231"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   tma:TM0714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32801"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R7"
FT                   /protein_id="ABV32801.1"
FT                   /translation="MTSLRKLLTLAICVSFWGLSFAKTVHIFSEFVKPEKEQAYYEGNV
FT                   KVEIEEDNLNLYCDSMKVSKYQNEWRIVEANNAEVFFDDGTATSTRLRYDIKLKTGTMS
FT                   GDVEAEIFDKESTDTILINCDSMEIDLENDIFQGNSTNQVQIYKGKIEASAKSFFYDRK
FT                   SGKIKLEGDVTLIDHDKNMKMWATSVEITTIDDKMTATNARVELIVEE"
FT   sig_peptide     complement(241023..241091)
FT                   /locus_tag="Tlet_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(241093..242247)
FT                   /locus_tag="Tlet_0232"
FT   CDS_pept        complement(241093..242247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32802"
FT                   /db_xref="GOA:A8F3R8"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R8"
FT                   /protein_id="ABV32802.1"
FT                   /translation="MRKLLFFAPLIVAIAIFGAEVKIKDVSPVLDIYEPVSFMIENKIM
FT                   DLDENGNFRGGLLVTRFDIAQYLYNILSKFQLRDISDKLGNLEKNQQNLSTKIMGIEAA
FT                   YKTYEQRLKDFEMSVASLQSQTDKLSQQIYAQLHKEIEEILNQHQNQISRLEPVLSRVE
FT                   ALEKLASSLQKSIESTDSNLNLLSSKIAELQANQTELSRSFSSSENLLNSLLKNVNENS
FT                   QSIQKLSEQFNVQMNAQGKLYDQKITELAARLDALSKGLQNDLSIQKKQLTDFQQNLEL
FT                   YNSRVTQLQQDMKIIESLASKDELSHVQDSITSLNQKIEEIDVNLTQLEQKMEDTQVGM
FT                   LQKKIGELETKQKNLESSVLTAYLIGAAGVAIGLIAVLFQWSGQ"
FT   sig_peptide     complement(242191..242247)
FT                   /locus_tag="Tlet_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.660 at
FT                   residue 19"
FT   gene            complement(242263..243669)
FT                   /locus_tag="Tlet_0233"
FT   CDS_pept        complement(242263..243669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0233"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: mma:MM2742
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32803"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3R9"
FT                   /protein_id="ABV32803.1"
FT                   /translation="MQKFIAICYLLLAVLSCAFTVNVVTNPGNVEIRQGNIIIAETDRS
FT                   GMASFEISLPATITFSKPGYLSKQIFISDQPGTYHIILTPVTVLKIDSKPIGADIFLNG
FT                   KFIGTTPKETEIIPGRYILQIEKDGFCRLTEKIEIDSLEKKELFYELKKIPDVKILSKP
FT                   PSHVWIDGKFAGKTPVELNIEKGKHLLVLKAENFFDLQAEIFVENEQEQTFNFSLTPSA
FT                   RLRITAVPQHALVKINEDQKNQPAEFYTDLSQKLITVSADGYKTQQIVFQPDQGENNLH
FT                   VILEPDIKELTIDAPADAVIFVDGKSVSRGSVKLKLSGDIHWVEAQLGEKKWAGIVDLT
FT                   KNQSLKINFDYATLILLGKYSIAVEGVTYIPPAITYLPAGFHTIEINSDPPKQQTKEFK
FT                   SGSLDIISLDSRAYLNIFSELVVPCYIDSKFIGLSPVLFYPLEPGVYSIKTGEKEEKIE
FT                   VPAGQLLGFR"
FT   sig_peptide     complement(243598..243669)
FT                   /locus_tag="Tlet_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.758 at
FT                   residue 24"
FT   gene            complement(243654..244037)
FT                   /locus_tag="Tlet_0234"
FT   CDS_pept        complement(243654..244037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0234"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: regulatory protein MarR; transcriptional
FT                   regulator TrmB; KEGG: tma:TM0710 transcriptional regulator,
FT                   MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32804"
FT                   /db_xref="GOA:A8F3S0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S0"
FT                   /protein_id="ABV32804.1"
FT                   /translation="MVKVEGRLVLKNYPITAAQFDLLQRLYFRGPMKMTELSTMLGIAK
FT                   STLSGIVRRLENVGYLSRTRGKDKRVFMISATAEGKKVVESVIEKRVEFVGKVLQELGK
FT                   EDSNQLLQLLQKFKEAIEKCRSS"
FT   gene            complement(244076..244756)
FT                   /locus_tag="Tlet_0235"
FT   CDS_pept        complement(244076..244756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0235"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: tma:TM0709
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32805"
FT                   /db_xref="GOA:A8F3S1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S1"
FT                   /protein_id="ABV32805.1"
FT                   /translation="MEGKLTIVGTPIGNMMDITIRALRALRECDVVIAEDTRRTKKLLK
FT                   FFNIDGKQLISYGLHNQLKSVPFILNLLKEGKKLCLVTDSGMPCVADPGGFLVDACWRS
FT                   GIELDVTPGPSALTSALALCGFDSSRVFFTGFLPRGKKRRKLFRDIKGKKMLFVFFESA
FT                   TRISETLSDAMDIFGNCDIFIGREMTKVFQQLFRGKISDAVESFKQTKGELTVVLYLKK
FT                   GGEN"
FT   gene            complement(244741..245478)
FT                   /locus_tag="Tlet_0236"
FT   CDS_pept        complement(244741..245478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0236"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   tma:TM0708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32806"
FT                   /db_xref="GOA:A8F3S2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S2"
FT                   /protein_id="ABV32806.1"
FT                   /translation="MLVLKTWNLSGELNMALDAILAEIPEEPILRIYTWSEPTLSLGRH
FT                   QKRINLNIDYMKKNQINCVLRPTGGRAVLHWDELTYAVILPANHIYAKSGVLETYLKIS
FT                   QCISKALKSIGYNAEIQPARKIKNNSQACFDAPSSYELCINGKKVVGSAQMRTNKSILQ
FT                   HGSIVLKKHVVEYARCLNLDEEQLEGKMAGLFDFHGISIFELSEALQIEFEKIFGYCRP
FT                   FPLNSELFEKAFERKGDYVWKVS"
FT   gene            complement(245488..246165)
FT                   /locus_tag="Tlet_0237"
FT   CDS_pept        complement(245488..246165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0237"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: tma:TM0707
FT                   glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32807"
FT                   /db_xref="GOA:A8F3S3"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3S3"
FT                   /protein_id="ABV32807.1"
FT                   /translation="MNKVAEIFREYGIKIDDSKTEKLDSYIDLLISAPINLTSLRDKEY
FT                   AIHKHIVDIVFPVKMLTGKLLDVGTGGGIPGLILAILFPINATLVESVRKKVMWLEKIL
FT                   NMLNIGNVNLLCSRAEKLPADKKESFDIVTARAVSELRILLELCAPFCKVGGRLFFYKG
FT                   PNWKQEYDAAHNAMKTLNVETIEIVSYTLKTGEKRVLLQFQKVGRTPDNYPRETKKILK
FT                   NPL"
FT   gene            complement(246162..246923)
FT                   /locus_tag="Tlet_0238"
FT   CDS_pept        complement(246162..246923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0238"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: tma:TM1876 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32808"
FT                   /db_xref="GOA:A8F3S4"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S4"
FT                   /protein_id="ABV32808.1"
FT                   /translation="MILAFISDVHANLEAFDSVMRDIESRDVDQIYCLGDIVGYGPDPE
FT                   EVTRRIMKIPSIAGNYDDAVGYSKSSCGCSYKPGRETEVGDISLNWTIENTSQEIKNYL
FT                   KSLKHRMELEFDGVKFLLVHGSPLDELLEYVTPDTEPERLRKIIENVEADVIISGHTHL
FT                   PMAKFFKGKLILNAGSVGRPKDGNPKACYLLIYIHEGVLSYEFIRVSYDVKKTCEKIAM
FT                   KKLPAELSVVLTLGKSYDMGKPLSETSFILP"
FT   gene            complement(246961..251100)
FT                   /locus_tag="Tlet_0239"
FT   CDS_pept        complement(246961..251100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0239"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tma:TM0576 DNA polymerase III, alpha subunit;
FT                   TIGRFAM: DNA polymerase III, epsilon subunit; DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; DNA
FT                   polymerase III alpha subunit; Exonuclease RNase T and DNA
FT                   polymerase III; SMART: phosphoesterase PHP domain protein;
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32809"
FT                   /db_xref="GOA:A8F3S5"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S5"
FT                   /protein_id="ABV32809.1"
FT                   /translation="MKAVSVEHVQINLKDFLSKLGIDFKEDCKIESVFFDSVSNELLIK
FT                   TDRCVKNTNELRKLLESFFEVPVSFYPVEAFKEISIDVDALRRELNGSFPYVQSAAVEG
FT                   EKVVLKVSGEFGRDRIKSKMNQVKDLISKQLGKDLEIHVQVVESQAIVEKHDLIVEEVQ
FT                   DQKKKSRNRKRYQKSDYLTPSNLPSNSDDVKVAGEIYKMDLRDGRKRFLLVHITDKKDS
FT                   LTCLAFNSIINDILSSLQKGDWAVFEGLLKYDESGEPTLHVKNFKKIEPNNRNDLAEKK
FT                   RVELHAHSKFSDLDSVLDIDEYVNRASSWGWKSIALTDHGVVQGIPYFYEACRKKDIKP
FT                   IFGVEAYVVNDSEPVVIGMDKDIEIDQERYVIVDIETTGLHPMFSEIIEIGAVAIENGQ
FT                   ITDEFHSFVKPSEKLNAFTVQFTKITDQMLANQPSIEEVLPKFMEFCKDTTLVAHNANF
FT                   DYRFLRYWIEKSLKLNWEPAVIDTLALAKKLVRLSSYNLEKLASHFKLGPFSHHRASED
FT                   AKVTAKIFLELLKLLKERKITTFKEIESLQKESTLRQSKPFHTTIIVQTKEGLKNLYKL
FT                   ISNAHVKYFYSVPRIPKSELQALRAGLLIGSACVGGELIQEMLTGANESEIEEKMAFYD
FT                   FVEVMPLDLLPVTNDLGLTRERLKELYIKLYEIARKINVPVVMTGDVHFLDPEDEKIRK
FT                   VLQAPQQENISEQPAAYLRTTDEMLKAALEIFEDTNKAYKVVVEFPNQIAESVEKIVPL
FT                   EKKLHTPRIEGAEDQVRTIAMQRAEQLYGTPLPELVERRLNRELDAIINHGYAVLYLIA
FT                   KKMVDKSLNDGYVVGSRGSVGSSFIAYLMGITEVNPLPPHYFCSKCRYVEFIESNEYGS
FT                   GYDLPVKICPSCGEPLNRNGQDIPFETFMGFEGDKVPDIDLNFSGDYQDEAHRFIETLF
FT                   GKQHVYRAGTINTIASRTAFGFVRAYEEKSGRKVRKSEAERLANAITGVKRTTGQHPGG
FT                   LMIIPKEYEVYDFTPIQHPANTKEAMVLTTHFDYESIHDDLVKIDALGHDDPTFIKILK
FT                   DMTNIDPMKIPMDDEKTLKLFSSVEHLGIKPEELGTDVGTLGIPEFGTQFVRGMLSETR
FT                   PKSFAELVRISGLSHGTDVWLNNAQEWIRQKHATLSDVIACRDDIMNYLIKKGMNASKA
FT                   FKIMENVRKGKGLSREDEEELKKLKIPEWYIESCKRIKYLFPKAHATAYVSMAFRIAYF
FT                   KVHHPLAFYAAYFTLKGDEFDLEAAMHGPEIVKKKLEELSGINDKDVRERAKETTLEVM
FT                   LEMFLRGFSFLPVNVNKSHARLFLIEENKLRIPFNKLPNLGDNVAESIIAARREKPFTS
FT                   LEDIVRRTKMNKSHIESFKKLVELEGLPEKEQISLF"
FT   gene            complement(251100..251588)
FT                   /locus_tag="Tlet_0240"
FT   CDS_pept        complement(251100..251588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0240"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: tma:TM0575 crossover junction endodeoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32810"
FT                   /db_xref="GOA:A8F3S6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3S6"
FT                   /protein_id="ABV32810.1"
FT                   /translation="MIIFGVDPGFGILGYGVLSVSGNSFQHVSHGTIQTEKQQNIALRL
FT                   KVLYEELSNVIDNFKPSEIAMEKLFFSRNITTAISVGEARGIVLLLAAQRNIPVFEYTP
FT                   HEIKKAVTGSGKASKKDVQQMIKILLNLKELPKPDDAADGLAIAWCHCAVRNITRRFS"
FT   gene            complement(251699..253510)
FT                   /locus_tag="Tlet_0241"
FT   CDS_pept        complement(251699..253510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0241"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein LepA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; GTP-binding protein LepA domain protein;
FT                   KEGG: tma:TM1623 lepA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32811"
FT                   /db_xref="GOA:A8F3S7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S7"
FT                   /protein_id="ABV32811.1"
FT                   /translation="MKDVNLIRNICIIAHIDHGKTTLVDRILELTKSVDPRQMHEQFLD
FT                   QMDIERERGITIKAQPVKILYQYKEKEYEINIIDTPGHVDFSYEVSRSMAACEGAILLV
FT                   DASQGVEAQTVAHTYLAIENDLDLVAAVNKIDLPNANVDETCNEIIDLIGIDSSDILKV
FT                   SAKTGQGVENILNAIIEKVKPPKGDVKKPLKALIFDAKYDKYRGVIVYVRIFDGSVKKG
FT                   DEILVMSTGDKYEVIETGIFTPLMKPTEELGPGEVGYIIAGIKEVGHAKVGDTITNAAF
FT                   PSDSPLPGYKEIKPMVYASMFSGLPEYYEELKKSLEKLKLNDWALFFEPTHSPALGFGF
FT                   RCGFLGLLHMDIVRERLEREYEIAVILTAPNVEYKILLSNGNEMFVNDPAKFPDEDEIQ
FT                   KIYEPFVKLSIITPSDYVGDIFTNLQNERRANLLHTENAGKNRVIMYFKVPLAEIITDF
FT                   FDRLKAISHGYASMDYEFLGYEESDVVKISILINKEPVDALSTIVHKSKAYIVAKKLVD
FT                   KLSELIPRHQFEIPIQAKAYGRIIARADIKALRKDVLAKCYGGDVTRKMKLLEKQKEGK
FT                   KKLREIGQVSIPQEAFLAVLRIDEEKH"
FT   gene            complement(253507..254496)
FT                   /locus_tag="Tlet_0242"
FT   CDS_pept        complement(253507..254496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0242"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: tte:TTE1085
FT                   L-aminopeptidase/D-esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32812"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S8"
FT                   /protein_id="ABV32812.1"
FT                   /translation="MRKRFRQLGLSFGTLNPATKNLITDVPKVKVGHVTLFSDKPTIVR
FT                   TGVTAIIPSEDVFQSPVTAAYSALNGFGKSIGLLQIEELGQIETPIVLTNTLSVGYAFQ
FT                   GIVQYMGSRFKFRTLNPVVGECNDGFLNDILYPSVNQKHVIEAIESASENFELGSVGAG
FT                   TGMICFGFKGGIGSSSRILKKDRILGVLVLANFGAFDDLHILGTKAADHIKTGILKRQA
FT                   NGSIIIIVATNVALDSRQLKRLSRHSFLALGMLGAPGYHSSGDICIAFSTEKGYSEESR
FT                   DFFDLLFRAVVECTYEAICDALFCAETTDGFLGKAQAMPTNWIRRLQS"
FT   gene            254549..254980
FT                   /locus_tag="Tlet_0243"
FT   CDS_pept        254549..254980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0243"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: tma:TM0887
FT                   methylated-DNA-protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32813"
FT                   /db_xref="GOA:A8F3S9"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3S9"
FT                   /protein_id="ABV32813.1"
FT                   /translation="MDCGFVSTKIGFVSVYVERGAVTRIEFAKKCEGKVSSEILKQLEQ
FT                   YFEGKRKTLDFPVRFSGTEFQKKVWNELRKIPYGKTVSYGELARKLNTSPRAIGQALKA
FT                   NPLPVYFPCHRVVAKGSIGGFSGGLEWKKMLLELERCNL"
FT   gene            254977..256896
FT                   /locus_tag="Tlet_0244"
FT   CDS_pept        254977..256896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0244"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG: tma:TM0886
FT                   penicillin-binding protein, class 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32814"
FT                   /db_xref="GOA:A8F3T0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T0"
FT                   /protein_id="ABV32814.1"
FT                   /translation="MRKISFFTGLFVSLGLLWFIYFSTIKNLDSPESHLPTGLIILYND
FT                   GSPVMLSRCFWKDLSQVPPSIINALLSSEDKNFTRHIGIDLAGIARATVRNISQMSISE
FT                   GGSTITQQLARTLYLSPERSWTRKIKEMFIALWIERVRTKDEILQMYLNSVYMGNGLYG
FT                   FASASKYYFDKDLSELSLEEGAILIGTVRSPENFNPKDNPDLSKKKARTVLKAMVNENY
FT                   LRNDQYEMLATKIDKMDFPKIGEQNFDEEIFWRIVRELNSIGFGLNELRQGYKIYTTLD
FT                   PLLSRLINDIDEKNVSLEAINPSTGTILAYKGVGVTYPEGRRLIGSSVKPLYYYLALLE
FT                   GWGPESKLSDLPIKIGDWTPENFDKKYKGSVTLADALIESRNVPSVNLFMQLGKDKVIE
FT                   FLKKELMLNGYYPNDITVSLGTIESAPEELLKCYAAIFNGGAVLKPYVVKAIEDPFGRI
FT                   VYRALPQVLNVVKPRENDPIVASGLLLDIMKQVVNIGTGVYARQKVPVAGKTGTSDRNA
FT                   WFIGGDSHIILSVVVDGENITGGTRAAPLWAKIMSSYPYRGVFPGWKTQTSDKIKNTRA
FT                   VPTIDAERIIQWLSEGKLSEETLMEMIKTMSDEMVLDILSALNQFSPELARELWEKIKD
FT                   TRSW"
FT   gene            complement(256897..257781)
FT                   /locus_tag="Tlet_0245"
FT   CDS_pept        complement(256897..257781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0245"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; KEGG: tma:TM0570 cell
FT                   division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32815"
FT                   /db_xref="GOA:A8F3T1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T1"
FT                   /protein_id="ABV32815.1"
FT                   /translation="MGFFERLKTGLSRARKALFEGLSQILKGSKISDEILEELEERLLM
FT                   ADVGYPTTEYIIEQLKQSKTNDALETLKEIMIDLLSFDSKLNSPDQPPFVITVVGVNGT
FT                   GKTTTVAKLAAYFQSTGKTVVLGAADTFRAAAIEQLREWGERTGSTVIYHSEGADSAAV
FT                   AFDAVSHAKAREKDVVIIDTAGRLHTKKNLMEELKKVHRVIGKVVPGAPHEVLLVIDAT
FT                   TGQNGLVQAKVFKEMVDVTGIVITKLDGTAKGGISLAIKKELNLPIKFIGIGEGAEDLK
FT                   PFDAKEFVEALID"
FT   gene            complement(257784..259511)
FT                   /locus_tag="Tlet_0246"
FT   CDS_pept        complement(257784..259511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0246"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: tma:TM0514 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32816"
FT                   /db_xref="GOA:A8F3T2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3T2"
FT                   /protein_id="ABV32816.1"
FT                   /translation="MKFSQLYAPTLKEAPADAEVISHALLYRAGFIRKIAAGVYSYLPL
FT                   AKRTLSKIEAIVRKEMNEIGAQEVSMPVIQPAELWKTTGRWDDYGPEMMKLKDRHERDF
FT                   TLGPTHEEVFTHMVKDELRSYKQLPLFLYQIGPKYRDEIRPRFGLLRAREFIMKDGYSF
FT                   HDSDQSLNETYEACKNAYRKITEKIGLKYIIIEAASGAIGGNESHEFVSFAPVGETNLL
FT                   KCEKCGYSSNDEQAPYRGKYHRDEEIEKPVELIHTPNVRSVEQVAEFLNVSKNKIVKSL
FT                   LFIGRNGFVMALIQGDRELNIEKLKVHVNDQSLRLAEPDEVLQAFRVPIGFIGPVGIEK
FT                   VHVVADCGIKYMKNVVVGGMKKDYHYINANVGRDFSPDSYTDLRVVQPNDPCPVCGEQL
FT                   TGSKGIEIAQIFKLGTKYSKAMNALYMDDKGEVKPFIMGCYGWGISRTMAAIVEQLHDE
FT                   DGILWPRSVAPFELIITVVSAQDQDQRIFAQKLYNSLLSSEIDVLLDDRDISPGMKFKD
FT                   ADLIGFPLRITVGKSLKEGMVELKSRNSSKSIKVSAELSKINSVLFKMLEEYNPHERV"
FT   gene            259596..261617
FT                   /locus_tag="Tlet_0247"
FT   CDS_pept        259596..261617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0247"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region; KEGG:
FT                   tma:TM1170 ABC transporter, periplasmic substrate-binding
FT                   protein/conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32817"
FT                   /db_xref="GOA:A8F3T3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T3"
FT                   /protein_id="ABV32817.1"
FT                   /translation="MKIRCFTVLLIFIFVTVFATQTLIFVSGDFYPPFIFKDEKGNIVG
FT                   ISVDILHLLEKKIDVKFEIKLLPFSQALEKLERSEADMINFIFKTPQREQLFLFSDPIF
FT                   NIESRVYFRKNLNIKNFSDLSRYVVGVVEKDANEQLLRRKVSSVSFKYFKNMEELMYAI
FT                   RENQIDVFLMENLTAQYYLVKYDIFHLFTSLEPISIQQIYFAFPKSKPQIAELINSGLA
FT                   KISDSDLENIISPFVRTTRLLPDWAWYVIFIAIACIIGVFGVLIVVNRYLSKQIRKRTE
FT                   ELQKRNEELLSANEELDALNQELKASFQELESLNEELQQTNKILQEKSEQVLKFQNAFL
FT                   ELLDISSKMTYESIQEKDFLFTLLKTFKNYADNLRHVGVALKSSEFGKTLIVLCKDSDD
FT                   FVIERISELIDFQSESVHESILNVVSRMCGKDIVENCSIHVIKTSSEVYGVLFYDSGKI
FT                   ASEVNMEKLSSLIATFLSLRSYVREQGIFHRRLLTVMTKALEYYDFYTKGHSENVANYA
FT                   AKLAENLSLGKEIVRKLYWAGLVHDVGKIFVPQQILNKDGFLTPEEYERVKIHPVKSYE
FT                   LLVAAGLGDLAKIVRHHHERYDGEGYPDGLTKEEIPLESRILCVVDSFDAMTTDRPYKK
FT                   ALSVKEAKIEIENCSGSQFDPDIARKFIELLDSGEIKR"
FT   sig_peptide     259596..259655
FT                   /locus_tag="Tlet_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            261651..263012
FT                   /locus_tag="Tlet_0248"
FT   CDS_pept        261651..263012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0248"
FT                   /product="peptidase M18 aminopeptidase I"
FT                   /note="PFAM: peptidase M18 aminopeptidase I; KEGG:
FT                   tma:TM0365 aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32818"
FT                   /db_xref="GOA:A8F3T4"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T4"
FT                   /protein_id="ABV32818.1"
FT                   /translation="MALRFSPKNVWHVRNRDEIELFSKDYAKFIDFSRTERMTISQAVL
FT                   MLEEAGYVPIEKFDGNSNKVYAVNRAKSLIALNIAGRLEEGVNLIAAHIDAPRLDLKPQ
FT                   PIFEEEKIALGKTHYYGGVKKYQWFGLPLELHGYIVKDTGEVVEIHIGQCKDDPVFVIP
FT                   DLLPHLDKKDSSIEEKFDAEKLTVVFGSIPLAGQEKEAVKTYVLKLLNERYDLTEEDFV
FT                   SGEFELVPALKTRSVGFDESFLGAYGHDDRICAYTALRALIEVENPVRSCGVILFDREE
FT                   IGSEGNAGAKANFYAMFLKRLLKIQGCTDTSLGIDELFAKSFVVSADVCPAVDPMFKEV
FT                   HDPTNAARVGHGIGIVRYTGSRGKSGSSEAHAEIVGKVRKILNEENVVWQVATMGKVDR
FT                   GGGGTVAKFLAERGVCVLDMGPALLGMHSPFELVSKADLFETYRAYKALLERFE"
FT   gene            complement(263036..264094)
FT                   /locus_tag="Tlet_0249"
FT   CDS_pept        complement(263036..264094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32819"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T5"
FT                   /protein_id="ABV32819.1"
FT                   /translation="MKKFMILILCLLFVTAFSYQWEVSPGFFKPVENLGMGGTYVTTSQ
FT                   GLGALILNPALYTPGFEIISPIGVSNNVMSISKLFPYISNPSSITELASDTEFLVSMQG
FT                   VHSYDWNIAAGYGSKLGNISLGGMGAFQTSAFWNLSLMRVEDVELGVWASYFGVFGGSF
FT                   KISNLKIGASVGGGMAGFLVPATGTDYPASVNLLDENSFENIVPDDVNKIFSNINNLFF
FT                   TASAGVIYDISNFRFGASLFYNSNDVLINSSRYILSIGASYNWQFLTVAAELEDLLNQE
FT                   KSIYRKLNLGLSTDFGIVKLFGGLHAGWLTGGVKLDIPFVKIGFTAYVYEYSKHAGIMG
FT                   EQRYILSFDTKF"
FT   sig_peptide     complement(264038..264094)
FT                   /locus_tag="Tlet_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.505 at
FT                   residue 19"
FT   gene            complement(264091..265038)
FT                   /locus_tag="Tlet_0250"
FT   CDS_pept        complement(264091..265038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32820"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T6"
FT                   /protein_id="ABV32820.1"
FT                   /translation="MKLKTITTLWLIVASILLLSSCAFNLFGDLEFQSLLSSGTDEQKL
FT                   ENAKNALSSKDYTKAIALSGSVLNNILGLNLTNEQLTSLLDSTSTLYEFAQSLYEKKDE
FT                   LNETAVEALKVLLEASASKSEKSVNEVIDDLSEVAEELGFNIGDYLPKSMKSSENLWEI
FT                   LESEAGTIVSSVASFMDNAELLKFLTSGYYALISTTDDASMIYAAFCAWYDICYMLNLV
FT                   LDIDNDGVITDEDLVKNTITSPASFTEYASNTQSGLYHDENSCDEFVWAYDILTDILTT
FT                   LDIDIDLPDAPATQDLYDAHYLPDLFELLSGDAE"
FT   sig_peptide     complement(264952..265038)
FT                   /locus_tag="Tlet_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.830 at
FT                   residue 29"
FT   gene            complement(265087..266007)
FT                   /locus_tag="Tlet_0251"
FT   CDS_pept        complement(265087..266007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32821"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T7"
FT                   /protein_id="ABV32821.1"
FT                   /translation="MKIESSYVNMKSYHSHVKFYERTGRYRTINNIKAAKADTNLFEIR
FT                   LSDEDKLKLRLIKFLLEKFTGKKIRIFVLEFEERPQNSGTKEPDLPVDSNVIYDIREKY
FT                   IEEEKLHFAAKGTVFSNDGRKLEFEISLKMSRSLEITRQINLSMHENLQDPLLLNFSNV
FT                   PVEFSDKKVKLDLDLDNVTDEIHLPENGAFLALDLNQNGVIENGLELFGPRTGNGFLEL
FT                   ARYDEDGNNWIDESDSVFAKLKVWFADQNGKSKLMTLKETNIGAIYLEFVKTPFDIHDG
FT                   VITNTGIYLTEDGQVKSIHQINLKV"
FT   gene            complement(266064..266879)
FT                   /locus_tag="Tlet_0252"
FT   CDS_pept        complement(266064..266879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0252"
FT                   /product="peptidase M55 D-aminopeptidase"
FT                   /note="PFAM: peptidase M55 D-aminopeptidase; KEGG:
FT                   mta:Moth_1265 peptidase M55, D-aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32822"
FT                   /db_xref="GOA:A8F3T8"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T8"
FT                   /protein_id="ABV32822.1"
FT                   /translation="MKIFISADMEGISGVVNLSHVEPGHREYERFRKLMTKEINTVVEA
FT                   AIESGATEIVVNDSHNNMDNILIEELHPGAILISGSPKPFSMMQGIDETFDGVFLIGYH
FT                   AKAGTEAIMDHTYTGKVFYTKVNGKTLSESGLNGRFAGCFNVPVVLITGDQNTIKCAKE
FT                   ELNDFVGVVVKEACGRYSAKIYPFEVSKERIKKGVKEALENIKKFKPTVEKEPVELEIC
FT                   FIKSIFAEMSLLIPGVERKDARTVIYRASTYMQAYKVFRACITLASSVE"
FT   gene            266966..268021
FT                   /locus_tag="Tlet_0253"
FT   CDS_pept        266966..268021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0253"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: gfo:orf3289 NlpC/P60
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32823"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3T9"
FT                   /protein_id="ABV32823.1"
FT                   /translation="MVVKELIESFKRENKIDEREQIFSVLPSIEGSTVLLKGFVGEQRV
FT                   KNLLIQKILENSKMNVLDQIELLPEKKFLNMYGIVRKSVVNLVKTPETNDIVTQARMGD
FT                   LLKLFKCVNDWYLVQMEDNYIGWLDSSGFVIYDEPSINSYLVNNFAVVISKFAAVEDSS
FT                   MVEKIVQGTVLPYLKVSENYVWLLSPDKEQLKVRKSDVTLHSSRKEVFSVFRDAEYIIN
FT                   IARQHTGLAYLWGGTTSYGFDCSGFTQFCFRMGGYFLRRDADMQFEQGLEINSKEDMMP
FT                   GDLVFFQTYKPGPSHVGIYIGNCRFIHSGSNGVTINSFAEKDEDYSYKLDVNYIGSRRI
FT                   IGAENLRHPFD"
FT   gene            268108..270618
FT                   /locus_tag="Tlet_0254"
FT   CDS_pept        268108..270618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0254"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; glycosyl
FT                   transferase group 1; TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: tma:TM0756
FT                   galactosyltransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32824"
FT                   /db_xref="GOA:A8F3U0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U0"
FT                   /protein_id="ABV32824.1"
FT                   /translation="MEIFEKISRLIQSKDFSKAKELAQNISDEIDKNNTLGVISFYEEK
FT                   NDDAINFFEKALRINPAHSDVLFNYSKALFEKQNYFESWRYLTRIPKKTWEIYDMLGDT
FT                   QLKQDNPAMALHYYKKAYEMSSIKELKEKYDSIKEQHFKNEKLAIFCLPNIDNFIKDIA
FT                   EILSNIYKVKLVVTTDSKQIVEAYNWADIIWLEWANEMAVQITGRMNKAGKRVICRLHS
FT                   YEALSTYPEKMNWQNVDILILVAEHMREILEIYHNDTYRKISNMIRIIPNGIDLNKFVF
FT                   KNRTPGFDIAVVAHISHKKDPAAWLQVAGMLKKIDRRYVLHIAGEFQELRYANYFRHFI
FT                   EDADLERNIKLYGFVKDINAFLENKNYLLSTSIHESFGYSIAEAMARGIKPIIHNYSGS
FT                   KKQWPAELVYSFIDEIPAMLENEYSSEKYRSFVENKFSIEKQIKNIVEVLNLLRCTQSK
FT                   VNNEQMLYGSSKFTANYFNLKGVFSESFVSKCCETIDAYNQKNRDNLDNSTKVVVDTTI
FT                   RKPLVSVVTPAYNAAEFLEALANSLSKQSIFRDLQWVIVDDDSKDDTQQSIAKLCKQYK
FT                   NMSIKVLKNEKNAGAAYSLEKGFEHANGEYVAWVSADDYYIDDRKLEKDVNLLENSFDV
FT                   VFSKYSLFGSSPGNAKRYETILPDNSTELFIRITLSNNLNGSSVVMKKELYDRAGGFDK
FT                   MLWNVDGDYDLFSKLILCGAKIGLSESTVFNRTHSGQTSSRSILMKVGSSLTRSRFFRI
FT                   DHLRTLIKDKIFGAGNERIMYSLSIRFPLFFLDLYRESIQIPDFERSSIKNLMEHYNKL
FT                   VDFLFSSEAFKVFLCNYTMKEEKL"
FT   gene            270615..271562
FT                   /locus_tag="Tlet_0255"
FT   CDS_pept        270615..271562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0255"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: dsy:DSY4430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32825"
FT                   /db_xref="GOA:A8F3U1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U1"
FT                   /protein_id="ABV32825.1"
FT                   /translation="MKILLTGGLGFIGRMLKVKLQAKGHEVIALDLQVRDYDDYVRADV
FT                   TEFLDLWRTAKTFDKFDYVVHMAGEVGRLVGEEHPHKMIRVNDIGTLNVIHICMEMGSN
FT                   LVYFSTSEIYGRLLDIQEVTEESVNHLSPFMLSNVYAISKYFGEALVNHYVTNYNLKAV
FT                   GIRPFMVYGPGVISSKYKSAIDQFIYNALTGKEFYVHRGSERAWCYIDDFIDGVMLVLE
FT                   KHEFRDNVYEAYNIGTQEYKTMEEVGEIVLKYTKAPGELMKIVEPPEKFLVTRKRFSNK
FT                   KLLNLGFEQKVPLEEGIKRTIEWHRSVVSGNNNW"
FT   gene            271543..272412
FT                   /locus_tag="Tlet_0256"
FT   CDS_pept        271543..272412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0256"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: bsu:BG13829 similar to NDP-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32826"
FT                   /db_xref="GOA:A8F3U2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U2"
FT                   /protein_id="ABV32826.1"
FT                   /translation="MVTIIGSDGFVGHRVKKWAECLKINHTGVYFEDKEKGNIHFEEYI
FT                   GSELLKETDTLVITAGNSNHNLPRHNFTEALKMDLSYLEKLEKAELRADIVFLSSAAVY
FT                   YGHEGKVDEETSVEPLDYYGLSKLYSEYMVRLIAGKTGKKLIIYRLTNAFGKNEKRKRL
FT                   FDNIIECIKTGAPLKITGKGESYINPVPVEKVAEILIKSALEIRKALGEKKLEVINLTS
FT                   KEEVRVIDIVKSIENKYDLKWVFSGQEESPVKFIVKSRKLENFLTRLGIEIEPLNRSIE
FT                   RFLVSYGL"
FT   gene            272551..273714
FT                   /locus_tag="Tlet_0257"
FT   CDS_pept        272551..273714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0257"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: tma:TM0758
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32827"
FT                   /db_xref="GOA:A8F3U3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U3"
FT                   /protein_id="ABV32827.1"
FT                   /translation="MRINHNISALNAWRSMDQTQYSMSKTLEKLSSGLRINRAGDDAAG
FT                   LAISEKMRGQISGLNMAVKNAQDAISLIQTAEGALTEVHSILQRMRELAVQAASDTNTD
FT                   VDRNQVQAELDQLREEIDRIARTTEFNTMKLLDGKIESFRASPDAKVVTAGNINLQLGS
FT                   VSSAAVEGTYVVEVGQLNGTETSALDVKITLFTAGGSNSVIANITAGGAAIGNITFTWD
FT                   TNVISLADFGGALPVGEVVDSAVARVEAAVTTASQLVFQIGANEGHNMVSGIDDMRAAA
FT                   LGLTSTSLDVKDQDNAERTVMVIDAAIHKVSSARAQLGAVQNRLEHTISNLGVAAENLT
FT                   AAESRIRDADMAKEMMQFTKQQILIQSSMAMLAQANTQPQTVLQLMR"
FT   gene            273811..276390
FT                   /locus_tag="Tlet_0258"
FT   CDS_pept        273811..276390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0258"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tma:TM0757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32828"
FT                   /db_xref="GOA:A8F3U4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U4"
FT                   /protein_id="ABV32828.1"
FT                   /translation="MSCLLSVAMIVKDEESNIRRALDSVKDIADEIVVVDTGSVDNTPD
FT                   IVRKYTDKLYFHPWKDDFSEARNNSLKYVTCEWVLILDADEEISEDFRKQIRDFLKNLP
FT                   EDVNTVYLPTLSYLDWDFKRTEIASTPRLFRNGTVHYENIVHNQAIYKPKVVNANFLIY
FT                   HYGYIWTRRLRKQKYERTANLIKKYLQQCKNDQEKLYYLIQLYKIEKTGGKPYQIAETG
FT                   WQAFQLMKKLTSIPAIGLEFLYVFSIDLANAGLNDLAVQLAQTAIKVVPDYPDPYFSLV
FT                   NIYAKEQKWEKVIEYYERFKKAVEYASENIEKFGWTIMSFKDIPVADATAMIAYVATEN
FT                   YEKFNEIARDRFAKNEDIPEKMLQFLVEKISEKGIRECLSGLTNLVEFIRKKQLKINMQ
FT                   PIYEKIVEFKLPVKIENVYAKEITPFSYALLKRLSEGRDLLLEFLSSGNLKKLVDDNGV
FT                   GGLLFVYSMLESDEEKKKFVENFVDNEDYVVQGVAKALLADQFLKEAKFLEAIRLYRNV
FT                   VQLVPELSKFVKPIVEDLKTKLDPDINGVYEELYNFYVKQKEFLIDFQKYAGDNTSKLH
FT                   LLSDKDVALYVSAVYTKNEDKAIKLLKRIKNPSRFPMYYYRLAKIYSKVDLEKSLMYHI
FT                   KAVEENEKLADINSGRFLYTGLYPNITLDWFDKNDEILWAGNISERFTTFGVIHPVRAW
FT                   MKAKNGLIYSRPYPVDESIKAYESFEKEFYKELPLRVGAFELHEILLNLDWKSVRKAEG
FT                   MKNFEYIFMDLGIEVSDNSENAVILEDVEKTVELKKLLQGAKRAVVFYHVPNLCDGDDI
FT                   IWYYPAFRILRTTAQMKKELSSIGYKILTNMIFPNGLRCVVIEQSKK"
FT   gene            276408..277103
FT                   /locus_tag="Tlet_0259"
FT   CDS_pept        276408..277103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0259"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: swo:Swol_0065 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32829"
FT                   /db_xref="GOA:A8F3U5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U5"
FT                   /protein_id="ABV32829.1"
FT                   /translation="MAVYQRPPKLSESIAQQLKDDIIKGIYLPGERLKIIEIARRFGVS
FT                   QTSVREALKILEKSDLVSESPHKGYVVTNLTLDELVDIWTIKEKLWSLAFAWFTERADK
FT                   ELIKDAEKWVSEFRNAYIENDLDRAFEANFAFTDVILAGCGSRKLVTLLRSIEDQVKRY
FT                   RYLSLEFDDNLKVSSQYFGEIIKAIWIRDSKKVSTMIQEYIRFSQKVLKENYKYMQEKS
FT                   KEKMRKEQL"
FT   gene            277216..277989
FT                   /locus_tag="Tlet_0260"
FT   CDS_pept        277216..277989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0260"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: rxy:Rxyl_2245
FT                   putative cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32830"
FT                   /db_xref="GOA:A8F3U6"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U6"
FT                   /protein_id="ABV32830.1"
FT                   /translation="MPYQLIDLSETIFPNSESEPWPAKITYLDHRTGAQEMREKFGVIP
FT                   KDLVYSQGLGWSYEFIEAMTHTGTHLDAPWHFHPISEGKIAKTVDEIPLEWCFSNGVVL
FT                   DMRHKNPGEYITIEDLNLSLEKINYEIKPLDIVLIMTGADKRMGTKEYFLQPGMSREAT
FT                   LWLIGKGVKVMGIDAYTWDRPFSEMSKDYSQKKDGSFIWPAHFAGIEKEYCHIEKLANL
FT                   DKIPRPYGFKVSVFPIKIHKASAGWVRAVAIIENI"
FT   gene            278008..279966
FT                   /locus_tag="Tlet_0261"
FT   CDS_pept        278008..279966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0261"
FT                   /product="Na+ symporter"
FT                   /note="PFAM: Na+ symporter; KEGG: rxy:Rxyl_2906 Na+/solute
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32831"
FT                   /db_xref="GOA:A8F3U7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U7"
FT                   /protein_id="ABV32831.1"
FT                   /translation="MGTVGIFTTFFAIFGFIMVFVGWVTRKWIGRSTDYLVAGRQINLL
FT                   VNTLGVAAIGYAGTTLTLAPAFTIMGGLTKSIFMLGVAYSLTGIISYALLIAPVARRTG
FT                   AHTLPEWLEIRYDRRVRFIITLVTVVAMLGITANNVLSMATIITGFTGWSIPVTILITF
FT                   LIFLFFTVLGGMWAVTLTDFIQGVLCTFAIPVLVIFLLVRYGGLSFLTHNWPGGNVWTS
FT                   GIAGKSFPWFSTFYPSVFVAFFLYGMALVWGSNSYWIRVSSVRSERVAKFSYLLAALIL
FT                   FSANGFMYPLLGAYVGAAHPEMFAPQGSAAPAAAFGIFLRDTPSVLAAYFLLTTLAASV
FT                   STSTTYYMAGSSVIVRDIYQRFVKPNAKPEDLVKPSMIVNTLFGIAALLLCFFPGGPVY
FT                   LFAFATAWLAPTAVIVILGLYSKKFSTTGAFVGGLTGLIFMSVWTLLDLTKIYPLTSKF
FT                   GHMVIPGLIVSVVAALIANLFGKSKYDFTVKKRTQLSDKEIEVLDIIRRGYNTMAEITD
FT                   LLDIDSSKSSELVLSLEKAGAVKRASNRGSGFYTFILTDFAQNLPTRIKSEEIYGDLDI
FT                   VGLNILKHVKSGSQVLADELSKTTGLNSMALSTVINSLIRRGYLSEGGIWRRIIKITQK
FT                   GLEAVQRFEKGDGESAV"
FT   gene            279956..281203
FT                   /locus_tag="Tlet_0262"
FT   CDS_pept        279956..281203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0262"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   dsy:DSY0970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32832"
FT                   /db_xref="GOA:A8F3U8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U8"
FT                   /protein_id="ABV32832.1"
FT                   /translation="MPFEKLEGCEPFILNDSWVSPLNFIEEVRSKMNLPEQVIIHDVTL
FT                   RDGEQMAGVVFTEDEKVFIAQELDKIGVPMIEVGFPAVSGEDQRVFKRLSKMNLKAKKI
FT                   ALARIMDEDVKLAAECGADGLFYETSINPYFVKYVLGLDSKEFIDRIIKGAKLAKELGL
FT                   FVEFCGWDTFRINNLEWIKTVYTELLKNVEVDQIGISDTFGQAHPFTVNFLVRKMKEWF
FT                   PSIPLSIHVHNDYGLATATALMAIASGAEAVETSFNCLGERTGNASTEEVIAGIEMILG
FT                   IKTNVDCQELYRVSKMIQEVSKMHVAPNKPIVGDRIFDSESGIVIDANEKINRATEIKY
FT                   AMYPYNPENFGRWLKYVGGKKSGRAFVKQYLDKRGLKANEAQIDEILVRIKKIGTVLKS
FT                   ALSDEDIDRIVELVLG"
FT   gene            281468..282718
FT                   /locus_tag="Tlet_0263"
FT   CDS_pept        281468..282718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0263"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase; Glu/Leu/Phe/Val
FT                   dehydrogenase dimerisation region; KEGG: tma:TM1015
FT                   glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32833"
FT                   /db_xref="GOA:A8F3U9"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3U9"
FT                   /protein_id="ABV32833.1"
FT                   /translation="MAKSLYQQALEVFGHAADVMQLDPNIRKFLERPQRTLIVEFPVVM
FT                   DDGRVEMFTGYRCQHNTARGPAKGGIRYHPDVTIDEVQTLAFWMTWKCSLLNLPYGGGK
FT                   GGVKVDPAKLSKHELERLSRRFFYEIANFIGEKRDIPAPDVNTNAQVMAWYVDTYTMHT
FT                   GYPALGVVTGKPVEIGGSIGRNEATGRGVAVVASEACKLLDKDISKATVAVQGFGNVGS
FT                   FSAKILHDDYKAKIVAVSDVSAAYYNPDGFDINDLIAYRDNNKGLINGYPKGQKITHEE
FT                   LLELDVDILVPAALENAITEENADRIKAKLIVEGANGPVTPAADRILVSKGIMVIPDIL
FT                   ANAGGVTVSYFEWVQDLQSFFWDLDDVRAKLTKMMRAAFADVAETKKKYNVDFRTAAYV
FT                   VAIERVAQAVKLRGIYP"
FT   gene            complement(282751..283047)
FT                   /locus_tag="Tlet_0264"
FT   CDS_pept        complement(282751..283047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32834"
FT                   /db_xref="InterPro:IPR037285"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V0"
FT                   /protein_id="ABV32834.1"
FT                   /translation="MKEIFEIEKQIDSLIEQHEYEKILNLLFQREKLIKNLSSIDKKIA
FT                   QILVEADKVRIDKIKSHMAQIQQNALQTKNAESAIKLYRYISDSKGTRLDEKM"
FT   gene            complement(283044..283850)
FT                   /locus_tag="Tlet_0265"
FT   CDS_pept        complement(283044..283850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0265"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; holo-acyl-carrier-protein synthase;
FT                   PFAM: 78-dihydro-6-hydroxymethylpterin-pyrophosphokinase
FT                   HPPK; 4'-phosphopantetheinyl transferase; KEGG: efa:EF3268
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32835"
FT                   /db_xref="GOA:A8F3V1"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V1"
FT                   /protein_id="ABV32835.1"
FT                   /translation="MIVGIGIDVVKIDRVELSLSKRILGPLEQLEFESIKDKKTYLAAR
FT                   FAAKEAFFKAIGTGVKNYSFTDIEIIHNHAGKPLLLFHRGFYFNFAHISITHDFVAAAQ
FT                   IILEKRPGNVYIGVGSNLEDRLKNIQQACNLMESRKIKIIKKSSIYETDPYGVKDQPDF
FT                   YNCVLEVDTDFSVEELLNMLLKIEQEMGRKREKKWGPRIIDLDILMYGNTVYKLPDLSV
FT                   PHYDLINRQFVIVPLLEIKAIDHPIYGELKNFVGERRDWRLVTKNW"
FT   gene            complement(283847..285139)
FT                   /locus_tag="Tlet_0266"
FT   CDS_pept        complement(283847..285139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0266"
FT                   /product="Conserved carboxylase region"
FT                   /note="PFAM: pyruvate carboxyltransferase; Conserved
FT                   carboxylase region; KEGG: tma:TM0128 oxaloacetate
FT                   decarboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32836"
FT                   /db_xref="GOA:A8F3V2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V2"
FT                   /protein_id="ABV32836.1"
FT                   /translation="MNFVDTTLRDGHQSLIATRMSTEDMLPALDAIDKVGFYSMEVWGG
FT                   ATFDVAVRFLNEDPWERLRKIREKIKNTKLQMLLRGQNLVGYRHYADDTVRLFVRKAVE
FT                   NGLDIIRIFDALNDERNLLIAIDEAKKSNAHVQGAISYTISPVHTIEYYLEYARKLIEL
FT                   GVDSICIKDMAGLLTPKDAYNLVSALKKQFSIPINVHSHCTCGLAPATYQAAMDAGADI
FT                   IDTALSPFALGTSQPPFEPIYYALSKNGDLPALDWDTLDFLIDHFTRVRQKYAAFDVKM
FT                   TTIDPKILYAQVPGGMYSNMVKQLQEQKMAHRMKEVLEEIPRVQKDLGYPPLVTPTSQI
FT                   VGVQAVLNVMTGERYSKVTKEVKEYVKGFYGRPPAPIDPELVKKILGDEDVLIYVILGE
FT                   IGKKYLQKRYINQLKVDFDLLKDFEAPVYPV"
FT   gene            complement(285145..286224)
FT                   /locus_tag="Tlet_0267"
FT   CDS_pept        complement(285145..286224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0267"
FT                   /product="peptidase dimerisation domain protein"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: tma:TM0129 carboxypeptidase G2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32837"
FT                   /db_xref="GOA:A8F3V3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V3"
FT                   /protein_id="ABV32837.1"
FT                   /translation="MDKKWFGIYERLVNTDTGFDIDLSQKLLRTDFVAEELAKLGFKLI
FT                   RESAAHVGILGKPPYITLIGHLDTVFKEGESSKRPFNVRNDIVYGPGVADMKGGIVTLL
FT                   ATVEKAVSSGFKDICVIMNVDEELGSKTSRETFYKYAKESICCLSFEPGGSNGEVVISR
FT                   KGIASMNLTVRGIKGHASRLEEGANAIVEASKKLVEIYSLNEKFSDLTANPTIVNGGEK
FT                   SNITPDLCMVYFDVRFSDQKDLEKFKEKVFQICSFSSIKGTNCDLSLQERRPAMKPHPE
FT                   ILKALEEISKELRKEIKVQHSNGGADSAFFYQFDVPSIDGLGISGGRFHSEDEYAILSS
FT                   FEPKIELSMALIKHFSNRR"
FT   gene            complement(286235..286867)
FT                   /locus_tag="Tlet_0268"
FT   CDS_pept        complement(286235..286867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0268"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   tma:TM0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32838"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V4"
FT                   /protein_id="ABV32838.1"
FT                   /translation="MRKELYKFKYESLCRKLKPILEKKAFEVYIADNTSDVRKLVERIV
FT                   PEGAVISSGGSITLNECGVIDLLKSNRYKFLDRYNSPDRRKTELEAFDSDFYFCSANAV
FT                   TMDGELVFMDGFGNRVAAVTFGPRNVILIVSANKIVKDLQEAKERIRYIAPMNAKRLSL
FT                   STPCAVSGICHDCDSPQRICRHLHVIFDSRNLPGRIKIILVLEELGL"
FT   gene            287051..287437
FT                   /locus_tag="Tlet_0269"
FT   CDS_pept        287051..287437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0269"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: pho:PH0854 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32839"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V5"
FT                   /protein_id="ABV32839.1"
FT                   /translation="MKIIQTSGAPKAIGPYSQAIEAGNFIFVSGQIPIDPATGELVNGD
FT                   IKKQLRRVLDNIEAVLMAAGCTLKNIVKVTVFVVDLKSFSEINEVYGEYFNEHRPARSF
FT                   VEVSALPKGSQIEIEVIAVKDVNK"
FT   gene            287504..290134
FT                   /locus_tag="Tlet_0270"
FT   CDS_pept        287504..290134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0270"
FT                   /product="calcium-translocating P-type ATPase, PMCA-type"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; calcium-translocating P-type
FT                   ATPase, PMCA-type; PFAM: cation transporting ATPase domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase;
FT                   E1-E2 ATPase-associated domain protein; KEGG: tte:TTE0030
FT                   Cation transport ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32840"
FT                   /db_xref="GOA:A8F3V6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V6"
FT                   /protein_id="ABV32840.1"
FT                   /translation="MKDFYKQSVEDVCSHLGTDPDKGLSSEEAKKRLEKYGPNELAEKK
FT                   KKTIWRMFFSQFTDFLIIILLVAAGVSILVGESVDAILIMIIVVLNATLSTIQESKAEK
FT                   SLQLLKKMAAPMARVLRDGIVQTVPSREIVPGDIVILEAGNYVPADGRLIETVNFSVSE
FT                   AALTGESQPVEKTTDLIDQENLPLGDRTNMVYSGTIVSRGRAKAVITSTGENTELGKIA
FT                   KLLSEMEETQTPLQQNLEKLGKQIGMIILAICAVVFLVGIFEGEPALEMFLTAVSLAVA
FT                   AVPEGLPAVVTIVLALGMYNMVKRHAVIRKLQAVEALGSVNVICSDKTGTLTKNEMNVV
FT                   KYYLHPSIILDQEQIKSQKSEHIEKLFMGAILCNDSFITVKNGNRVTSGDPTEIALALA
FT                   AMDYGFDKNELEKRIPRIHEIPFDSDRKMMTTVHEFEKKRLSFTKGAPDVVIKNCSKYM
FT                   APDGEIKVLSENDKNEIEQANMKMAQDGLRVLAVAFREIGDDYSELEKDLVFLGLMGMI
FT                   DPPRPEVKDALERCRTAGINVIMITGDHKITAQTIAREIGILSENDMVLTGHELIEMDV
FT                   EDLVKVVDKVKVYARVSPTDKLKIVEALKKKGKVVAMTGDGVNDAPALKKADIGVAMGI
FT                   TGTDVSKDASEMVLTDDNFASIVAAVEEGRKIFDNIRKVVYYLLSCNISEVVTIFVSIL
FT                   LRLPLPLIPVQILWMNLVTDGLPALALGVEPAEPDVMKRSPRDPKEGIMSKEIMTNVFI
FT                   GGTILSVLTLFVYSWALLEHDQIELLRTMVFFTLCTGQLLHSLNSKSIKLSLFKVGIKN
FT                   NPRLLIAIAGSFALLLGVIYLPILQNVFGTTNLTGKQLVVSLIAAIMIIPLYELVKVIR
FT                   YRKKE"
FT   gene            290172..290744
FT                   /locus_tag="Tlet_0271"
FT   CDS_pept        290172..290744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32841"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V7"
FT                   /protein_id="ABV32841.1"
FT                   /translation="MKKILTICLFLLATGAIAGVFFSVNPSLGFSIYNDVYADGKKQVR
FT                   AITDYGGQLNIEYGLDEGLRMGAVLGLLSMSVASDLGTTDANLFFVGLAPSFSFGFLDV
FT                   IGKITGEIMFVFMGPTGSLSALGLSGTSNLEGRIYSGRFDVQFPLSEQFSVGAGLGVRF
FT                   HDLYISTRNVYVRTLSTPIYLNMNYKF"
FT   sig_peptide     290172..290228
FT                   /locus_tag="Tlet_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.514 at
FT                   residue 19"
FT   gene            complement(290766..291647)
FT                   /locus_tag="Tlet_0272"
FT   CDS_pept        complement(290766..291647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_2351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32842"
FT                   /db_xref="InterPro:IPR029433"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V8"
FT                   /protein_id="ABV32842.1"
FT                   /translation="MRTNKDKLVMISVQGTIVRPEHSGRHSVSHDGKPFMLPGTGGITY
FT                   NVKVGDCAFGWEADHVEPGVSTILDQDKRDSGPNRGYNFYACIGNEARVVSGDAKGAKG
FT                   VVTGHHGGAEHVLIDFPDEVLEKLTLDDKILIKSFGQGLKFLDYPDVYVYNIDPNLLEK
FT                   LSIEEKDGKLYMPVVAVVPSFLMGSGIGSTSMGTGDYDIMTADKKTLKKYGLDKLRFGD
FT                   IVYIQDHDNTFGRCYRKGAATIGVVIHSDCKYAGHGPGVTTIMSCAMPKIKPVIDPDAN
FT                   IAKILKIGRYRE"
FT   gene            291730..292401
FT                   /locus_tag="Tlet_0273"
FT   CDS_pept        291730..292401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0273"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: mja:MJ1434 endonuclease III, putative
FT                   (nth2)"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32843"
FT                   /db_xref="GOA:A8F3V9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3V9"
FT                   /protein_id="ABV32843.1"
FT                   /translation="MDVRKFLLKIYKILYGSYGPQGWWPAESWFEVIVGAVLTQNTSWN
FT                   NVEKAIHNIRKAGALDPVILFRLRNDQLSQLIKSAGFYNLKTVRLKNLLSLLSEYNFDF
FT                   HSLSRNITREILLNVNGIGKETADSILLYAFDKPVFVVDNYTKRVFERLGILNKKDSYD
FT                   KIQAIFHDLPKDTGLYKEYHALIVKHAKDICLKNKPKCNICCVKGFCAFHTHISKPIST
FT                   C"
FT   gene            292447..292537
FT                   /locus_tag="Tlet_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            292447..292537
FT                   /locus_tag="Tlet_R0004"
FT                   /product="tRNA-Ser"
FT   gene            292574..293032
FT                   /locus_tag="Tlet_0274"
FT   CDS_pept        292574..293032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0274"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   tma:TM1778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32844"
FT                   /db_xref="GOA:A8F3W0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3W0"
FT                   /protein_id="ABV32844.1"
FT                   /translation="MILVKKIIDKLRPVVIDILSQLGLELFDITLRRERRKLVLRVVID
FT                   DPENYVSIRQCEIVSSQIGNYLDEADLIDSSYILEVSSPGLDRPLREMKDYNRFVGRLA
FT                   KIWLKDGKVLVGNIKETTENTVSIELKNGEIITFSFDQIKKGKLEIDF"
FT   gene            293046..294080
FT                   /locus_tag="Tlet_0275"
FT   CDS_pept        293046..294080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0275"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: NusA domain protein; KEGG: tma:TM1777 N utilization
FT                   substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32845"
FT                   /db_xref="GOA:A8F3W1"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W1"
FT                   /protein_id="ABV32845.1"
FT                   /translation="MNLGLLDALDQLEEEKGISKDEIIEILEKALVSAYKKNFGTAKNV
FT                   DVKIDRMTGDIQLFQVFDVVEEVEDPLTQMSVEEARKADPLAESGKKIFKKISVKNFGR
FT                   IAAQTAKQVLIQRIRELEKERQYEHYSTLAGSVITVEVIRVTSDWADIRVGKIETRLPK
FT                   REWISGESISAGELIKVYVQSVVKDKKGPKIMVSRAVPEFVAGLLKLEIPEIENDIVQI
FT                   KAIVREPGVRTKVAVVSTNPQVDPVGACIGEGGSRISAILRELKGEKVDIFRWTDDPRQ
FT                   LIVNALAPASVTSVEILDFERKAVRVLVPPTQLSLAIGKGGQNARLAAKLTGWKIDIKP
FT                   VMNV"
FT   gene            294092..294556
FT                   /locus_tag="Tlet_0276"
FT   CDS_pept        294092..294556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0276"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: tma:TM1776
FT                   ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32846"
FT                   /db_xref="GOA:A8F3W2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W2"
FT                   /protein_id="ABV32846.1"
FT                   /translation="MMLYESLRKELRSKKYRMTAQREIVLKVFAESGERHLGAEDVYRK
FT                   LVEKRYRISKATVYRTVELLSKLGFLRRLEFGEGIYRYELAAPDAETLHQHIVCKACGE
FT                   VIEVDEKIVKDLVKNVESKTGYVINDYDIKFYGLCPKCQNRKSISRENRI"
FT   gene            complement(294496..295791)
FT                   /locus_tag="Tlet_0277"
FT   CDS_pept        complement(294496..295791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0277"
FT                   /product="ComEC/Rec2-related protein"
FT                   /note="PFAM: ComEC/Rec2-related protein; KEGG: tma:TM1775
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32847"
FT                   /db_xref="GOA:A8F3W3"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W3"
FT                   /protein_id="ABV32847.1"
FT                   /translation="MNYFWLISFLGISTGVLLSPALLISFSMVGIAIFLLWKHLSVRIY
FT                   LLCVVLGLIISLPGNVPQRSEIVGFCTLKKSSYTVVSNVRFFENGKWNYLHHDVKVKSD
FT                   QINPGEEVYIYGKISKSFSYPLYTVVPDFSCGVRQTARGFLKVMSILQKFKEENEIFII
FT                   DVLGPFAKTVNGLLFSDGEFDQAEYSDLKNSGLAHIFAVSGLHVGIVYALVEIIVSFFT
FT                   YKLFFRRFIGAFIALMFALSTGPTPSAFRAAAMLCIWSFFKIADYPVEPLNVLGMAGTF
FT                   NILLEPYCILSTSFLMSYMATASILICQEKIRSYHIVVKTLFTPFSAFFGVAPFLNIFS
FT                   SLNVLSPFLSIFATYLVIPIIWAAFISIFFRTIHMETLAQILLKGATPFVYLVQRLIHL
FT                   SSLVPNFSLGLTGYILFSLLILFLFWHFGHKP"
FT   sig_peptide     complement(295702..295791)
FT                   /locus_tag="Tlet_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.393 at
FT                   residue 30"
FT   gene            complement(295788..296996)
FT                   /locus_tag="Tlet_0278"
FT   CDS_pept        complement(295788..296996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0278"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase-related
FT                   protein; PFAM: metalloenzyme domain protein; KEGG:
FT                   tma:TM1774 phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32848"
FT                   /db_xref="GOA:A8F3W4"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W4"
FT                   /protein_id="ABV32848.1"
FT                   /translation="MNYDRQQLLSEIVQPAQTKIVLLVMDGIGDIPKNGETPLQKANTP
FT                   NFDKLAKDSDLGQTIPVLHGVTPGSGPGHLALFGYDPVKYQIGRGILEALGSNVDVEEK
FT                   DIVARANFATVKNGIIVDRRAGRPSTEESGKVVQKLSSLIKEIDGVKITFYPGKEHRFV
FT                   VKLTAEGLDDKITDADPQKEGKPILLTQPLTAEAKKTSEIVNKLMNQIADVLKDEERMN
FT                   FALIRGFSKYPKLPQFPEVYKLKAAAIATYPMYRGIAKLVGMDVIETGSTIQEEMQTLK
FT                   SVWGSYDFFYFHVKKTDSYGEDGDFDSKVHVIEEVDSVLPEIISLNPDVLAITGDHSTP
FT                   AALKSHSWHPVPFMLWSKYTRKGLSKAFDEYECAKGTLGTFYAVDAMSIILAHALRLEK
FT                   YGA"
FT   gene            complement(297001..298644)
FT                   /locus_tag="Tlet_0279"
FT   CDS_pept        complement(297001..298644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0279"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: tma:TM1773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32849"
FT                   /db_xref="GOA:A8F3W5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W5"
FT                   /protein_id="ABV32849.1"
FT                   /translation="MLIKAIVYLPLKPDKAKRLNLPVKLPVLAEDLPEILDENHIPVNI
FT                   IIRGLEAQYEISKDQYYKSYLIYFYYEKVKEALNENNLTEAEEWLGKVEQLERDYRYDF
FT                   FKGVILSRSGDYDQAEIFLRSSTSKNNYFALGHYELGNLLRSKKEFEDAILEYKKAFES
FT                   DKNFLLPLLRIGDCYMEMGEVRQACDFYQTAIQIDPNFAQAYARLGVAYNILQKYDHAE
FT                   NSLRKAVQIDKTDYLSLFNLSFTLSRLGKHFEAMHILKDLVEKKPQDATIMNEYALILR
FT                   KLGFYEQAKDFIDRAFEINNNDPSLNYNRVLLTLFVDKEEAIRLSEKLSSPYYEKMEDL
FT                   ITFLRQWRPVDVPDFISDKVKKFKPCMEKGEINVQKLVDLLENEDRINMVKNGILPATD
FT                   TEIDTVQWLDIVMFIILASNDDPIKMEKNVTKVAVSLYGSGIMLAVAITLMRIFLHISA
FT                   HGNFDLQSFVNDVVTDIQEYHWQFAKRISELENESFSLEELHLNGIKKGSDFLIELLKV
FT                   LSIDITEEDLYLIEDNLMKEIYLIFQPIRR"
FT   gene            complement(298604..299404)
FT                   /locus_tag="Tlet_0280"
FT   CDS_pept        complement(298604..299404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0280"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   tma:TM0768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32850"
FT                   /db_xref="GOA:A8F3W6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W6"
FT                   /protein_id="ABV32850.1"
FT                   /translation="MWYPGHMAKASKTIHRIIKDIDLVVELLDSRAPLATQAYDRKFLM
FT                   GKKKVMILGKSDIADPKQTMKWKIFFESKNEKVLIFNKNTTKNYLIDFIANHADKNSLI
FT                   MIVGAPNVGKSTLLNKLKGTRSAKVGAAPGITRGLQWFSAGGSLRILDTPGLLLPKLWS
FT                   SDLAAKLLLTGCLIPENVPPKVLERAFEIYARRAKLEENSLQDFLERHAQKMGMILKGG
FT                   IPDRERALVDFFIKLSQGKLGRFTFETVEEASAYQGNSLSSTET"
FT   gene            299485..300591
FT                   /locus_tag="Tlet_0281"
FT   CDS_pept        299485..300591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0281"
FT                   /product="glucose-1-phosphate adenylyltransferase, GlgD
FT                   subunit"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase,
FT                   GlgD subunit; PFAM: Nucleotidyl transferase; KEGG:
FT                   tma:TM0239 glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32851"
FT                   /db_xref="GOA:A8F3W7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011832"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W7"
FT                   /protein_id="ABV32851.1"
FT                   /translation="MRVLGLILAGGQSKMLGSLVSKRASAALPIFGKYRAIDFTLSNMV
FT                   NAGIKKVGVLTQYNPRSLMDHLGSGKEWDLDRKNGGLFLLQPYVSQEGYYWYKGTADAI
FT                   FQNMTILRRGEEDYVLIGSGDHIYKADFGDIFNFHFSTGADITLLVKELDETYDLTQYG
FT                   IVKLSGNRVMEIEEKPENPKNNTAFLGIYFMNKYLLMELLYNYVNRGENDLLNIVISQI
FT                   DRLKVHGYVFRGYWRNIKKGVAEYFRVNMDCLKREIREELFYKHGKVYTKLKDFPPPKI
FT                   GGNAVVKNSIVSDGCIVNGYVENSILFRGVVVKAGAVVENSVLMQDAVVEEGAIVRNAI
FT                   LDKEVLIRQEAKLIGRDSIAVMEKRAVL"
FT   gene            300605..301867
FT                   /locus_tag="Tlet_0282"
FT   CDS_pept        300605..301867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0282"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: tma:TM0240
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32852"
FT                   /db_xref="GOA:A8F3W8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3W8"
FT                   /protein_id="ABV32852.1"
FT                   /translation="MRKVLALILAGGHGKRLGVLTEKIAKPAVPFGGKYRLIDFTLSNC
FT                   VNSGIYHVGVLTQYRPHLLNNHINIGRPWDLDRKKGGVTILPPYLGGVAGWYRGTANAV
FT                   YQNIEYVDSADPDFVLILSGDHVYAMDYNDIIDFHILKGAEGTIACIEVPPEETNRFGI
FT                   MMTDLDSRIVDFEEKPQRARSNLASLGIYVFNWKFLKEYLIRDEQNNESTHDFGHDIIP
FT                   LMINEGCQIYAFKFNGYWRDVGTVRSYWESNLELTRPIPPLNLYDRHWRFFTQTEEMPP
FT                   AYCAPTSKIVNSIISEGCEIYGFVENSVIFQGVYIGENAVVKNSVVMTSTKIGENCVIT
FT                   DAVIAERVIVENRVIIGEGDDAKNKLDSDVYTGQITVIGMYSVIPSGSVIGKNCVVGVG
FT                   VEKGDFKTQKVESGDYILHKE"
FT   gene            301874..302917
FT                   /locus_tag="Tlet_0283"
FT   CDS_pept        301874..302917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32853"
FT                   /db_xref="GOA:A8F3W9"
FT                   /db_xref="InterPro:IPR032602"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3W9"
FT                   /protein_id="ABV32853.1"
FT                   /translation="MDFYFVKYRLKSRITAEEGIGFFFGKVNEPPEYDLLIVPSRYSNF
FT                   LRLDLSDDYAAFIKGFNDLKSKLSSQIPESVDLSNEFLSYIKGYISRKGGQLFGAELSA
FT                   AVKDSDVDLVQYIVSEILKEWAPKIEITVEFKQVSYQEISAENFMQLWQDFDSEGLVDV
FT                   LKRPDIADLAEIFPLVDPIRGKVLAEFDVGDPIFFVILNVRNSENLEKLKLLYPKHFSQ
FT                   QGNVIPLPGILVGKELIRGKKEEYYLIKVDMGEGLLGRGLIPKSIKIMSEVQRFEEKIT
FT                   KSQQEWNDKLSQMVSEKPEQQNQNQSVKLAGIRSDMKSHGSDFLIAFLMTLMVLGIILI
FT                   VSYFFTL"
FT   gene            302914..303201
FT                   /locus_tag="Tlet_0284"
FT   CDS_pept        302914..303201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32854"
FT                   /db_xref="GOA:A8F3X0"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X0"
FT                   /protein_id="ABV32854.1"
FT                   /translation="MRYGFLVLDMVIGLLLIAIVMVIAFSTISHQRFLIKRAFEMDLAN
FT                   RTAMNIFVRIVTNSEIPETSNGFQINVLSDKIILESSTKIYVYQIGDDDG"
FT   gene            303198..304103
FT                   /locus_tag="Tlet_0285"
FT   CDS_pept        303198..304103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0285"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tma:TM0243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32855"
FT                   /db_xref="GOA:A8F3X1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X1"
FT                   /protein_id="ABV32855.1"
FT                   /translation="MILRASVGTLSKLNISKSMFPPDLKTAYLMLDGKCRFNCLYCSHA
FT                   ISSISPQRFLSRVTWPLIDKDVLIEKISHSDFERICIQTVSYKGYQDDLRLLLKDIVPL
FT                   GKKVSISVRAENIKEIEDYFNLGVDRIGIAVDVVNEKLFSKIRGGNFKFTLSLIERSAK
FT                   LFPKKISTHIIVGLGENDSDLLKIMIHFYELGVEVGLFAFTPLNGTPLQDLERPPIERY
FT                   RRIQIARYLIFTGRKELVFLDQGIIRFRCIPDDAIKAFLTSGCPGCSRPYYNDRPGKSL
FT                   YNVHSEKLLLSMDLSREVKW"
FT   gene            304100..305413
FT                   /locus_tag="Tlet_0286"
FT   CDS_pept        304100..305413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0286"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; Respiratory-chain NADH dehydrogenase domain
FT                   51 kDa subunit; KEGG: tma:TM0244 electron transport complex
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32856"
FT                   /db_xref="GOA:A8F3X2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X2"
FT                   /protein_id="ABV32856.1"
FT                   /translation="MKLLTFRGGIHPPEKKELARESQIIRLDPPKIAYVFLANHAGAPA
FT                   KCVVEENQHVRTGQVIGEPAGFISGYVHSPVTGIVKKIDKVYHPLQGKPMEAVVIERTS
FT                   EDDWEYLDHKDWEKLSREELLEVVKKAGIVGLGGAMFPTHVKLNPPKDKKIDTLIINAA
FT                   ECEPYLTIDHRLMLEKAEDFIEGIRIVMKILQVQKSFVGVESNKLDAYKHLKSIVGSEE
FT                   IEVKLLKTKYPQGAEKQLIYAITGRKVPVGGLPMDVGVVVQNVQTVIAIKHAVVDRKPL
FT                   VERGLTVSGEGINKPANVIARIGTTVNQLIELAGGLKEEAERVILGGPMTGIAINRLDI
FT                   PILKGTSGITVLLKEKQPVQKNCIRCTKCVVACPMGLQPYLLYLLSNKRKYDEAVSEGL
FT                   MSCIECGACAYICPSKIDHVRAIKLAKKVYQALRGGRK"
FT   gene            305410..306384
FT                   /locus_tag="Tlet_0287"
FT   CDS_pept        305410..306384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0287"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   tma:TM0245 Na-translocating NADH-quinone reductase, Nqr2
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32857"
FT                   /db_xref="GOA:A8F3X3"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X3"
FT                   /protein_id="ABV32857.1"
FT                   /translation="MKLLVKDAPHIRSNDSVRKIMIDVLIALLPAVIGAAIFFGWYALF
FT                   LCAIGAVVAELVEWFIVRVLRKQKDFMPDLSAAVTGLLLAMNLPPTAPWWLLLIGILVA
FT                   ISVAKQAFGGIGQNIFNPALVGRVFLLISFPTLMTRWINPVQFFSTTPWDAISSATPLG
FT                   ILKQQGFSKAISAFSYTDLFLGNIGGCIGETSTLLLIIGFLYLWYRGRVNPVIPASYIG
FT                   TVFLFASVMYFVNPEKFGSPLFHILTGGLFLGALFMATDMVTSPMTLRGQAIFGLGCGI
FT                   TTMVIRYFAGYPEGVSLAILLMNAVTPLIDRAFKPRVFGEVKS"
FT   gene            306381..307052
FT                   /locus_tag="Tlet_0288"
FT   CDS_pept        306381..307052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0288"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; KEGG: tma:TM0246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32858"
FT                   /db_xref="GOA:A8F3X4"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X4"
FT                   /protein_id="ABV32858.1"
FT                   /translation="MKEYLKMGVVLLIYCAVAGLALGLVYTLTKDRISLTELQQKINAI
FT                   EKVLKDENGQYIVPIEEVKRQISRSGPVSNVIYEDSNGKVYSPVYKFESELGTVYVLSG
FT                   SAIGYGGSVTIVASFVEKQEGLMLFSIRVTDFSQETPGLGARIGEEEIQKRFYPMEPSA
FT                   LENSVRVDKDANMTGLSVEEARQKGIAKVSDVMTGATITPRAVANAINAMLSYLKSGVK
FT                   Q"
FT   sig_peptide     306381..306452
FT                   /locus_tag="Tlet_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.701 at
FT                   residue 24"
FT   gene            307049..307657
FT                   /locus_tag="Tlet_0289"
FT   CDS_pept        307049..307657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0289"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   tma:TM0247 Na-translocating NADH-quinone reductase, Nqr4
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32859"
FT                   /db_xref="GOA:A8F3X5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X5"
FT                   /protein_id="ABV32859.1"
FT                   /translation="MSAIKEFTKGFFKENPTYVQVLGMCPTLAVTTSAMNGLGMGIAAT
FT                   SVLTMSNIVISLIRKNVPKNLRIPIFITVIATFVTMIDLVMHAFTYDLWKTLGLFIPLI
FT                   VVNCIIMGRAEAFASKNGVWTSFLDGLGVGLGFTGSLVLLGSIRELFGNGTIFGINIWG
FT                   KAFNVFVMILPPGAYMTLGLLAALFAFIGLKKKQRGEKK"
FT   gene            307654..308229
FT                   /locus_tag="Tlet_0290"
FT   CDS_pept        307654..308229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0290"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   A subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   tma:TM0248 Na-translocating NADH-quinone reductase, Nqr5
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32860"
FT                   /db_xref="GOA:A8F3X6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X6"
FT                   /protein_id="ABV32860.1"
FT                   /translation="MRIFLILFSALLVNNYVFIRFLGICPFLGVSKKMDTAVGMGFAAT
FT                   FVLVMSSVITWIINKLLIALQLQFLQTVTFILVIATFVQFVEFFLKKNSPSLYEALGIY
FT                   LPLITTNCIILGVAILNAQTNYTLLESVFHALGAGLGFLLALVIFAGIRERLDLYDLPK
FT                   SFEGLPIALILASIISMAFMGFQGLIKM"
FT   gene            308240..308527
FT                   /locus_tag="Tlet_0291"
FT   CDS_pept        308240..308527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0291"
FT                   /product="Fe-S cluster domain protein"
FT                   /note="PFAM: Fe-S cluster domain protein; KEGG: tma:TM0249
FT                   RnfB-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32861"
FT                   /db_xref="GOA:A8F3X7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X7"
FT                   /protein_id="ABV32861.1"
FT                   /translation="MVIVYSTLLMAVLGLAFGTFLAYSAKKFEVKEDPRVEMIKQILPG
FT                   ANCGACGYAGCEAYAKAVVAGKATFDMCIPGRPSGVSEKIREIMEKNAPN"
FT   sig_peptide     308240..308314
FT                   /locus_tag="Tlet_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.888 at
FT                   residue 25"
FT   gene            308514..309533
FT                   /locus_tag="Tlet_0292"
FT   CDS_pept        308514..309533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0292"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: tma:TM0250 DNA processing chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32862"
FT                   /db_xref="GOA:A8F3X8"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3X8"
FT                   /protein_id="ABV32862.1"
FT                   /translation="MHPIEIFALSYFGKFSIEEIQKIKETYNSVSEILKSDFFQGNERF
FT                   KAHYDEGFIQQQLKKIENFNVKLVDFWSEDYPELLKWTHSPPAVLFCLGNIQFLKDSRT
FT                   VAVVGTRKATGYGIDVTKKMVTDLSRAGFVTVSGMAFGIDSSAHSTALNVGGKTVAVLG
FT                   TGVDVCYPVSNKDIYEVILKNGCLVSEYPLGTKAAKQNFPARNRIIAGLCRATVVVEAP
FT                   LNSGALITAKIAAEIGRDVFSVPGDIDRKTSEGCNWLIKMGATPLTHVDQIFEYYGVEF
FT                   KKEELSDNFISLFDSGPLLAEEVAERLKMDLSEVLSKLTEYELRGMISKTQSGHYNRV"
FT   gene            309547..310764
FT                   /locus_tag="Tlet_0293"
FT   CDS_pept        309547..310764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0293"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: tma:TM0274 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32863"
FT                   /db_xref="GOA:A8F3X9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F3X9"
FT                   /protein_id="ABV32863.1"
FT                   /translation="MKILVVNCGSSSVKYQFIDMKGEKVLCKGLAERVGIEGSRLVHKV
FT                   NEDKHVIEKPMKDHEEALKLILETLLDREIGVIRDLSEISAVGHRVVHGAERFASSILI
FT                   DEEVMKVLEENIHLAPLHNPPNIMGIKAVQKLLPQVPNVGVFDTAFHQSMPRKAFLYPL
FT                   PYEFYEKYRIRRYGFHGTSHRYVSKRAAEILGRDYYDFKVITCHLGNGASIAAIRHGKS
FT                   IDTSMGFTPLEGLVMGTRSGDIDPAIVIYMQQNLSIPVEEVYNILNKKSGVLGLSKLSS
FT                   DMRDIEDAAESGNEMAQLALEIYIYRIAKYIGAYTAAMNGVDAIVFTAGVGENSPYVRE
FT                   KVCDYLGFLGVKIDRNLNNMKGVERIVSTPDSRVAILIVPTNEELVIARDTKQIVESGI
FT                   KELKLF"
FT   gene            complement(310751..311437)
FT                   /locus_tag="Tlet_0294"
FT   CDS_pept        complement(310751..311437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0294"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: tma:TM0691
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32864"
FT                   /db_xref="GOA:A8F3Y0"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y0"
FT                   /protein_id="ABV32864.1"
FT                   /translation="MENLNFENRFDPDILNSIFSPSSSDFYRITHATTLLAWYSKPKKD
FT                   QRKVIELGCATGVVCAYIASKYNRYVVGIDKDPDLIHLAQRTIQMNNLYGKVDLVNISC
FT                   KDVSKFFAAESFDMVISNPPHHITGVPSPNEKRRQTRTADFETVREFVEAAAYLLKNRG
FT                   EFVFVLSPTHLIFWINEFLRKKMQPKKILPVYGSSRRDAVLILMRGTKNGGIGFSLEPP
FT                   IILKRV"
FT   gene            complement(311412..312986)
FT                   /locus_tag="Tlet_0295"
FT   CDS_pept        complement(311412..312986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32865"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y1"
FT                   /protein_id="ABV32865.1"
FT                   /translation="MNKFILIFILFCSVLFAKVNYYFENSQLIIKGLEMYDQIKVTVNE
FT                   TSFTVNSGEIKIPWQKYLNIPIEISPLSDTTKKIVLNIDASKDLPPKIDFIISGYYVTA
FT                   DRLSFPIKISDDWDELDKLTMRFFLDGNQTELVKVKDGFLEIDNFFIHSGEHALRIVCK
FT                   DSNSNVTDKTYRFFVVPHLPSPPAVNGNNIISSRTHRAYWIENGELYFEDSKSNSLKKD
FT                   MAFICDVDGAGNESFPSLLYQTKINNQISPGNIITLNSGILANGEYTVFGKIVIPSGET
FT                   VLIKSGGVLRIPAGCEIAIKGNLIAESGSKILGQGKLIITDEGKLILNNSKIEVQIVIS
FT                   GASMFWGSNLDLSRSYLEVNRSLAISLKNVKAKQITFTNVRKLWINSCEISQLTLKHIS
FT                   SFLINDSKINRINVSDFSKGKIYSTSFYSEDTALSLENFSFVQMIDSWLSAKKCVQIQD
FT                   YSVMRVRSTQFNADTGVVLSGYSIFDSFACMISASIAIQLRDSRATLLKTELLGEVVKI
FT                   GKSEFRK"
FT   sig_peptide     complement(312933..312986)
FT                   /locus_tag="Tlet_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.980 at
FT                   residue 18"
FT   gene            complement(312979..314706)
FT                   /locus_tag="Tlet_0296"
FT   CDS_pept        complement(312979..314706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0296"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: tma:TM1256
FT                   ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32866"
FT                   /db_xref="GOA:A8F3Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y2"
FT                   /protein_id="ABV32866.1"
FT                   /translation="MIKQFLRKYWYRYALGILVLIFVDLFQLFIPRIVGQVVDHLKTQP
FT                   NLDYVSTMVAWIVGIAIGMAILRFLWRFFIIGTSRRFEYMTRNFLFEKLLSLSTGYFDQ
FT                   NRSGDLMAKLTNDLQAVRMALAQGVVLSVDASFMAVMTILFMGRVVSWRLTSLASIPLP
FT                   ALALIALFFGKLIHKRFMSVQRQYSSLSEWTEETISGVRIVKSFAANDKIHYLFNKRSF
FT                   QNYEAAMSLAKVASLFFPLMMLFASISHVLALGFGGPMVIKGDVTLGEFIAFNSYLGML
FT                   TWPMMALGWVLNVIQRGRASYKRLMEIVQEKPQVEEPEAPVEIKEINTVEYKNLTYRYP
FT                   GTDRWVLKNVSFSFSRGDMIGIVGTVGSGKSTIVKLLAKLYPVERGKIFINRVDINDIS
FT                   SVNIRQLIAFVPQESFLFSDSVLKNIAFAQKDIDFKKAVHYAELASVHDEIESFDHGYD
FT                   TVVGERGVTLSGGQKQRVTIARALYMEKDLIVFDDCLSAVDPETEEKIITALRENYREK
FT                   TMIVITHRLKVLKDADLIIVLDDGKLIEKGRHEELMALNGMYARMFRKQMIEEELESE"
FT   gene            complement(314712..315851)
FT                   /locus_tag="Tlet_0297"
FT   CDS_pept        complement(314712..315851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0297"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tma:TM1255 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32867"
FT                   /db_xref="GOA:A8F3Y3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y3"
FT                   /protein_id="ABV32867.1"
FT                   /translation="MNLSKNVSAMPVSKTLEINAIASNLKKNGVDVVNLTAGEPDFPTP
FT                   EPIVEAAIEAMKKNLTKYTDSSGIPELREKIAYHISKKYCLNCSADQIVVSNGGKQAIF
FT                   NTLAAVLSEGDEVIIIDPCWVSYEPMVLLLSAKAIHVKAKIEDGFSPKIDEIEKAISSK
FT                   TKAIIINTPNNPTGAVYSEETLSKIYELAKRHDLLIISDEVYETLTYYQEHISMLKISK
FT                   GDRTVLINGFSKSHSMTGWRIGYLMAPVQIAKAAGKVQAHITSNINTITQYAALKAFDV
FT                   DVSYMRKRFKERRELVCSLLSEIGVKYFEPKGAFYVMIDVSEFGKNDIDFCKELLNDYH
FT                   VALVPGSAFNAPGFARLSFATSEETLKKGIERIKKFAGR"
FT   gene            315920..316633
FT                   /locus_tag="Tlet_0298"
FT   CDS_pept        315920..316633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM1656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32868"
FT                   /db_xref="GOA:A8F3Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y4"
FT                   /protein_id="ABV32868.1"
FT                   /translation="MPNFEQLFAHSSDYILLMLETWYIVIPISAFLIFAAKHVEKVSVS
FT                   LFGFLLGGFVLFPVLVDRFEAFRQWISTSEVNQYIAFFVISVLCAIVLYVLFRVFIFLV
FT                   GFLATMGMVYYVVDFVVKRFELLANMNQFVQENWFMILLAVSAGCGIIGGLLATNRSSS
FT                   VVAVLSLLAGSAALSVEIVGWSYLFATQDKQKVSELFSKPAALAVFIVITAVLFVAGLY
FT                   FNFSRGKKRQENKPQ"
FT   gene            complement(316642..317307)
FT                   /locus_tag="Tlet_0299"
FT   CDS_pept        complement(316642..317307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32869"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y5"
FT                   /protein_id="ABV32869.1"
FT                   /translation="MHIKKVLAVIFLFLSAVVFADILISNLEVAINLAKIEHKKLAIIF
FT                   TTSSCPYCAKLKNETLTDETVRRLISANYVFAEAMFDYSRKTTAFGKEMTYSELFTKFQ
FT                   VNSVPMIWFFTQQATPIAYLPGYVDAQIFAKILRYVYQDIKEDFQQYIAKNDDFAGNPM
FT                   ILAVSPDEAEYVLKNDQNSIYIEDFPGEIDLYKIYITPDKNLAEKLVQNGVFRVLLVK"
FT   sig_peptide     complement(317245..317307)
FT                   /locus_tag="Tlet_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(317323..317973)
FT                   /locus_tag="Tlet_0300"
FT   CDS_pept        complement(317323..317973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0300"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: tma:TM1141 cytochrome C-type biogenesis
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32870"
FT                   /db_xref="GOA:A8F3Y6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y6"
FT                   /protein_id="ABV32870.1"
FT                   /translation="MGISVTQVDFITALTHGIISFFSPCVLPLIPAFIALILSEKGVKA
FT                   FARIAGFLLGLSATFSLLGALSGLIGFLTNREITRYIAGSLIILMAIFFLMQIQLVKIK
FT                   SFNFYRFKSGGFLSGIIIGIGIGLVWIPCASPVLASMLIIASAQGTMLKGSFLLFIYSL
FT                   GISIPFLTIGSVISRVFSKISFSTPKWERFFRYLASAILVTIGLLIVTGKAFI"
FT   gene            318114..319328
FT                   /locus_tag="Tlet_0301"
FT   CDS_pept        318114..319328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0301"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: tma:TM1729 outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32871"
FT                   /db_xref="GOA:A8F3Y7"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y7"
FT                   /protein_id="ABV32871.1"
FT                   /translation="MKKVFLAILLLLSAFLYATTFSDVPVNHWAYEAVTELSKLGIVSG
FT                   MPDGTYQGNNPMTRYQVAVALKKLLDYLTQQVEKAVSPADLQNAIKRISVIEDLVSTTL
FT                   TKVQKNSEQISASDQSLQTVLAEISNLKTTVVEIAQVKKDMPTMIAASENKMMTMYNQL
FT                   SAKVSSVEKTISDLQSQISSQVMAQLKDSINSINANVASIEGKVNSLSGKVEALASSDD
FT                   SIKADLTSLSKRVDAAENNLQILSTLRKSFTDLEARVASLETKLATDVDSLKKAISTTA
FT                   NQLDARLSLVEGQLASLVTDVEKLKKDVADASQAAKKVSVLEGNVGTVAGQVVSLNQKV
FT                   SQNEQNIASLKKTVDSKPWQGDIEASTVQFSKKYDEVYNMAMIGVIAGAAGAIVGLIGL
FT                   LVGMQ"
FT   sig_peptide     318114..318170
FT                   /locus_tag="Tlet_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 19"
FT   gene            319448..320710
FT                   /locus_tag="Tlet_0302"
FT   CDS_pept        319448..320710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32872"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y8"
FT                   /protein_id="ABV32872.1"
FT                   /translation="MREKFVFLFLSLACLCLSFTFKFDGWFEYDFDQPTDSTKYSVMIP
FT                   FMGTYFTASGGFRRDNIVIPPYADVLMNNYWYWDEGFFSWSNNVFTFEVGVKENHAGPG
FT                   QVYQLFVSENGFSYPSIHSVAEIGKFRVETLWGGIRVLKTDIKPVKAFNYRALVYTPFD
FT                   GFEIAYEDSILYLDRFFDPYYFFVPIPVPGIQEFWHLSAPWGYSSYELNDNSMVGAWIK
FT                   YYRENYSFYSEILIDDINMNRFLAPDSPYQNPDKIAFLAGFTGKSGPVKLTFEVAGATA
FT                   FTFQRTTDDPYEYTYFEDSQFPVEKNMIGYKHGENNIACTIKFEYESDSWSYSAEYEGL
FT                   IYGDRTPDIPWHGKWSSVPYGTYWLTGDVQSEFSLRMRIAYQFKNLLPGVEKAETGFSA
FT                   GFYGGNPFVGFDLSIALNIND"
FT   sig_peptide     319448..319516
FT                   /locus_tag="Tlet_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.757 at
FT                   residue 23"
FT   gene            320723..321790
FT                   /locus_tag="Tlet_0303"
FT   CDS_pept        320723..321790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0303"
FT                   /product="glucose-1-phosphate thymidyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: tma:TM0862
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32873"
FT                   /db_xref="GOA:A8F3Y9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Y9"
FT                   /protein_id="ABV32873.1"
FT                   /translation="MKGLVLCAGKGTRLRPLTYTTAKHLIPVANRPVVYYTLDFMKNAG
FT                   IREIAIVVSPENKMLFEEVLKDGKDLELNIEYIVQDQPKGIAHAVYQARNFIDEDPFLM
FT                   VLGDNLVFEDIKSVVEEFNTLKSDAVVLLARVSDPRAYGVAVLEGNKVKYVVEKPQNPP
FT                   SNLAIVGVYMFRPAVFRAIENIKPSWRGELEITDAIGYLIQNGHSVKAHIIKGWWKDTG
FT                   KPEDLLEANRKILDNIKEECCKGKVDENSVIQGRVSIKQKTIVVGSVIRGPVVIGENCK
FT                   IINSYVGPYTAIGDNVTLESCEIENSILMDQSVVTNLSGRIDSSILGKGVRVFQNGKIP
FT                   KAMRLIVGDLGQIQF"
FT   gene            321806..322771
FT                   /locus_tag="Tlet_0304"
FT   CDS_pept        321806..322771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0304"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   tma:TM1187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32874"
FT                   /db_xref="GOA:A8F3Z0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z0"
FT                   /protein_id="ABV32874.1"
FT                   /translation="MKDGILVLFYLILFLLLTKLSPFIMTALMLGVYLSIIVDFVARFF
FT                   ARFLHGKISRILANVTVLGVIAYSIGNFFPVIINEAKKVFSEIEKIQITFEDVSIPDWI
FT                   LSFLTNLGKSFSDIALTIVNKLLGYVPSLITALVIVVITTLIVGNLKKVVSKKLDKLFP
FT                   ENPEKGIYFAKTTYREFERFVAGQVLVAAFVGFFVGVMSLIFKIPSAIFLGVLAFITDF
FT                   IPYLGVIISAIPLLMLGFASHGLKGLIIGVLILLSANQLEMWFLAPKIQSNALKIHWFF
FT                   ILIAILLFGDVIGFGGIFVALPTLIYVKNFWNQYVSKSPH"
FT   gene            complement(322786..323682)
FT                   /locus_tag="Tlet_0305"
FT   CDS_pept        complement(322786..323682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0305"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: tma:TM0861
FT                   protein-export membrane protein SecF, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32875"
FT                   /db_xref="GOA:A8F3Z1"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z1"
FT                   /protein_id="ABV32875.1"
FT                   /translation="MKKMDFVGKRKFFIIISTILIVASVISMLAKGFNFGVEFTGGSEI
FT                   ILRVESNSFSESDVRTILQNISSDFEAARVTRVRSVGDPEGITKFSITLSKTFETEEKA
FT                   KVQSSIEQQISTVGVKGQVISFNETGGSAAEEIRRLTWRSILITLAAVLVYITLRFNFV
FT                   FGIGATIALIHDVLITLGIFSFTGYELNVPAVAAFLTLIGYSLNDTIVVYDRIRENMKK
FT                   FKGKEISSLVNESINQVFRRTLNTSLTTFFVVFILFLFAGNAIKPFAFGMTIGVVVGTY
FT                   SSIYIASPLVIKWVKSR"
FT   sig_peptide     complement(323584..323682)
FT                   /locus_tag="Tlet_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.713 at
FT                   residue 33"
FT   gene            complement(323679..325103)
FT                   /locus_tag="Tlet_0306"
FT   CDS_pept        complement(323679..325103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0306"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG: tma:TM0860
FT                   protein-export membrane protein SecD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32876"
FT                   /db_xref="GOA:A8F3Z2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z2"
FT                   /protein_id="ABV32876.1"
FT                   /translation="MRTDRIRLVIVIVAIFGAFLALLWPSEEQTYRGLAAIFQRIPLGL
FT                   DIKGGARLEYRVDIDENVENPSEVIDDVWTVLRNRLDAAGYTEATVRKTFRENNSFIVV
FT                   EIPAATDTTRAEKLLGSTGLMYFGQVIDESQIDPQNDPRLKDLAKLKKAEWLPSRDGKI
FT                   WYLVRTEVMLVKDLKLVSPQIVSASPVPETRVGRFGYKVTFELSSKDSEIFKKITQQLV
FT                   VPESAIGSSSSKEKRLAIVLDDVVQFAGYVISVIPDGKAEITGNFSLEEAKQLAAILRS
FT                   GALPARLEKISAGWVAPLLGSDIVKTSLWAGIIGLFVVLIYMIFTYGVQGIIADIALVY
FT                   NTFLLLGVLAATHSILTLPGIAGIIFTIGTTVDGNIIIAERVREELKSGKSVKAAISSA
FT                   FGRCFITLFDANLTTIIAGLALYYFGTGTVKGFAITLIIGVLGSFFVNIVLSRLLTDAL
FT                   SSFIRKPAVEERGAQS"
FT   sig_peptide     complement(325032..325103)
FT                   /locus_tag="Tlet_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.613 at
FT                   residue 24"
FT   gene            complement(325125..325496)
FT                   /locus_tag="Tlet_0307"
FT   CDS_pept        complement(325125..325496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0307"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: tma:TM0859 preprotein
FT                   translocase YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32877"
FT                   /db_xref="GOA:A8F3Z3"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z3"
FT                   /protein_id="ABV32877.1"
FT                   /translation="MNIIYSAAPGATGSAPSATTTATGSGWSFIILLAMLFAMFYFLII
FT                   LPQRRREKQFKEMVSNMKRGDTVITVGGIVGKVIDIKKDTIKIKTSMTTELEVTKRAIA
FT                   TVLKEKEESKEQQEEKDKE"
FT   sig_peptide     complement(325428..325496)
FT                   /locus_tag="Tlet_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.386 at
FT                   residue 23"
FT   gene            complement(325512..325997)
FT                   /locus_tag="Tlet_0308"
FT   CDS_pept        complement(325512..325997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32878"
FT                   /db_xref="GOA:A8F3Z4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z4"
FT                   /protein_id="ABV32878.1"
FT                   /translation="MTRKIVYILLWLSMSVAILYFTHLTGFETIDRVILPVYFIVILAT
FT                   LIHGAFVGIIVGTLSPVLSFFATRIPSESFIFIRAIELVILAIFCFVWMKKVKNLRLVI
FT                   MLTFFSTRIVLFLVEFTQFSLYTVFKDTLYGLIGLGLQLFFIPTIYRILVKSIEIEN"
FT   gene            complement(326011..327150)
FT                   /locus_tag="Tlet_0309"
FT   CDS_pept        complement(326011..327150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0309"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   drm:Dred_1730 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32879"
FT                   /db_xref="GOA:A8F3Z5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z5"
FT                   /protein_id="ABV32879.1"
FT                   /translation="MKNEYRVVVVGGGIIGCSVAYHLAKFGETDVAVFEKDFISSGSTG
FT                   RCAGGIRQQWSSPHNVILAMRSVSLFEKLSGETATDIEYKQGGYLVLSYSEDEAREFEK
FT                   NVRMQRELGLDVEILTPKQIKERYPYLNTEGVKLATFCQKDGHANPHLANFAYARAARK
FT                   MGVHLFTHTKVVGIEFHRSSFIIHTNRGTVKTRFVVNAAGSYSRDVGKMVNIDLPTESY
FT                   RHQIMVTEAVRNFLDPMVISFSGNFYIRQSKHGQFIMGQGDADEKPGINYDVTFKFEKD
FT                   MVQKMMNIFPPFGNLRIIRHWSGHYNMSPDAQPIIGQSSAVPGFYYAVGFSGHGFMLAP
FT                   AVGEAIAQMMLHGKSIHVDISELDIDRFKKGVLREKNVV"
FT   gene            complement(327140..329244)
FT                   /pseudo
FT                   /locus_tag="Tlet_0310"
FT                   /note="BFD domain protein (2Fe-2S)-binding domain protein;
FT                   ferredoxin"
FT   gene            complement(329274..330629)
FT                   /locus_tag="Tlet_0312"
FT   CDS_pept        complement(329274..330629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0312"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   fumarate reductase/succinate dehydrogenase flavoprotein
FT                   domain protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; FAD dependent
FT                   oxidoreductase; KEGG: tma:TM0381 dihydrolipoamide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32880"
FT                   /db_xref="GOA:A8F3Z6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z6"
FT                   /protein_id="ABV32880.1"
FT                   /translation="MYDAVVIGAGPGGYVAAIKLAQRGKKVAVVEKSFVGGTCTNWGCI
FT                   PTKALLSSVHLYSEITEKGKQLGINVEKISYDFSAMKAHMNKTVMMSRKGIEYLFKKYG
FT                   VELINGTATVESTSVVKTSDKKLETHNIILATGSVPTLIPPFDQIPGIWTSDDVFKMEK
FT                   LPESILIVGGGVIGIEFATFFSTLKIPVTVVELMDHILPGEDKDVAETISKSLKKKGVE
FT                   IYESSRITSVEPDSDAFKCIIETKQGTVEKIVQKVLVSVGRKPNIPKDIEKIGVNVQRG
FT                   IKTNNKMQTSVPNIYAIGDVRGQIMLAHVAMYEAVVAARNICGEDVHMEYSAVPSVIFS
FT                   NPEVAVVGIREKEIDPSKIKVFSFPVSANGRARTILERDGFVKVIADKNSLKVLGMAIV
FT                   GPSSTDMIMEGVVAVKFGLKANELEESIHPHPTLTETVLGALEGIVEMPIHL"
FT   gene            330782..331252
FT                   /locus_tag="Tlet_0313"
FT   CDS_pept        330782..331252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0313"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; PFAM: MGS domain
FT                   protein; KEGG: tma:TM1185 methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32881"
FT                   /db_xref="GOA:A8F3Z7"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z7"
FT                   /protein_id="ABV32881.1"
FT                   /translation="MEKRIRLGKKKRICLVAHDRRKKDLIEWVQFNRGTLSKHELYATG
FT                   TTGSLIEEKTGLKVNRFKSGPLGGDQQIGAKIAEGQIDMLIFFWDPLEPLAHDVDIKAL
FT                   LRIATVYNIPVAITRSSADFLISSPLFEKEYEKIEQDYEAELIERIKRIVHQ"
FT   gene            complement(331558..332592)
FT                   /locus_tag="Tlet_0314"
FT   CDS_pept        complement(331558..332592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0314"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; NmrA family protein; Male
FT                   sterility domain; KEGG: deh:cbdb_A1667 putative
FT                   dihydroflavonol 4-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32882"
FT                   /db_xref="GOA:A8F3Z8"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z8"
FT                   /protein_id="ABV32882.1"
FT                   /translation="MILVTGSTGHLGNVLVRFLVARGYSVKAMVAPFEDTKPIENLPLQ
FT                   IVQGDIRDHDFVVNSSKDVEAVFHLAATISILGKKKTVYDVNVNGTKNVISACIKNKIG
FT                   KLVYVSSIHAFSDQKPGSLIDESIPIDPKKVKGDYAKSKAMATLEVLKASKEAIDTVVI
FT                   CPTGIIGPYDWRISEMGKLLILYSKGLLKVGVDGSFDFVDVRDVANVLISAYEKNEWGE
FT                   IFIASGHHTTVRALIQMLEKIRKKRSVNVFLSKYIAYPISLLTALYYFAAKKRPLLTPY
FT                   SVYTLSRNYIYSNKKASEKLGYNPRNLQESLKDAIQWFEDNGYLKPANGNLRKNTRMHL
FT                   SLDK"
FT   gene            complement(332589..333026)
FT                   /locus_tag="Tlet_0315"
FT   CDS_pept        complement(332589..333026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0315"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; helix-turn-helix HxlR
FT                   type; KEGG: tma:TM0816 transcriptional regulator, putative,
FT                   Mar family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32883"
FT                   /db_xref="GOA:A8F3Z9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F3Z9"
FT                   /protein_id="ABV32883.1"
FT                   /translation="MDLDSEKIMKSVFDLVLAFSKMLNFNSEVENLRAIELYVLLYVAQ
FT                   KGPQKMSELAEVFSMTKSNITFLVDNLEKNGFVERERSNEDRRVIYIRLTDRGRDIYRQ
FT                   ILDDFAKLIDKVASQIPEQDLLIISDGFERLSRLFRTGGER"
FT   gene            complement(333177..333268)
FT                   /gene="ffs"
FT                   /locus_tag="Tlet_R0005"
FT   misc_RNA        complement(333177..333268)
FT                   /gene="ffs"
FT                   /locus_tag="Tlet_R0005"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            333556..333999
FT                   /locus_tag="Tlet_0316"
FT   CDS_pept        333556..333999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0316"
FT                   /product="pyrimidine dimer DNA glycosylase"
FT                   /note="KEGG: eba:ebA6557 pyrimidine dimer DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32884"
FT                   /db_xref="UniProtKB/TrEMBL:A8F400"
FT                   /protein_id="ABV32884.1"
FT                   /translation="MRLWSIDFSYLDRKGLLGVWREALLAKAVLSFKTKGYRSHPQLER
FT                   FKNHPSPLKSINTYLYHVFQQAQKRNYNFDISKIDLSQVDTSIKLKVTKGQLKYEFQHL
FT                   LAKLRQRDHQKYLELLNVETVQPNQLFYVVDGDIESFERPNNR"
FT   gene            complement(334300..335919)
FT                   /locus_tag="Tlet_0317"
FT   CDS_pept        complement(334300..335919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0317"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: tma:TM0506 groEL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32885"
FT                   /db_xref="GOA:A8F401"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F401"
FT                   /protein_id="ABV32885.1"
FT                   /translation="MPKLLRFDEEARRSLEKGVNKVADAVRITLGPKGRNVVIEKSWGS
FT                   PTITNDGVSIAKEIELEDKFENLGAQLVKEVASKTNDVAGDGTTTATVLAQSMIREGLK
FT                   NVAAGSNPILLKRGIDKATEKAAKYIKDKAKKLSGREDIAHVAAISANSSEIGDLIAEA
FT                   MDKVGEDGVITVEDSKTLETYVEFTEGMQFDRGYISPYFVTDAEKMEVELKEPFILITD
FT                   KKLSAVKPLIPVLEKVAQTGKPILVIAEDVEGEALTTLVLNKLKGTLSACAVKAPGFGD
FT                   RRKAMLQDIAILTGGTVISDELGINLEDVAIEDLGRADIVRVKKDDTIIIGGKGNPEEI
FT                   KKRIAQIKSQIEQTTSEYEKETLQERMAKLAGGVAVIKVGAATETELKEKKHRIEDALS
FT                   ATRAAVEEGIVPGGGVTLIRSRKAVEDVLKELDGDEKVGAMIVYKALEAPIRQIAENAG
FT                   YDGAVIIEKILASKEESYGFDALKGEYTDMFKAGIIDPAKVTRSALQNAASIAGMLLTT
FT                   EVLVVEKPEEKKEAAPAMPPEY"
FT   gene            complement(335935..336204)
FT                   /locus_tag="Tlet_0318"
FT   CDS_pept        complement(335935..336204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0318"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: tma:TM0505 groES
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32886"
FT                   /db_xref="GOA:A8F402"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F402"
FT                   /protein_id="ABV32886.1"
FT                   /translation="MKVTPLGERLLIKPLKEEKKTEGGIVLPDSAKEKPMKAEVVAVGE
FT                   KVENIDVKVGDRVIFSKYAGTEIKIDDVDYIIIDANDILAKIEE"
FT   gene            336467..337327
FT                   /locus_tag="Tlet_0319"
FT   CDS_pept        336467..337327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0319"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   tma:TM0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32887"
FT                   /db_xref="GOA:A8F403"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A8F403"
FT                   /protein_id="ABV32887.1"
FT                   /translation="MNKPLLIREYILSSVGVFITAVGLVVFLIPNNIAAGGASGIAMIL
FT                   NAFIKLPVGVWMYIVNALLFLIALITIGFDFSLKTIYCTFLMTFLVDILDRFIKLPKYL
FT                   AGDMMLAVFFGDLLTAIGMAITFTQNASTGGTDIIARIFNRYYGASMGTTLLFIDFAVG
FT                   ILAGFTFDLRTGMYAILAIVINGLMIDFVMKGIETSTQVVVISDKNDIIADFVVNDLKR
FT                   GATFIDGQGVYTGKRRKILLVVLRRRELGELISFIRKTDKGSFIIVGEARYIFGEGFQN
FT                   IRNAF"
FT   gene            complement(337518..338531)
FT                   /locus_tag="Tlet_0320"
FT   CDS_pept        complement(337518..338531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0320"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   tma:TM1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32888"
FT                   /db_xref="GOA:A8F404"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A8F404"
FT                   /protein_id="ABV32888.1"
FT                   /translation="MKTKIFLGVILSLGASGLISFLVSGNQIISALEKMNLWYFLLACF
FT                   MYLLFLVLDSLRTKLLLSHAKINISYLKCFQNTLLGLYTSAVTPFSAGGQPFQIYHLNK
FT                   NGVPVEAASMTIGVKFISSFTLMVFSTFFLLLIRGKSLLTTVGSTLLVYSGLVLTSSIY
FT                   LFFLLLIFSKPFAQKIIMSRFFTRIVSILTKKDPKAVWKKAFDSLSNYFELLRGLWISS
FT                   KLIVLITVIITFFNIIITASLPYIISISFGLSEIDYLQFVCAFLTMSMVVYFVPTPGSS
FT                   GGIEGAFYLMFKNLSSSEFSVATMLIWRLITYYAILIIGSLSLSKMIFSSKQTKQL"
FT   sig_peptide     complement(338454..338531)
FT                   /locus_tag="Tlet_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.906 at
FT                   residue 26"
FT   gene            338679..339692
FT                   /locus_tag="Tlet_0321"
FT   CDS_pept        338679..339692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0321"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: tma:TM0588 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32889"
FT                   /db_xref="GOA:A8F405"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8F405"
FT                   /protein_id="ABV32889.1"
FT                   /translation="MNVRRDLGIDLGTANTLVYVKGKGIVLNEPSVVAINADTGEVLKV
FT                   GMEAKLMLGKTPASIIALRPLRDGVIADYDVALSMLKYFIGKAKSSITLFKPRVVIGVP
FT                   IGITDVERRAILEAGLEAGAARVFLIEEPMASAIGIDLDVEEPNGNMIVDIGGGTTEVA
FT                   VISLGSIVVWDSIRIAGDEMDEIIVQYVRETYRIAIGERTAEKIKIDIGNVFPCQEHDS
FT                   LETVVTGIDLSTGLPRRIVLRGAEVRDALMIPVATIVESIKSTLEKTPPELATDIVERG
FT                   IVATGGGSLIRGIDRLIEEETGIKVVRAEDPLTCVARGAGKVLEKIEILKKLQQVD"
FT   gene            339693..340352
FT                   /locus_tag="Tlet_0322"
FT   CDS_pept        339693..340352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F406"
FT                   /protein_id="ABV32890.1"
FT                   /translation="MHSRQISRLIALMFIFSLIFAIDILLSGNISAAVYSFSNLLTVGF
FT                   KKSRVFSIRVIEGVELSLKKESSQRIEISSHLFAEYTPVLGVRGYYILAAADAEEGDVA
FT                   VDPDSKRLVGVVKSSNAGISWVESIFSPNMTIQVTLASTDTEIDGELFAGNRVRIYENI
FT                   DVTGFDVRVSDVFTCGTLLNNLNFGYIGTIAGREGIYYIVDSKFTAPSRLVIFPGY"
FT   sig_peptide     339693..339791
FT                   /locus_tag="Tlet_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.723 at
FT                   residue 33"
FT   gene            complement(340312..341160)
FT                   /locus_tag="Tlet_0323"
FT   CDS_pept        complement(340312..341160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0323"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   tma:TM0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32891"
FT                   /db_xref="GOA:A8F407"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8F407"
FT                   /protein_id="ABV32891.1"
FT                   /translation="MNYLKQLLIVAFFLSGTIFAMNEYYVSAMNAYASGNYKQALEWFE
FT                   TAIQKEPSLESYDPFMKLKMGICAFATGDFQRARTYLRSYQGNATAEKILQLIDQENEP
FT                   TEEWMVWIRSKTPETTSLATPAKFTRSSTSVFLLVGIFVLSFSATFLVMYLLKHRFKII
FT                   KEKKEHSSEKSLEEVIESNINEIEKLVQEINPAEEEKYEQSDEELKKIEAQLDSIVQEI
FT                   LAKEKPKVPERQPISDENPFEILKKLEEKNNYDEEDAKVLSDLMQKIVSNQEKSQDEKE
FT                   L"
FT   sig_peptide     complement(341098..341160)
FT                   /locus_tag="Tlet_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.825 at
FT                   residue 21"
FT   gene            complement(341147..343465)
FT                   /locus_tag="Tlet_0324"
FT   CDS_pept        complement(341147..343465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32892"
FT                   /db_xref="GOA:A8F408"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F408"
FT                   /protein_id="ABV32892.1"
FT                   /translation="MKKILEVLKNLLKRKLLFIVLSGSLATIVIIFLVLSLINNESVIH
FT                   PDKQKDITAQALTISIPEGAFNKMKVLQIRKISPENLPGKLSSSFVSDVYDVSPGDGID
FT                   EFAMKPLTIKYRIPKNLYLGKEYANLKVAYVPDIEEPVYRTLGGAYIDIDNNGPYIEVE
FT                   AFHASKIGIIASVPEKQKTGLQLIKENSKSLEPILLLIPDIDRGFLGFIPNSARANVNI
FT                   WSEMFPNRTVMYYEYPIVNTKSKSYMDSYRQFSRVKGTNSFILYEAEKLATELQRLKNL
FT                   EFDIVAHGVGGIIARLAVEKHPEIKNVRKIVLISTPNKGTNIVNPIYFGTLLFGKPSEV
FT                   IASNFSMDRTIVDSIKSHLLFYLESLGPLYREISVSSTLLSSLSETRKDIAYLCVVGNS
FT                   PPMSIDVKSTPFESFYPELVKGSADGVVTKSSALIDGVESLVVEGSFFDCYISIQFQEK
FT                   LRAFLAYEPAKVPEYKTETYPEKIPNIQGREIVSVKNVDISTPDTFSITPVMKKTKNMP
FT                   FDGVIDILKVGSQVIYLRRDGIYSANGKLYEGNFIFPHATNSKMSFYANGNVMSYDGKT
FT                   FSKLATLQLPANCIDLISTDFGIFSLVKNEKLILYRWEEKWAKMLELDGEYGKFLNNQN
FT                   VILLTNKNIYELSSNGLKMLLSSSEINNQKISTDFTAFLSIENNAFVGLRSYALMVYDM
FT                   VNRKYALVAQGWIDPEFLCQSGEYLLICGRSSIMFLNPKTMTLRKEIQKFDGNITRALT
FT                   LGKEVYVLVDGRVEVYELP"
FT   sig_peptide     complement(343355..343465)
FT                   /locus_tag="Tlet_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.718 at
FT                   residue 37"
FT   gene            complement(343472..344302)
FT                   /locus_tag="Tlet_0325"
FT   CDS_pept        complement(343472..344302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0325"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: tma:TM0161
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32893"
FT                   /db_xref="GOA:A8F409"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A8F409"
FT                   /protein_id="ABV32893.1"
FT                   /translation="MNNEGFVKKLNEKMTRLINKSTMVEQAMAYSLLSAGKRIRPVLIK
FT                   LICEDMGVQEDLIWNPAMAVELFHTASLIHDDLPQIDDSPLRRGRPSCHVVFGNDMAIL
FT                   AGDGLMLMAFCVLNQTPADPVSKSMLFDLFSKSTYDVLIGEAMDVEFTGKEKDINDVIE
FT                   MYRKKTGALFSFCFAIGAILMKKLEYLEKLINVGSTFGVWFQIVDDLKDVSGKDENVGK
FT                   TTGRDKALGKPTVVNIMGIQEAKNFADNLYESVIVQLKSLSLNKVVDFLCALRE"
FT   gene            complement(344295..344849)
FT                   /locus_tag="Tlet_0326"
FT   CDS_pept        complement(344295..344849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0326"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; KEGG:
FT                   tma:TM0160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32894"
FT                   /db_xref="GOA:A8F410"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A8F410"
FT                   /protein_id="ABV32894.1"
FT                   /translation="MRRAWIKALVLDKAHNSPVVILGIEGTNKVVPIWIGACEANALAI
FT                   NLEGLEFPRPLTHDLIVNILDALDARLEKAIIHSVKDNVYHATLVIRDLTFVETEDEEG
FT                   SDEHALIEIDARPSDSIVLAVKKGVPIYVSNEIVEEHAIDLQIPEDSSDEEFKKFVESL
FT                   DIDKFREMLKDEPDEEGEEDE"
FT   gene            complement(344851..345585)
FT                   /locus_tag="Tlet_0327"
FT   CDS_pept        complement(344851..345585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0327"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /note="TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; KEGG: tma:TM1693
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32895"
FT                   /db_xref="GOA:A8F411"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A8F411"
FT                   /protein_id="ABV32895.1"
FT                   /translation="MKKLLVTIYFLIMAVLYVFVYGSIVLFAGFLIKIFAGEKVSRKFV
FT                   NGQIKLFGKNSFRWMFSSVIVHGEENIQPSCLVVANHQSLMDIPLILGYVGPMPMVAKK
FT                   ELAKVPGVNWFVKYMGGYFLDRSNPAEGAHILKELIKTLSSGKSLLIFPEGTRSVDGSV
FT                   GKFKTAIFKIAKKVHVKILPISIWGTIFLVPRRSLFLNPGRVAMLIHPPVNPEDFPNEE
FT                   ELARTIEETVRAGVEKLKQEVI"
FT   sig_peptide     complement(345499..345585)
FT                   /locus_tag="Tlet_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.280 at
FT                   residue 29"
FT   gene            complement(345602..346261)
FT                   /locus_tag="Tlet_0328"
FT   CDS_pept        complement(345602..346261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0328"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   smr:Smar_0789 UBA/ThiF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32896"
FT                   /db_xref="GOA:A8F412"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A8F412"
FT                   /protein_id="ABV32896.1"
FT                   /translation="MFQRHSELLKDCMQKLFKSTIFVAGAGGLGCTVLSLIVRIGVKNI
FT                   YLIDHGIVDEPDLNRQILYDRNDLGKSKVKVAGEKLKMINPECNLITIDKTLDEKFILP
FT                   AVDIVIDCLEGFRSKLILDDLCQRKSIPLVHAGVGKFSGQVMTLMYNGGPTLKELYRGA
FT                   VEEDKERQIFPPAVVLTAALQVSEMTKIICNKGDILNGKILQINLLQNHFDFLNLF"
FT   gene            complement(346263..346556)
FT                   /locus_tag="Tlet_0329"
FT   CDS_pept        complement(346263..346556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32897"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="UniProtKB/TrEMBL:A8F413"
FT                   /protein_id="ABV32897.1"
FT                   /translation="MKIRFGNMVDNLVGIKEIEVCGRSLDEIFKNLSSSLKKNVNLLID
FT                   EKRESVYLVVENDGKFLKNWVIALHNGVNLLDIDRDALQDGELVIFVPVSGG"
FT   gene            346600..347367
FT                   /locus_tag="Tlet_0330"
FT   CDS_pept        346600..347367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0330"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: tma:TM0795 sugar
FT                   kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32898"
FT                   /db_xref="GOA:A8F414"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8F414"
FT                   /protein_id="ABV32898.1"
FT                   /translation="MKIAVFGGTFWDVYIYGQQVHKAEVIEMCGGSGLNIAFGLWRLGF
FT                   DIEFFSNVGSDYRADLILEELRALGFKNNIRKIHGKTGLHIAYNDVPIAVNRGVNELDV
FT                   PVIQELLNDCDCVFLNGEIPSSCARKIIELCREKKIFVDVGPLANFDFDLKQAARDILV
FT                   IGNEKECSRINCDVVKLGPKGAVFGSIKISGDGRDYVYRTGCGDVFDVVLMANLLNNEK
FT                   ISVALNRAVKEAEKMARTVKGAFSKMKNLGEKA"
FT   gene            347364..348308
FT                   /locus_tag="Tlet_0331"
FT   CDS_pept        347364..348308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0331"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: tte:TTE1591 threonine dehydrogenase and related
FT                   Zn-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32899"
FT                   /db_xref="GOA:A8F415"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F415"
FT                   /protein_id="ABV32899.1"
FT                   /translation="MKALFYDGNLRLIQIDKPRMHKGFALVKILMAGICNTDLEILKGY
FT                   MNFSGILGHEFVGIVEKGPSALIGKRVVGEINIPCKKCDLCLEGLWRHCRNMRVLGING
FT                   YNGVFAQYALIPVENLHVLPHEIADEEAVFVEPLAAAFRITEQINFTGHEKIAVFGDGK
FT                   LGLVISKALNFSNIAHVLFGKHEEKLSLAKKWTDVEFADNIEKYDRHFDVVIDATGKQS
FT                   GLQQALYAVKPEGTIVLKTTVAGKISIDMSTATVNEVTIVGSRCGPFPKAIFALQNGLR
FT                   VVDLIEDVFDFDDYQKAFEKASGALKVILKIQD"
FT   gene            348354..348980
FT                   /locus_tag="Tlet_0332"
FT   CDS_pept        348354..348980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0332"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: tma:TM0169 AT-rich DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32900"
FT                   /db_xref="GOA:A8F416"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F416"
FT                   /protein_id="ABV32900.1"
FT                   /translation="MKIPKPTVKRLAIYYRCLERLVDKGIDNISSRQLAEMLHIKDTQV
FT                   RKDLSYFGNFGRRGFGYKTRVLLDEIRKILGIHKRWNVIIVGAGNIGKAIARFKQIEKH
FT                   NFKITGIFDVDRKKIGKRINSDLIVMSVDEMENFIEKTGSELAVIATPAEAAQLIADRL
FT                   KNSGIKGIICFAPVTLNTDIPVEYVDITIFFKTLVHSVISLSHNI"
FT   gene            349043..351562
FT                   /locus_tag="Tlet_0333"
FT   CDS_pept        349043..351562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0333"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; KEGG: tma:TM0118 ribonucleoside-diphosphate
FT                   reductase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32901"
FT                   /db_xref="GOA:A8F417"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A8F417"
FT                   /protein_id="ABV32901.1"
FT                   /translation="MYSDLIEKYKKIQPSQNAVRILTERYFIKTPAGEFIEKSWHDVAH
FT                   RVARVVASAELINNPALENLSKSEKLDYIKLLEKEFFDLLASRIFIPNSPTLFNSGMGV
FT                   DYELLYKPLEQMELDDYSKIIQMRNHLHMLSACFVVPVEDSIDGIFTAVKEYALITKAG
FT                   GGIGSNFSSLRPNGSFVAGTHGKASGPISFMHVFNSAVSVVEQGYRRRGALMGILNIDH
FT                   PDIMDFISAKKGNDGEKVLRFFNISVGIPMRREELLRIYERDGTIRLNHSKWHGEKEIK
FT                   VREIIQKMAQSAWETGDPGMVFLGEMNRYYALYPHKEIISTNPCGEIGLGAYEACNLGS
FT                   IDLAKLYTQNGVDWDALEKATRIAVRFLDNVIDVNVFPIDKISKAVKESRRLGLGIMGF
FT                   ADLLYKMDIPYDSEEARRLAKNIMAFMALHSHEESSKLGEEKGNFPLFEQSRYHTEDDF
FT                   VPFSMDESDYDEEIFEHFRNVAPKFKRNVAVLAIAPTGSISNIADTSSGLEPNFLLAYV
FT                   RYVNKQNSDEREPLFYVNEVLKQKLPEDLINSIKDKLVEDGTLKHLEIDEEIKRVFVVS
FT                   HDIKPIDHLLMQEAFQCYVDNNISKTINLPNSATVDDVVEVYIEALKHKIRGLTIYRDG
FT                   SLQTQVLTSTKSLKTKDAPKIQFFVLDEKHRLRAKPRKETLRSVTRKYKSSSGTTYITV
FT                   SFDDTGEAIEIFLSNGTETAEAIGRLSSTALRAGVSVDEIIEQLVKVKGDYVRNVGIEI
FT                   KKAIDDFAELWTEKNNVETEVMRIDGTAKTPEEVEKFVIANGLEWKQGYYVDIDGNTYC
FT                   PSCLSKNSLIMQEGCVSCKICGWSRCS"
FT   gene            complement(351583..352245)
FT                   /locus_tag="Tlet_0334"
FT   CDS_pept        complement(351583..352245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0334"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG: ana:alr2226
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32902"
FT                   /db_xref="GOA:A8F418"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F418"
FT                   /protein_id="ABV32902.1"
FT                   /translation="MDRTAEIVYKDLRKKIESGYYSQGTKLEDEKDLAEAYGVRRHTIR
FT                   LAIKKLAEEGVVKRIKGRGTFVAAEIQKKFLGLIENSWQFRVLKSALSNSREQYSLFSE
FT                   GSPVLNFEILWLEDDKPVCYEKCLVDVVKNPHILQLMNSQQKIHPVEYLSEKLSVQYIQ
FT                   EIYEIGKLTKSVSKHLQTDLKITIFRTIILKNQLDEVLALSILKYHPGVQIKQIRKV"
FT   gene            complement(352256..352588)
FT                   /locus_tag="Tlet_0335"
FT   CDS_pept        complement(352256..352588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32903"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:A8F419"
FT                   /protein_id="ABV32903.1"
FT                   /translation="MEKENFEVFVLTDENNVDHHFVLLAEIENSGKKYWVCEEIMVDEE
FT                   GQITDFGEIYPFEVKKDDTGNLFVDSIETEEEFDRVSEAWNNMLENDEKLRGMFNFEEH
FT                   GESEEE"
FT   gene            352800..353783
FT                   /locus_tag="Tlet_0336"
FT   CDS_pept        352800..353783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0336"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: tde:TDE0951
FT                   lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32904"
FT                   /db_xref="GOA:A8F420"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F420"
FT                   /protein_id="ABV32904.1"
FT                   /translation="MKKNLIIMLMILPLMVLSYDVALLITGEIGGNPIYEMMVDGAKRA
FT                   SRDFGFNLKVVEGGYNPAKWEPSLIALASTGSYDLIVTFTEGMPKSVEKAAKMFPKQKF
FT                   ALIDGIAPLSENVYSLGFKDEEMAYLAGYFAGLITTSNLPGANRELKVGLISGDIYPAM
FT                   IDRMKPAYEKGAKSVNQAIEVLFSVAGSWSDPGKGSELAQLQFSQGADIIFLVAGGTGI
FT                   GAIQKARELKKYVIGVDSNIISIAPGVILACVLKRADDAIYSVLKRAYEGKLPFGNYER
FT                   WGIEENVIDFTLDENYFTQFVSENIAEKMRQIFNSLKNGEIDPLEK"
FT   sig_peptide     352800..352856
FT                   /locus_tag="Tlet_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.861 at
FT                   residue 19"
FT   gene            353773..355278
FT                   /locus_tag="Tlet_0337"
FT   CDS_pept        353773..355278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0337"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cac:CAC0703 sugar ABC-transporter, ATP-ase component"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32905"
FT                   /db_xref="GOA:A8F421"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F421"
FT                   /protein_id="ABV32905.1"
FT                   /translation="MKSKVFVEMRGIFKTFFPSNTIALKGANFVLRAGKIHALLGENGA
FT                   GKTTLMKILCGLERMDSGEIFINGNPVQIKSPGDALHLKIAMVHQHLALIDDFTALENI
FT                   ILQKVPLKNLVFLDKNSAQKHVERLFSESKLEVNLNSKIKDLTMAERQKVEILRALYLG
FT                   AQLLIFDEPTTYLSEHEAENFYRLIKWLKQNGKTVVLITHDIKEACDISDEITVLRNGR
FT                   TVFSSSNKGVSHEKIAEMMVGRTKILLTKKEKKCGKVVLSVRNLSLPEETMVRNISFEI
FT                   SAGEIVGFAGLANSGVLDILEALIGLRKIANGEIIFFGENIEHKSVKERRKCGISYIPQ
FT                   NRTQVGVSADLSILENLLAIKYYEKNFTRFKYFLNYKTVENWARELLKKFDIQTKSVWQ
FT                   PVSTLSGGNIQRLLIARELSAVPKLLIASDPTAGLDVHSTAMVHKFLLNLRNDNVAVIL
FT                   YSSDLEELLKICDRIIVVKDGTLKDEFVVDENISKVKLFGVMA"
FT   gene            355440..356309
FT                   /locus_tag="Tlet_0338"
FT   CDS_pept        355440..356309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0338"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   csc:Csac_2322 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32906"
FT                   /db_xref="GOA:A8F422"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8F422"
FT                   /protein_id="ABV32906.1"
FT                   /translation="MLSNSIPLIMTAIAAVVSFSSGLFNLGLEGQVYFGAFFGTLTALF
FT                   LPDIPSFFAKMIVLLAAFFAGMMLSGVSVFLKIKLNIDELISSFLLSQATVHIIDYFLN
FT                   GPMRDPSAGLAASKYIDLSFSKILPPSQLHSGIFISAFFCFALYMLMNYSWFGLETRIA
FT                   KNRRFAEYIGVDVKGVWVLTMLISGGIAGLSGMVDVLGVHSRVVKGFSAGYGFNGIAVA
FT                   LIARNNPILVIPAAIFFSYLEAGSQVASFMSDITPEMSRIIQGAIFYLVTAEAILDFIA
FT                   KRKVKKIW"
FT   sig_peptide     355440..355517
FT                   /locus_tag="Tlet_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.432 at
FT                   residue 26"
FT   gene            356303..357193
FT                   /locus_tag="Tlet_0339"
FT   CDS_pept        356303..357193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0339"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   csc:Csac_2321 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32907"
FT                   /db_xref="GOA:A8F423"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8F423"
FT                   /protein_id="ABV32907.1"
FT                   /translation="MVGGFLHLVISSTVPVVLASIGGMFSNVSGKLNIGLEGMILTSAF
FT                   FGVYSAYSSKSLLVGILAGIISSCVLAFVMAYLSFFLKANIFVVGLATNLFAMGLTVFL
FT                   GAVLFGSKGTLIFDKAPLLRNIELPIKNIDFLRELLSGYNIIEYSTPFLVLLSHLVLFK
FT                   TPFGYRLRAIGKNETAAADIGINVRKTRTIAYLAGGIFTGLSGLALSLPLGSFVAGMSN
FT                   NRGWMALVAVILGGEKPVNVMVVSFFFGLITSLSNVLQTSTKLPSDLLMSLPYFATVLA
FT                   MVLYSLTRKRVWFKR"
FT   gene            357190..358038
FT                   /locus_tag="Tlet_0340"
FT   CDS_pept        357190..358038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0340"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: tte:TTE2419 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32908"
FT                   /db_xref="GOA:A8F424"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8F424"
FT                   /protein_id="ABV32908.1"
FT                   /translation="MNVSVFQKMKDMMPSMSRSQIRIAQFIIENPSKVLNMNILELARS
FT                   CESSPSTVVEFSKKLGFSGYKSFQIALAQEIALFETLKPDSDRLRRICRDFLGFVFSEL
FT                   KQSVELISDEVLTRASDIILKSNVVEIFAYGFDSIAGKDLFLKLKEFGFQVNFFSNPFL
FT                   QSISASHLGNRGCAVAISSSHSSTDLLDAISFSKKSGASVIAIASPSSKIAEVCDILLP
FT                   AYVRTEILSEGGFLTKYLQIVIVDLLILKMFEIDKDRLYEKYKHFETILSQKRRGDKGV
FT                   F"
FT   gene            358028..359440
FT                   /locus_tag="Tlet_0341"
FT   CDS_pept        358028..359440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0341"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: mtp:Mthe_1249
FT                   carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32909"
FT                   /db_xref="GOA:A8F425"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8F425"
FT                   /protein_id="ABV32909.1"
FT                   /translation="MFSDLVAAVDIGTTNVKIGLFNFSGEKIFLFQQRCFESSRSGVHE
FT                   VSTEKWWKAVVQGFHSIDSSYRKNIVAICITGQGPTTIMVDERQKVFGKAITWIDKRGF
FT                   ESLKKIIEKGIDGQTATVVAHLIEVEKNLTQKVYLLQPSDFIIMKLTRKIVNASFPQSG
FT                   YLPWNKEILEKFNLDKKFSIPPLVNTGEVISSIDRSIARVLGVNDKALIIAGAPDFAMA
FT                   LIGTGVLEDGMLCDRGGTSQGLTLCSAKKILHPGLITTPFFLDDYWKISGVMTTTGGAY
FT                   EWFSRQVARTRLVNLARLMQIKRPTGVIFLPHLNGERSPYWNPSLRGAFFGLSFNDDWK
FT                   TMLVSVVEGVAYAIREIVELMKKSGCDIKTIRTTGGQSLNDLWNQTKSDVLGKELEVVN
FT                   VHESELLGCAIVAISSLSKESFLQISKKIVRVSRKFLPCMDKHEVYSRLFELYQLIHRR
FT                   NEDIFEKLTKSL"
FT   gene            complement(359432..360397)
FT                   /locus_tag="Tlet_0342"
FT   CDS_pept        complement(359432..360397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0342"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   pfl:PFL_3640 acetylpolyamine aminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32910"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A8F426"
FT                   /protein_id="ABV32910.1"
FT                   /translation="MKIVYDPSHIFHKPTKEIDNGRFIENPEKPERIDSIKDALILSGF
FT                   DNLTPPNKFPMSYIYMVHDESYVEWLKNKSSSLSDQDEYLMEVFGFDRCFDTGTPVKKN
FT                   TFEASKKAVDVVLTAASFVDSSTNTVYALTRPPGHHATMDLCGGYCYFNNAAIAAYYFL
FT                   KRGADRIVILDLDFHHGNGTQQIFYDVDWVYYISIHGDPQVFYPWISGKASEIGNGPGE
FT                   GFNLNLPLQAGSGWNEYSEALTYALREIKDYYPDLLIISLGFDTHKDDPVGRFSLCDED
FT                   YAKIARQIGALKLPVLVVQEGGYNPQANALAATRFFSALE"
FT   gene            complement(360394..360831)
FT                   /locus_tag="Tlet_0343"
FT   CDS_pept        complement(360394..360831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0343"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.26"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: tma:TM1080 ribose
FT                   5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32911"
FT                   /db_xref="GOA:A8F427"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:A8F427"
FT                   /protein_id="ABV32911.1"
FT                   /translation="MKIAIGCDHAGFKLKEAIKGYLVSKGFNILDEGTYSEDSVDYPDF
FT                   AAKVALDIKNQRADFGILICGTGIGMSIAANRIKGIRAALCLFPEMAKLARSHNNANIL
FT                   VLPGRFIAVELAQWIVDAFIEEKFEGGRHENRVQKIEEMDK"
FT   gene            complement(360828..361193)
FT                   /locus_tag="Tlet_0344"
FT   CDS_pept        complement(360828..361193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0344"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   tma:TM1442 anti-sigma factor antagonist, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32912"
FT                   /db_xref="GOA:A8F428"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8F428"
FT                   /protein_id="ABV32912.1"
FT                   /translation="MDKKELYTATNIKDVWIIRPNGELDMSNSAELKEQIKREFIHQGK
FT                   VDLIIDLSHVDYMDSSALGVLIGLQKSCRLNGGALILCGLEENLKRIFKMTSLDSVFSI
FT                   RATVEDALKVFLEGDQN"
FT   gene            complement(361186..361788)
FT                   /locus_tag="Tlet_0345"
FT   CDS_pept        complement(361186..361788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0345"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="TIGRFAM: LexA repressor; PFAM: peptidase S24 S26A
FT                   and S26B; LexA DNA-binding domain protein; KEGG: tma:TM1082
FT                   lexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32913"
FT                   /db_xref="GOA:A8F429"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F429"
FT                   /protein_id="ABV32913.1"
FT                   /translation="MKKELTDRQKKILDFVLSYIDSHGYPPSIRDIARAFRITPRGAIV
FT                   HLNALEKKGYLTRGKRARSIKVLNRSEAIRLPVVGTIAAGNAIEAIENPTEIIEVPKAM
FT                   IKIGFDHFLLRVRGESMIEEHILDKDYVVIRKQNTANNGDIVAVLTNSNEATLKKIYIE
FT                   PEKIILKPANSKMQPIELKPENVKILGKMVGVIRIYG"
FT   gene            complement(361785..362159)
FT                   /locus_tag="Tlet_0346"
FT   CDS_pept        complement(361785..362159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32914"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:A8F430"
FT                   /protein_id="ABV32914.1"
FT                   /translation="MYRELNHPSDICYELACDDLQEIFSDLIKIFKSCYSPELKNNFIK
FT                   KEYPVQDPEDMVFDVVNDWIYTISAKKFFPDECKISEKLICKFRKIENLYGTELKALTY
FT                   HGLQLRHQKGKIVLKVVFDV"
FT   gene            complement(362144..364570)
FT                   /locus_tag="Tlet_0347"
FT   CDS_pept        complement(362144..364570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0347"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; KEGG: tma:TM1084 DNA gyrase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32915"
FT                   /db_xref="GOA:A8F431"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8F431"
FT                   /protein_id="ABV32915.1"
FT                   /translation="MAEILSKNIEDELVELYMNYSMSVIIGRAIPDVRDGLKPVQRRIL
FT                   YAMHELGLTHNAQSKKCARIVGEVLGKYHPHGDASVYDALVRLAQPFSVRYPLVIGQGN
FT                   FGSIDRDPPAAMRYTEAKLSELAEEMLQDLDKETVTMTKNFDDSLDEPEVLPSKVPNLL
FT                   INGANGIAVGMATSIPPHNLQEVVNAIEMLIENPEATIADLLRIIKGPDFPTGALIVNG
FT                   NELTEVYATGKGRIVLRGKVHFEEGKRFNNVVITEIPYNVSKAALIEEIASYAEKNPKM
FT                   MIKNIRDESDKNGLRIVVEIPKNANAEIILNNLYKHTSLQTSFSVQMLVIDGRRPKLMN
FT                   LSQLLKAFIKHRFDVIRKRAEYELKVYSRRAHILEGIMKAARAIGVVVDIVRTSKDSEE
FT                   AMKNLIEALSITNEQAKAILDMRLGRLTGLEIEKLQGEYSQLIKKIEDVKDILSRDERV
FT                   YNVMYQELEELKKKYADERRTKIENITDSLSYTPEDLIPNEDVVITLTEKGYLKSTSLK
FT                   DYRSQRRGGKGIVGARTAEDDEILTVCTSKMHSQTLFVTSAGKAYILKNYEIELTGRDT
FT                   KGKPIRAYLNLEEDESVLTMISFDEWKGDLVLVTKSGRIKRTPLKEFENTTSRGIRAIT
FT                   FSDSDVVVSATLSSSESDQIIIATKNGMAIRFPLKDVRQMGRSAMGVIGIRLREKDEVV
FT                   GMVNVPDENCEILTITVRGFGKRTPVNDYRVQSRGGVGIKTMPGVEKAGQLCGIDIVAD
FT                   PKSDVIVMTKNGQSIRFNLSTVSQLSRTARGVKIVDLSGDDEVSHFAVVETCTEN"
FT   gene            complement(364583..366457)
FT                   /locus_tag="Tlet_0348"
FT   CDS_pept        complement(364583..366457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0348"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M); KEGG: tma:TM1085
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32916"
FT                   /db_xref="GOA:A8F432"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A8F432"
FT                   /protein_id="ABV32916.1"
FT                   /translation="MKFYITTPIYYVNSDPHVGSAYTTIIADIIARYKRMMGYDVFFLT
FT                   GTDEHGQKILQASSSLGKDPQSFCDELADRFKQLWKKLNITNDGFIRTTDPNHMKVVQY
FT                   FVKKMVENNDIYKGEYRGWYCVPCETYWNEDEIGSDKLCPSCGRELKYVSEQNYFFRLS
FT                   RYQDKLLRYYEEHPEFVQPDFRRNEMMRILEGGLKDLSITRTTFKWGVPMPDDPEHVIY
FT                   VWVDALINYISAIGYPEDLKTFEKYWPADLHLIGKEINRFHSIIWPAMLMSAGLELPRT
FT                   VFAHGWLTVDGQKISKSLGNAIDPKYFVEEYGNDVLRFYLVRDINFGKDGDFSEKNLVN
FT                   RLNSDLANDYGNLLHRTLAMIKKYYSSTMPRPGAHEQIDEKFKHDILQCCKEYQQFMDQ
FT                   YSLTQAVEKVMEALAISNKYFDERKPWVLAKQKDFDKLSTVLFNVCESLLKVATMFSPI
FT                   MPDSSEEVFSRLGFDQKSSKYMLETWNILKPGKKIVHAEPLFAKRDQKEIKRSEVLMTD
FT                   TIDFDQFKKVNLRVGKVISAERVPKSEKLLKLLVDLGELGSRQIVAGIAKYYKPEDLIG
FT                   KNIVVVSNLKPVKLMGIESEGMLLAAKDDTDLKILTIDGEISPGAQIS"
FT   gene            complement(366535..368103)
FT                   /locus_tag="Tlet_0349"
FT   CDS_pept        complement(366535..368103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32917"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8F433"
FT                   /protein_id="ABV32917.1"
FT                   /translation="MIIKVFDGYDCIGGNKILVADKHNDGFMLDFGLNFSKWSLFFEEY
FT                   LKPRSGKILHDLLKLNMIPRINIYRKDLQPPEFDENTKISFLFLSHAHADHCGMIGLID
FT                   ESLPLLVTGETFAIMKAGAQIRQDVWDELYPKKRKKVGHNDDVLRHDILVAERNVKNRR
FT                   KISLLSSSTQKKILEPDFFEEIDAKNLWKDELYIQPVYHSIIGSAGLIARVDDWWVAYT
FT                   GDFRTGPESVEEENFWLENLGEKRVQLSKRSDMFFDLLKNKKPLLLIVEGTRTTRQSEK
FT                   DTTEWDVFQNVLNLLQNTNKLVIADFSMKHLERLMTFLKVAIMTERTLVVMPKDYAYLE
FT                   TMGEVEPLWKLNDTEKNHIKIYHPAKSSFIGLEKKVVEKAKKDEILLLPDDINHKPSLY
FT                   ILAAGYWDIPNILDLNEDVLENCLYIHSTSEAYSEEQQIDFRRFKNWIDRFSIKSFGFG
FT                   VDSDGELRFSKQFHASGHVSAEKLSSIINTVSPDLILPVHTLDRSWFVERWGRKVINGN
FT                   KFHIS"
FT   gene            368345..370219
FT                   /locus_tag="Tlet_0350"
FT   CDS_pept        368345..370219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0350"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: tma:TM0071 putative oligopeptide transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32918"
FT                   /db_xref="GOA:A8F434"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F434"
FT                   /protein_id="ABV32918.1"
FT                   /translation="MKKLFWLMLLLISVNLIFAQLAADVPRDETFIANQLTGRVGTPGN
FT                   FNLWAGWRSQDRGIQNLLLEPLWCVEYATGEIINALAAEPPIYSEDFTELTIKLRKGVY
FT                   WSDGVPFTADDVVYTIELVKKTSGMDYNSQMQAVLETKKIDDYTVLVKLNSPNSRFHTY
FT                   FLDRWGALRPLPKHIFEKVADPMTFEFNPPVGTGPYILKNYDAGGYWTLWERREDWDRT
FT                   PTGMLYGKPVPKFVLIQTFGPAERQVLAMAQHQLDAADLTMEALKAVLSRVDTARAWRR
FT                   EFPWTVNIDPCVTGVMFNTAKAPFDNPDVRWALTLSIDIVEYAANAFDGAVTLSPIHVP
FT                   LTSAYYDWYYTKLDGWLKNLEIDIGNGEKFKPYDPDAGKRLAEYVKQRGYSVPTNPEEV
FT                   KKIFGPGWYKYAPDVAEKLLLKNGFKKDKSGKWLLPDGKPWQIVVITNTNPAHPSYRNA
FT                   FAVAQAWKKFGIDATVMTTDALATLGQKGDFDVTSDWPAAEPWGGHPDLYRVLDPFNSE
FT                   YLAPIGENAPWGNYGRWSSSKMDEVIEKLRNTDWNDTETIVDVGVEGLKLLIQDMPSIP
FT                   TFNYPGVIAWDEYYWTNYPGAENMYAQPYHHWPNLKYMLPFLKPTGRK"
FT   sig_peptide     368345..368413
FT                   /locus_tag="Tlet_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 23"
FT   gene            370280..371287
FT                   /locus_tag="Tlet_0351"
FT   CDS_pept        370280..371287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0351"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM0072 putative
FT                   oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32919"
FT                   /db_xref="GOA:A8F435"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F435"
FT                   /protein_id="ABV32919.1"
FT                   /translation="MAFIRRYLLPRLIVYFLVIFVGITVIFVIPRLLPIDPIQQLIGKL
FT                   SAQGTYLDPKAINRMIETLQELYGLKGSLWEQYVNFWGRLLRGDFGPSYYQFPVPVITL
FT                   IKQSLPWTFGLLLTTTIISWIIGNILGGLGGYFSDKNWVKILDGVAMVIRPMPYYILAL
FT                   GLLILFAYVFPIFPLGGGYLIGGHVSFTFSSLLILLRHAFLPALSLILINIFVWFQAMK
FT                   LFVQSVKSEDYVNYAKLGGVMQSRIVYKYVIKNAMLPQITGLALSLGQIFSGALITEIA
FT                   FSYPGLGTLLYNAIFTGDYNLLMGITTISILVITTSILVIDLLYPLFDPRVRYR"
FT   gene            371301..372155
FT                   /locus_tag="Tlet_0352"
FT   CDS_pept        371301..372155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0352"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tma:TM0073 putative
FT                   oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32920"
FT                   /db_xref="GOA:A8F436"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F436"
FT                   /protein_id="ABV32920.1"
FT                   /translation="MKLFKDLIRDLRFRFAFFVVVILFFLSLLSFFSPYDPYRWNLVPR
FT                   DLPPKWPHVLGTTSMGQDVFWILTFAVRNSLLMAFIASGISRIIAVLIGMVAGYKAGKI
FT                   DRALMFLSDSFLVMPLFLIIVLFGTMMKARINLVNLGLLLGFFGWAWDARVIRSQVLSL
FT                   RERDFTYTALLSGSSTMAIIFKEYIPFVIPLIFATLIGNMSWAIGMEITLAILGVANLE
FT                   IPTLGTMLQWSINYQAMLLGYWWWVLTPVIVSVFLFVALYLLSVSISEYLDPRMRMQRI
FT                   GKV"
FT   gene            372166..373149
FT                   /locus_tag="Tlet_0353"
FT   CDS_pept        372166..373149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0353"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: tma:TM0074 putative oligopeptide
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32921"
FT                   /db_xref="GOA:A8F437"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F437"
FT                   /protein_id="ABV32921.1"
FT                   /translation="MNLVLKTEKLRSYYILNIYGRKKIVRAVDGIDLLIAENEIYGIAG
FT                   ESGCGKTTLLKTIFASIDPPLRLIGGKVYYHHDNKLIDVYQLEDEEKRRLRWRFISYVP
FT                   QGSMSVLNPVARIKDTFKDFLNSHARGKDKKEAYELAKKHIKELGLPLKTLDAYPHQLS
FT                   GGMRQRVTIALATILSPRIIITDEPTTALDVVTQRGVVQLLKDIQIKYNNTLIIVTHDM
FT                   GVHANMTDRMAIMYAGRIIEEAPTVEIFSNPFHPYTKYLIDSLPKFGDKLKRESVPGNP
FT                   PSLSDLPEGCSFHPRCPRVFERCRKEIPDLKEIKSDHRVACWLLEE"
FT   gene            373152..374111
FT                   /locus_tag="Tlet_0354"
FT   CDS_pept        373152..374111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0354"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: tma:TM0075 putative oligopeptide
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32922"
FT                   /db_xref="GOA:A8F438"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F438"
FT                   /protein_id="ABV32922.1"
FT                   /translation="MEKLVEIRNLKKIFSIGSIFSRVKITAVDDVTFDLNFSQIFTLAG
FT                   ESGCGKTTIAKILLGFEEPTSGKVLYKGNDLTTMKHKERSKFMKDIQAVFQNPFSSFNP
FT                   LRKVDNYFFETLRNFEIAKTQNEAIEIIKEKLLAVGISFEEFREKYPSEFSGGQLQRIS
FT                   IARSLLTNPSLLIADEPVSMVDASLRMSIVNLFKELRDKFGLSVLYITHDLTTAYYVSD
FT                   KVAIMFRGNLIEFGPAEKVLLNPKHPYTKLLRESVPEADPKRKWTSRIKLSELEQEEYA
FT                   KLGCKFAGRCPEVMDICRKNLPDYYEVDGVKVKCFLYR"
FT   gene            374124..376463
FT                   /locus_tag="Tlet_0355"
FT   CDS_pept        374124..376463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0355"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tma:TM0076 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32923"
FT                   /db_xref="GOA:A8F439"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8F439"
FT                   /protein_id="ABV32923.1"
FT                   /translation="MPKVPAYKNASLPVDIRVKDLLSRMTLDEKVAQLGSVWSYELLDD
FT                   QGNFSNEKAEALLKNGIGQITRPGGATNLSAKEVARLINQIQKYLIEQTRLGIPAIMHE
FT                   ECLTGYMGLGATNFPQAIAMASTWDPELIEKMTSTIREDMRQMGIHQGLAPVLDVVRDP
FT                   RWGRTEESFGESAYLVAKMGVSYIIGLQGKDIKNGVIATAKHFVGYGASEGGKNWAPTN
FT                   IPERELREIFMFPFEAAVKEASVMSVMNSYSEIDGIPCASSKELFTGVLRKNWGFSGIV
FT                   VSDYFAIDMLREYHRLAKDKKEAAKYALQAGIDVELPKADCYTTIRELVEQGLISESTV
FT                   NQATSRVLQIKFMLGLFDKPYVDVEKIELKKHYSIATEIARKSIVLLKNDGILPLKKDA
FT                   KIALVGPNASEVRNLLGDYAYLAHIKVLLDSVNQTTFNAPKFNLKNVEKVINESIEKIP
FT                   SILDSMKAEGVIFTHAIGCDILNSSTEGFSEALHAVKNADIAVVVVGDRSGLTEDCTSG
FT                   ESRDSANLKLPGVQEELVLEIAKCGKPIVLVLVTGRPYSLKNIVSRVNAIIEMWLPGEV
FT                   GGMALVDVLFGKVNPGGKLPISFPRSAGQIPVYHDVKPSGGRSHWHKDYVDELVEPLFS
FT                   FGHGLSYTKFEFSNLVIEPQKIPSDGQVTIKVDVKNSGEVEGDEVVQLYLTREHASVTR
FT                   PIKELKGFKRITLKPGESRTTVFKIHTDVLAYYDRGMELVVEPGVFKAMIGSSSTDIRC
FT                   FGEFEITGKKRKLGKNRKFFSDVEVI"
FT   gene            376463..377443
FT                   /locus_tag="Tlet_0356"
FT   CDS_pept        376463..377443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0356"
FT                   /product="Acetyl xylan esterase"
FT                   /note="PFAM: Acetyl xylan esterase; KEGG: tma:TM0077
FT                   acetylxylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32924"
FT                   /db_xref="GOA:A8F440"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:A8F440"
FT                   /protein_id="ABV32924.1"
FT                   /translation="MVYFDMPLEDLRKYLPQRYEEKDFDDFWKQTIHETRGYFQEPILK
FT                   KVDFYLQNVETFDVTFSGYRGQKIKGWLILPKFRNGKLPCVVEFVGYGGGRGFPYDWLL
FT                   WSAAGYAHFIMDTRGQGSNWMKGDTPDYEDNPSDPQYPGFLTKGVLNPETYYYRRVFMD
FT                   AFMAVETISQLEQIDSQTIILSGASQGGGIALAVSALSSKVMALLCDVPFLCHYKRAVQ
FT                   ITDSMPYAEITRYCKTHIDKIQTVFRTLSYFDGVNFAARAKCPALFSVGLMDDICPPST
FT                   VFAAYNYYAGEKDIRIYPYNNHEGGGSFHTLEKLKFVKKTISMRE"
FT   gene            377468..378604
FT                   /locus_tag="Tlet_0357"
FT   CDS_pept        377468..378604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0357"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; SMART: regulatory protein
FT                   Crp; KEGG: tma:TM0110 transcriptional regulator,
FT                   XylR-related"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32925"
FT                   /db_xref="GOA:A8F441"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F441"
FT                   /protein_id="ABV32925.1"
FT                   /translation="MKYNSPRIKVLNKQNILKLIHDNHPISRAEISEITDLTPSSVTRL
FT                   TKELIDEGYVKERGTIGKNSPGRRRTLLDLNKDASISLVFDLGVNVTTFGLGYFNGKVS
FT                   LSGSFETPRRPEDFFAKVEEIYLRLKKEYRITRISLSIPGMVNMLENRILLAPNLCWQD
FT                   VLINDLLDVDVPVLADNEANLSMMAEKYHSKDLKEVKEAVFIVIREGVGTGVLLDGKIY
FT                   RGSSFTAGEAGHMTVDIHSDKKCHCSNKGCWELVTSINWAIENYRGELQGKNAIEKFAS
FT                   LKKKTGNKKFFEEFAKNIAVGIVNIVNVLNPQLIILGGEVQDLGEYFFNSIESEVKRRA
FT                   LRDAVKQLKIRPTIFETVSSNLVGAAILAIEDIIEKVK"
FT   gene            378949..379929
FT                   /locus_tag="Tlet_0358"
FT   CDS_pept        378949..379929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0358"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: tma:TM0112
FT                   simple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32926"
FT                   /db_xref="GOA:A8F442"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8F442"
FT                   /protein_id="ABV32926.1"
FT                   /translation="MVVLEGEKTLIARKKQRSFKELGPLVALMSLAIFTTVLNPRFLTA
FT                   FNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGSVVALTGVMVAWLMTHGVSVWIS
FT                   LFLILLFSLGIGAWHGVFVTKLKVPAFIITLGTLTIARGMAAVITRGWPVINLPSSFLK
FT                   IGQADFLKIPVPVWILIGVTLIADFFLRKTVYGKHLRASGGNEIAARFSGVNVDAVRTI
FT                   AFMVSGFLAGLVGVIVAARLSQGQPGVGSMYELYAIASTVIGGTSLTGGEGSVLGAIIG
FT                   ASIISLLWNALVLLNVSTYWHNVVIGIVIVVAVTLDIVRRRFVSK"
FT   gene            379954..380925
FT                   /locus_tag="Tlet_0359"
FT   CDS_pept        379954..380925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0359"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: tma:TM0114 simple sugar
FT                   transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32927"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F443"
FT                   /protein_id="ABV32927.1"
FT                   /translation="MRKLLVVLLTVVLAVVSLAMTIGVIGKSVHPYWSQVEQGVKAAGK
FT                   ALGVDTRFFVPQKEDINAQLQMLESFIAQRFDGIAIAPSDPTAVMPTIKKALEAGIPVI
FT                   TLDTDSPESGRYVYIGTDNYQAGYSAGLIMRELLNGRGKIVIGTGSLTAMNSLQRIQGF
FT                   KDAIAGTEIQILDTLNDEEDGARAVSLAESALNAHPDLDAFFGVYAYNGPSQALVVKNA
FT                   GKAGKIKIVCFDTTTDILQYVKEGVIQATMGQRPYMMGYLSVVTLYLMSKTGVQNTLAM
FT                   LPKVEAEGITDYVIDTGVDIVTPQNLSNYLETMEKLGIPIKF"
FT   sig_peptide     379954..380013
FT                   /locus_tag="Tlet_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 20"
FT   gene            380979..382502
FT                   /locus_tag="Tlet_0360"
FT   CDS_pept        380979..382502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0360"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tma:TM0115 simple sugar transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32928"
FT                   /db_xref="GOA:A8F444"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F444"
FT                   /protein_id="ABV32928.1"
FT                   /translation="MQLLQARNIIKSFPGVLAVDDVDFEVGENEIVSIVGENGAGKSTL
FT                   IKVLSGILKPDSGEIFFNGEKVEFHSPFDAFIKGISAIHQELNLCENLTVAENIFLAFE
FT                   AIRGKRRSLSSRLDENYMRRKSEELLNLTGARFSSNTLVRELTTAQRQMVEICKALIKE
FT                   PRIIFMDEPTSSLTVEETERLFEIIHMLKDRGISVVFVSHRLDEVAKISDRVIVMRDGK
FT                   KVGELKRAEFDMDTVIKLMVGREVEFFPHGTEVSPGEVVLKVENLRWKNRVKNVSFQVR
FT                   KGEILGFAGLVGAGRTETMLLIFGINKKEDGEIFIKGNKVNIERPLDATKLGIGLVPED
FT                   RKLQGLVLKLTVKDNMVLPSLSVISNHGWILNERKEKMIAENFVKKLSIKTPSVYQITE
FT                   NLSGGNQQKIVLAKWLATNADILIFDEPTRGIDVATKAEIHRMIRELAAQGKTILMISS
FT                   ELPEILNLSDRIVVMWEGEITAILDNKSKKVSQEEIMYYASGKLKQSGR"
FT   gene            382511..384001
FT                   /locus_tag="Tlet_0361"
FT   CDS_pept        382511..384001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0361"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: tma:TM0116 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32929"
FT                   /db_xref="GOA:A8F445"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8F445"
FT                   /protein_id="ABV32929.1"
FT                   /translation="MNLYVGLDVGTTGVKGVLVDENGKIIDIQSGHLTIQTPKPGWSEQ
FT                   DPLNWWKAVLKVLKNLSERSKEAGGRIRAISTSGQMHSLVAIGKNGEVLRNAILWCDQR
FT                   TYEECKEAESLLGGEEKTLKIVGNSILPGFTLPKILWLRKNEPDVYGKIYKVLLPKDFI
FT                   NYMLTGIIATEHSDASGTMLYSVSEGRWSDQILDAFGISKKFLPDILESNEMIGKVREN
FT                   LVKMLNLDEEVAVVAGGADNACAALGVSVIDPGDVMISLGTSGTVVAPTGSKVPDPYGR
FT                   VHFFAHVVPRTMYHMGVMLSAAYSLEWFKHRFLKEDYEVINRQVMKVPIGSNGVIFLPY
FT                   LNGERSPHKDPYAKGVFFGISSYNSKWDFVRAIFEGVAFGIRDCFEVIEELNTSVKNIR
FT                   TTGGGARSDVWNVMIADLLSREIQKPLINEGASYGAAMLACSGFSSSSPDQIARRWFKL
FT                   ETSVKPSLENKKEYDKFYYRFRDLYKGLKSFFHDWKDE"
FT   gene            complement(384050..385247)
FT                   /pseudo
FT                   /locus_tag="Tlet_0362"
FT   gene            385607..386884
FT                   /locus_tag="Tlet_0363"
FT   CDS_pept        385607..386884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0363"
FT                   /product="Argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: tma:TM1780
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32930"
FT                   /db_xref="GOA:A8F446"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F446"
FT                   /protein_id="ABV32930.1"
FT                   /translation="MKKVILAYSGGLDTSVILKWLSEKGFEVIAFVANLGQKEDFKAIE
FT                   CKALSTGASKVYVEDLRREFVTEFVFPALMGNALYEGRYLLGTALSRPLIAKKQVEIAE
FT                   KENAAFVAHGATGKGNDQVRFELTYAALNPFLKVLSPWKDIEFLKLFKGRTDLLAYAKQ
FT                   KCILTRATIEKPYSEDENLMHISHEGGKLEDPLYIAGEDVFSWTNSPKNAPDEEVFLEL
FT                   HFRSGLPVKVVNLNDGSTKEDPLELFEYLNRIGSKYGVGRVDMVENRFIGIKSRGIYET
FT                   PGATILWIAHRDLEGIAMDKEVMHLRDMLSVKFSELIYNGFWFSPEMDFLLSAFRKSQE
FT                   GIEGKVNLIIYKGNVVPVSRFSPTSLYDQSLSSMDVDGGFDATDSKGFINIHALRLRAH
FT                   NLVLRSRDPFGWRRGIIDAEIMGKGV"
FT   gene            386856..388052
FT                   /locus_tag="Tlet_0364"
FT   CDS_pept        386856..388052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0364"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: tma:TM1781
FT                   argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32931"
FT                   /db_xref="GOA:A8F447"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8F447"
FT                   /protein_id="ABV32931.1"
FT                   /translation="MPKLWEKGYDLDSLIEEFTVGEDYLVDMKLIKYDVKASIVHAEML
FT                   EKMGYLERHEFIKIKEALEELLTLVESGKFCIDPEEEDSHTAIENFLVQKLGEAGKKIH
FT                   TARSRNDQVLTALRLLYKDELKDVCRHLKGLRSVLRNFAKKYGHIKFAGFTHTRKAMPA
FT                   NFRMWGMALCDALKDDEIMINLTIRLIDQSPLGTGAGYGVPIKIDRNYIANRLGFSKVQ
FT                   RNPIYSQNSRAKFDYLILHCLSQVSYDLNRFASDIIFFSLPDIGYLIIPENLCTGSSIM
FT                   PQKMNPDPVELVRAYHSRIISKALESALISMNLISGYHRDMQLLKITVLETFKDIKDML
FT                   RVTCRIFEKIQVNGNKCKESLTEEVMATQEVYRLLMEKGMSFRDAYRVVAEKYGSDRK"
FT   gene            388049..389074
FT                   /locus_tag="Tlet_0365"
FT   CDS_pept        388049..389074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0365"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region; KEGG:
FT                   tma:TM1782 N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32932"
FT                   /db_xref="GOA:A8F448"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F448"
FT                   /protein_id="ABV32932.1"
FT                   /translation="MKIRVGILGATGYTGLELLRMLKNHPQVKITYLSSNNFSGQSMKD
FT                   IYPFAEIDILLSKIDVKEIKANCDVVFTALPAGISYDIVKSLRDENLKIIDLGADLRFD
FT                   DPSLYEKWYGRTLQDYGLIKRVYGLPELYRSEIKESRFIGNPGCYPTSILLATAPILKR
FT                   KLLVNGEIIVDSKSGVSGAGKKEELAYSFCEIDGSLKPYSVINHKHVPEIQEQMKKIYH
FT                   SEVTVIFAPHLVPMVRGILSTIYLKTRLSADELYGLYSEFYRDEYFVHVLKPAIYPSTK
FT                   WSYGSNHVFISMKKDERTDTAVLISVLDNLVKGASGQAIQNMNILFSLREDTGLTFTVY
FT                   P"
FT   gene            389092..390279
FT                   /locus_tag="Tlet_0366"
FT   CDS_pept        389092..390279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0366"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; PFAM: arginine biosynthesis protein ArgJ; KEGG:
FT                   tma:TM1783 glutamate N-acetyltransferase / amino-acid
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32933"
FT                   /db_xref="GOA:A8F449"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A8F449"
FT                   /protein_id="ABV32933.1"
FT                   /translation="MNIPKGFKFSGLHCGIKRYRKDIALAYSEKECVTSGFFTTNAIKA
FT                   APVLHNIQVLKENSENIRALIVNSKIANSCTGEEGLQNAFKMAKITAQKLHIDSRSVLV
FT                   ASTGIIGIQLPMEKVEYGIDAAVKKLDSDVISFAEAIMTTDTTVKISFRKINVPQEVIL
FT                   LGIAKGSGMIHPNLSTMLAFIFTDAKIPFYTLKELLKKSIDKTYNMIDVDGDMSTNDMV
FT                   LMFCNGAANVEIKEKTAAYDKFSRALDEINTELAKKIVSDGEGASKVIEVRVANAPDEA
FT                   TAKKVARSICSSNLVKTAIHGADTNWGRIIAAAGSSQTFFSLEMVDLHISDGKEEICVF
FT                   EKGKSQAFNEENLRRVLSSREIFLLLNMNTSNSSATAWGCDLTEKYIQINGRYKT"
FT   gene            390276..391115
FT                   /locus_tag="Tlet_0367"
FT   CDS_pept        390276..391115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0367"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: tma:TM1784
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32934"
FT                   /db_xref="GOA:A8F450"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F450"
FT                   /protein_id="ABV32934.1"
FT                   /translation="MTSENMAILFEVLQYMKEFREKTFVVKVGGAALEKEEAKTSFAKS
FT                   IVFLRHVQVNPIIVHGGGVEITRLMNQLGIKPLFKNGYRVTDEKTLQIAEMVLEKINKD
FT                   IVLKINLHGGRAIGVSGKDDNLLLCEKDIANGDIGYVGKIRKVNSGFIEKLIAQNYIPV
FT                   ICPVGFGEDGTTYNINADVAAAEIAISLKAEKLIFVSDVPGVMKDGELIPYLDVRNARK
FT                   LIEEGVVKGGMIPKIQCAVNALKAGIKSVHVVNGEIPHALLTEIFTLHGIGTMLREI"
FT   gene            391130..392320
FT                   /locus_tag="Tlet_0368"
FT   CDS_pept        391130..392320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0368"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   tma:TM1785 acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32935"
FT                   /db_xref="GOA:A8F451"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F451"
FT                   /protein_id="ABV32935.1"
FT                   /translation="MKNNYLMNTYNRFPVILDHGKGSVVWDKDGRSFLDFSSGIAVNIL
FT                   GHSHKKLVSAIESQVRKLVHCSNLYWTEPQVELAKLLIENTFEGKVFFTNSGTEANEAA
FT                   IKLSRKYGKKKSISKFRILSAVNSFHGRTFGSLTATGQEKYHEYFKPLVAGFDYFEFNS
FT                   EESLRSKMNDEVCAVILEPIQGESGIVPASDDFLNAARVLCDHYGALLIFDEVQCGMGR
FT                   TGKLFAYQKYGVKPDILTIAKGLGGGVPIGAVVASNKADVFEPGDHGSTFGGNPLACSA
FT                   GIAVMREILKDGFLKRVEDKGRYLMKKLEGIKKIFPSLIGDLRGTGLMVGVELKNISSR
FT                   DFVNNCFDHGLLTVPSGRNTVRLLPPLTVKKVEIDSALKIIAEVLEGFDRTGRNIQ"
FT   gene            392317..393441
FT                   /locus_tag="Tlet_0369"
FT   CDS_pept        392317..393441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0369"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: tma:TM0558
FT                   carbamoyl-phosphate synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32936"
FT                   /db_xref="GOA:A8F452"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A8F452"
FT                   /protein_id="ABV32936.1"
FT                   /translation="MKKALLLLEDGTFFYGRAFAADGEVFGELVFNTSTTGYEEVLTDP
FT                   SYAGQIVIMTYPEIGIYGINDEDAESDSAKVTGLVVYRSVQRYFNQRANKSLGEYLKTN
FT                   GVIGIEGIDTRSLTKKIRNRGTAMGAVSTENMDPDSLREKLRNVIEINKTDLVSKVSSE
FT                   VVWNYKKEGKVRIAIVDCGCKKGILRELEKFDVAITVVPYDIGFEEIEKLNPDGVMISN
FT                   GPGDPSILIRTVELIKHILKKRIPLAGICLGHQLLALAIGAKTYKMKFGHRGINHPVKD
FT                   LRSKRVLITTHNHGFAVDPKSLNINTDTLIGISKEDFGRVEITHLSLNDMTVEGIRLLD
FT                   YPAFSVQFHPEASPGPHDSKSFFEDFLKLIISGR"
FT   gene            393446..396763
FT                   /locus_tag="Tlet_0370"
FT   CDS_pept        393446..396763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0370"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; MGS domain protein; RimK domain
FT                   protein ATP-grasp; KEGG: tma:TM0557 carbamoyl-phosphate
FT                   synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32937"
FT                   /db_xref="GOA:A8F453"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F453"
FT                   /protein_id="ABV32937.1"
FT                   /translation="MPKRDDIEKVLVIGSGPITIGQAAEFDYSGAQAIKALKSLGYRVV
FT                   VINSNSATIMTDPEFSDAVYIEPLTIDFLEAVIEKERPDALLPTLGGQTALNLAVELFK
FT                   KGVLCKYDVELIGVKPDTIEKAEDREQFKTAMKNCGLEVLESRLVSSVTEAMDVVREFG
FT                   YPVVIRPSFTLGGSGGGIAYNLQELKAIVENGLIESPAHTVLIEKSVIGWKEYELEVMK
FT                   DHEDNFIVVCSIENFDPMGIHTGDSVTVAPAQTLTDVEYQCMRNAARKALSAIGFDAGG
FT                   CNIQFAVDTYTGKLVIIEMNPRVSRSSALASKATGYPIAKISALLAVGLRLDEIPNSIT
FT                   EQTTAAFEPSIDYVVVKMPRFQMEKFPGAEQKLGTQMKSVGEVMSIGRTFKEALGKAVR
FT                   SLELDIAPKLDLRNMREHLANPTSERMSYIFAAFRNSLSVDEVHELTFINKWFLTEIEE
FT                   IMNFEKVLRKKKPKDFGSLKKAKEFGFSDRELAEIYKVQEEEIRKIRHKLGVTPVYKMV
FT                   DTCSAEFEAKTPYFYSTYNGMENETIPSKRRKIMVLGSGPNRIGQGIEFDYANVHAVWA
FT                   FQEEGYEVIMVNSNPETVSTDYDISDKLYFEPLTTEDILEIAKIENPDGIVVSFGGQTP
FT                   LRIARALEKEGLKILAANYELIDLTESRDRFAKFLKQSGLSVPPFSVARSIKEALRAAE
FT                   LIGFPVLIRPSYVLGGRAMAIVDHKKDLLSYISNASLISPDHPLIIDKFLENAVELDVD
FT                   VISDGENVWIAGLMEQIEKAGIHSGDSACVLPPVSLSDDLIEKIEHLIYRLIKSLKIIG
FT                   PANIQLAVKDDKVYVIELNLRASRTIPFVSKAIGIPVAKIAAKTIIGKKLSQLLLRYWP
FT                   YSTKERLVKYEPARSGVLPTPWPEYYSVKEAIIPFNKFSGVDILLGPEMRSTGEVMGIG
FT                   DDFAEAFAKAQLSADGISTKSLLVTVNDRDKREIVPLVSYLYDLGFEVFATAGTGKILR
FT                   SMGIAVKNVFKVGEGKPDVVDLIRQGKIGFIVITQSPNRKTSAEINREAENSFADDERT
FT                   AGYKIRTAAIQCKVPCITTIEAFRAEVSAIRRLKKSTLSVRSLQDIFYAQQNTLLKK"
FT   gene            396813..399752
FT                   /locus_tag="Tlet_0371"
FT   CDS_pept        396813..399752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0371"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: tma:TM1546 single stranded
FT                   DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32938"
FT                   /db_xref="GOA:A8F454"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A8F454"
FT                   /protein_id="ABV32938.1"
FT                   /translation="MRWIIKQVDQQKVEFLSQEAGISLFLAKILVNRGIEDPKIANRFL
FT                   KPSILDLHDPFLLRDMDRVVELLLKAREENIPVLIYGDYDADGITGIAVYKEFLDRYGW
FT                   VTDYYIPKRMDEGYGIQPAVIEQFFKKFNKGIVLTVDCGITAIEAVEFAKKFNCLVLIT
FT                   DHHEVGEQLPDAAAVVDPKRPDDDYPFKDLAGVGVAFKVVSAISQKLNIQIEEIFDLLE
FT                   FVAIGTIADMVKLVDENRFMVKTGLEKLKRTGKPGLSILFKRLGINEPDSRDIGYRVAP
FT                   KLNAAGRLDSADDAFELLISRDETSAEKLVNLLFEYNSTRQEIESEIFMRAVEQIEERG
FT                   LHKDPIIVVKGDNWHVGVIGIVATRLVHRYGKPVMVISNSDGIARGSARSIPNLNLIEL
FT                   LQPLSSYFYEFGGHPLAVGFSLDSNNVDDFAELLRNFEIPIEDVPDVLEIDEDLQLEQI
FT                   NEETLKDIGKLEPFGHGNNEPIFVARNVIAESIKFFGQNHANVKMNFTVNGAKIEAIGF
FT                   GLDHAFDKSIYECNKVDIVFSIRNHRHPFSINIIDFSIIKDYQDTHQATENIEILQKNS
FT                   HLNHILEQLKGGKLFILDLRTRNALYYWLKEKSKIRCAVISLNNIISSQVHQSLLRHIQ
FT                   KPIEYLNSLCKSGSEDFAFMTMSYFMAEKEEVMKRFDLFFINELSVFTLFQNNSQVAEF
FT                   LDFVSSNCDKFVAVTVKNPEKLLSFANELGFEVTYERSLKPSYGLTDASNEIDLIINDA
FT                   SCFLFSDQRKLSSFYKKLKTTIKNKEILMYSHSLKPSYRAGVVNYIKRKKPVKLVSSTN
FT                   TDGLPTLLGQETEIAILDAPLTLFEILDAISYNCNDQLLDLCFTEENVVERENELNELF
FT                   PSRSVLREIILQIGERKVSQDELMEYVVRQGYFGSFSYARIIKNIFDDLGAAISDGMID
FT                   LTKIDFSKKSLREMERELEIEYFAKITRPLLTQKVKGIYRALANVHVVI"
FT   gene            399752..400396
FT                   /locus_tag="Tlet_0372"
FT   CDS_pept        399752..400396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0372"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: tma:TM1545
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32939"
FT                   /db_xref="GOA:A8F455"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A8F455"
FT                   /protein_id="ABV32939.1"
FT                   /translation="MIVAVDYGDARCGLAIGEKLARKIMTVEKKKVISEISRIPFINCF
FT                   VVGLPLSMSGRYSQQTFKAIEFAEKLNRRFKKRVYLIDERLTSSIFKNRENIDGLCAAE
FT                   IFEKFVFSKMKFHEIIPPIKVSDNLVNELNNMAGNILIVGLSDTRLVCKRRCIVLQEEP
FT                   YYAYLFYKLGCHVERYADQLENFAPFDIIVAGKMCDKLKAYLKPEGKLLCL"
FT   gene            400387..400463
FT                   /locus_tag="Tlet_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            400387..400463
FT                   /locus_tag="Tlet_R0006"
FT                   /product="tRNA-Arg"
FT   gene            400490..401500
FT                   /locus_tag="Tlet_0373"
FT   CDS_pept        400490..401500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0373"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl; KEGG: tma:TM1544 rod
FT                   shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32940"
FT                   /db_xref="GOA:A8F456"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8F456"
FT                   /protein_id="ABV32940.1"
FT                   /translation="MPKGDLGIDLGTASFIVYQRGKGIVIFEPSVVAISEKTGEIVAIG
FT                   EEAKKMLGKTPEYFKAIKPMKDGVIADYKTIEAVIKEFINRTVRRSFFFKPDLVIGIPT
FT                   KATSVEKRAVFEAALNAGARQVHVISEPLAAAIGSGIDVTKSEGSMVVDIGGGTTDIAV
FT                   ISLGGVVVGDSIKIAGDAMDEAIVRFARRKYGLVIGEPTAEQVKIRIGKIHSSMESYEI
FT                   EIKGRDAVTGLPRTDQINSDDVMETLRPLVETIVSRIKMVLEKTPPELAADIINQGIVL
FT                   TGGGALLRGLDLLISEELGVKTIIAEDPITSVARGTGILLENPDLLKVVATSYSR"
FT   gene            401505..402254
FT                   /locus_tag="Tlet_0374"
FT   CDS_pept        401505..402254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0374"
FT                   /product="protein of unknown function DUF1078 domain
FT                   protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; KEGG: tma:TM1543
FT                   flagellar basal-body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32941"
FT                   /db_xref="GOA:A8F457"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8F457"
FT                   /protein_id="ABV32941.1"
FT                   /translation="MLRGIYTAAMGMLLDMSKLDVTANNLANVETVAYKRDKLAFRAYQ
FT                   DRAIYALPDRRQPIGNLTYSAVLDDVFLDSSMGTFMKTDNPMDFAIDGEGFFSLLGEDG
FT                   VYYSRAGNFKLNEEGYLVNTDGLMVLDENNQPIRFESSYVVDADGYIRDPVGNVITRLG
FT                   IYNFDDPGELRKIGYTLFQPTEESGQPVVADEFRILSGYVELSNVNAIDEMVNLIEAQR
FT                   HFEISQKALTVSDETLAKLISQVGSLK"
FT   gene            402273..403058
FT                   /locus_tag="Tlet_0375"
FT   CDS_pept        402273..403058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0375"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: tma:TM1542 flagellar
FT                   basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32942"
FT                   /db_xref="GOA:A8F458"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8F458"
FT                   /protein_id="ABV32942.1"
FT                   /translation="MMVSLYSAATGMWAQQYKLDTISNNLANVDTTGYKKVRAEFQDLV
FT                   YQYYKNAGTPTAVNSTIPTGIYFGHGTRLSATTKIFSLGNMEYTGNALDVAITGDGFFQ
FT                   VQLQDGRTAYTRDGTFKVDSEGRVVTSNGLALIPNIVVPADAVAINISPDGIFSAEMQD
FT                   GTVQNLGTITLVRFVNPSGLKAVGDNLYLETTASGEPIEGTPNQDGFGALQQGYLEKAN
FT                   VDVVKEMVDMITAQRAYELNARAIQTADNMLQTVSTLKR"
FT   gene            403096..403755
FT                   /locus_tag="Tlet_0376"
FT   CDS_pept        403096..403755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0376"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: tma:TM1541 flagellar
FT                   protein FlgA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32943"
FT                   /db_xref="GOA:A8F459"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A8F459"
FT                   /protein_id="ABV32943.1"
FT                   /translation="MWRIFAFCLISVSAFAVFETDVQSAIIDFVLSQISETATVTDLQF
FT                   KQSIPSADRFEILSCNFNGNKTNILIKFYNNRSFAGYVQASALISQPRKILIARRTIKS
FT                   GEIIKREDVELVEFDVFGKKGNFTNNLEVVAGKVSRKMFREGEPIDLFYLVKAPDVRAG
FT                   QVLLAVFETGSVLATALVRVLHDGNFGEIVKARNVDTGFLIQGILRSDYTILISGG"
FT   sig_peptide     403096..403155
FT                   /locus_tag="Tlet_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.544 at
FT                   residue 20"
FT   gene            403760..404359
FT                   /locus_tag="Tlet_0377"
FT   CDS_pept        403760..404359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0377"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein; KEGG: tma:TM1540
FT                   flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32944"
FT                   /db_xref="GOA:A8F460"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A8F460"
FT                   /protein_id="ABV32944.1"
FT                   /translation="MKKSLIIVIVFALYTTFVFPTSLWNNSSSAQFKNIIADRKASKVG
FT                   DIVTIVVKETPQINSSSSNDAFENALVNLFTGAVKNITQFDLSQFIPINNNSQQQRSAQ
FT                   LSSTVVLTISAVVVDIQNGNLVVEGNKKLKVGEQLSEIIIRGTVRPDDISHNNTVDSSN
FT                   IANCQIWVNGELVFRQNPDQQSWLDYLLSAIAKWFL"
FT   sig_peptide     403760..403837
FT                   /locus_tag="Tlet_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.583 at
FT                   residue 26"
FT   gene            404369..405364
FT                   /locus_tag="Tlet_0378"
FT   CDS_pept        404369..405364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0378"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein; KEGG: tma:TM1539
FT                   flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32945"
FT                   /db_xref="GOA:A8F461"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F461"
FT                   /protein_id="ABV32945.1"
FT                   /translation="MRKVTIFIIIIVALTGFGSVRIKDIADFRGARDNQLFGIGVVVGL
FT                   NGTGDSGQVNSTLLANMAKAFNVSIDSDSLKTKNSALVMVFADIPPFYKEGMRLDVSVA
FT                   SIGDAKSLEGGFLVQTPLYGADGNVYAVAQGNVSVGGFDVKVSANLQNKYRIVGYIPNG
FT                   AIVEKEIPFEFVQSNSVTILLKKPDFTTSARVAQAINTTFERKIAKAVDASSIKIEVPS
FT                   AFEDDIVTFLSLVEEVEVSVDQPARVVVNEKTGTVVFGGNVKILDFTLSYGVFNITVKN
FT                   GKVESSEEVDATVSSLVSALKNLGATPQDIIAILQTMHSAGVLLADLVVM"
FT   gene            405364..405624
FT                   /locus_tag="Tlet_0379"
FT   CDS_pept        405364..405624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM1538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32946"
FT                   /db_xref="UniProtKB/TrEMBL:A8F462"
FT                   /protein_id="ABV32946.1"
FT                   /translation="MLVQSVDSVRTDKLYNACSEFAGSLFYEVFKKMYDSIPKSDLIPR
FT                   TPAQEWFTNMLFYEYSKQVAKDNLKSLVRTIYERLAQNAYQ"
FT   gene            complement(405626..406669)
FT                   /locus_tag="Tlet_0380"
FT   CDS_pept        complement(405626..406669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0380"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   tma:TM1363 peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32947"
FT                   /db_xref="GOA:A8F463"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A8F463"
FT                   /protein_id="ABV32947.1"
FT                   /translation="MKDIIESIIKDVNKKTIELEQKLSSSNLDIEQLREFSVEYSRLKE
FT                   ALEIYQQLKQVEEEMNFWQEAMKEDPSLEEDFLKARKQYEDIISQLISHLLPFEEHNNV
FT                   IFEIRAGTGGEEAALFAADLYRMYIRYAERKGWQVELSDFHDTGLGGFKEIVFFVKGKS
FT                   AYKYLKYESGVHRVQRVPVTESSGRIHTSTATVAVLPEVSDVEIHIDPKDLKIDTFKAS
FT                   GHGGQYVNKTESAVRITHLPTGIIVSCQSERSQHQNRERALVILRAKLYEIEQEKINSQ
FT                   LSNQRKNQIGSAERSEKIRTYNFPQNRVTDHRINYTTYRLQEILDGDLDELIMKLFESE
FT                   LIKLTRN"
FT   gene            complement(406666..407724)
FT                   /locus_tag="Tlet_0381"
FT   CDS_pept        complement(406666..407724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0381"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: tma:TM1362 motility
FT                   protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32948"
FT                   /db_xref="GOA:A8F464"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F464"
FT                   /protein_id="ABV32948.1"
FT                   /translation="MIEISALVADAFSKKASDIHLSVDMPPIYRINGLLVEQKNFGIMG
FT                   ESDLVMSLKKLFDQIGMTNNLEKKEIDFAFSVGEQVRVRGNLYYERRKPALALRLITRK
FT                   IRTFDELGLPDILKEFTERDSGLILVAGPTGSGKSTTLAAMIDYINENHPYHIITIEDP
FT                   IEYIFTNKKSVIHQRELGQDTNSFYDGLKYALRQDPDVILVGEMRDLETMSLALTAAET
FT                   GHLVFSTIHTNSAASAPERVIDVFPAHQQKQIALQLANTLIAIIYQRLLPRIDGKGMVP
FT                   VLEILVGTPAVKNLIRENKLHQIESIMQTSSRQGMVLFDDALFRAYMSGLIDKKQVYEY
FT                   ARNQQEMGKKLG"
FT   gene            complement(407729..410464)
FT                   /locus_tag="Tlet_0382"
FT   CDS_pept        complement(407729..410464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0382"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG: tma:TM1361
FT                   isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32949"
FT                   /db_xref="GOA:A8F465"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F465"
FT                   /protein_id="ABV32949.1"
FT                   /translation="MDYRSTLNLPGTEFSMRANLVEKEPRILEKWQKMNIYDYLLKHRE
FT                   NNPTFVLHDGPPYANGDIHIGTAMNKILKDIVVRYKTLRGFKSPYVPGWDTHGLPIEHK
FT                   VTTMLGEKARSMSQTELRKACEEFAKQQIEMQKKQFQRLGVIGDWENYYATLNPEYEYK
FT                   IYEIFAKLVEDGYVYRALKPVLWCNNCGTALAQAEIEYHDHDSPSIYVKFKMENSENEY
FT                   IIIWTTTPWTLPGNTGIAVHPDQQYVKIEVGSEIWILAEKLLKMAMQEIGIDEYRILEK
FT                   FKGHFLEGKQAVHPIFDRKSRIITADFVDMETGTGCVHIAPGHGEEDYEFGHLVNGLAV
FT                   ISPVDEKGYFTEEAGKYSGMHIEKANKQIIEDLKNNGSLLKESTIKHSYPHCWRCKKPV
FT                   IFRATEQWFISVEKNNLRQRVLENIQNVAWIPAWGKNRISAMVEERPDWCISRQRAWGT
FT                   PIPAFRCSKCSEVVLDARLIRHFAEIVKKMGTNAWFELSEKQLLPDGYVCPHCGSEDLV
FT                   KMNDTLDVWIDSGSSFEAVLTTRPELTFPADMYLEGSDQHRGWFNSSLVLSVITHDKPP
FT                   YKTVLTHGFIKDAEGKKMSKSLGNVVDPLEVCSKYGADVLRLWLASSDYFNDIRISKNI
FT                   IFQQVEVYKKIRNTIRYLLGNLQDFSVTDSIGFQKMLPVDRWALGRLQQIIKSVTEAYE
FT                   SYEFSKAYNILVKYCSVELSAIYLDIVKDRLYVEGKHSLKRRSAQTVLYNILKSLLVMF
FT                   SPILAFTCEEAYEFLNFGEKKYQTVMAENWPEYKEEYIDTNLMNDFEELLQLRDLVLKA
FT                   LEESRQNGLIGHSLDAKVAIKTGSKKTLDLLKKYSAYLEEFFIVSKVEICNSDENLHIE
FT                   VEHAEGEKCERCWKYDPLTNSDSEFPNICPRCMAVLKEKR"
FT   gene            complement(410478..410840)
FT                   /locus_tag="Tlet_0383"
FT   CDS_pept        complement(410478..410840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0383"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: tma:TM1360
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32950"
FT                   /db_xref="GOA:A8F466"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8F466"
FT                   /protein_id="ABV32950.1"
FT                   /translation="MMKEAKILVVDDEQNLRLLISEELEELGYKVETVSNAEEALKRIE
FT                   SDDFDLATIDIEMPGMNGIELAGILRQKYPALRIILLTAYSHYKYDLASWAADAYVVKS
FT                   TDLTELKETVKKLLQM"
FT   gene            complement(410837..413428)
FT                   /locus_tag="Tlet_0384"
FT   CDS_pept        complement(410837..413428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0384"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; KEGG: tma:TM1359 sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32951"
FT                   /db_xref="GOA:A8F467"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F467"
FT                   /protein_id="ABV32951.1"
FT                   /translation="MSQIAQIICSQANAEHCDLFIYESQKDHFRLVGTTHQHEKIGVLK
FT                   INSNTLMNDSHTIKLEYNGKLTGAIALRNPKNLPAIDNLLEELAFSLWWLDRFTELENT
FT                   AERYHNMSQLTDAFYSYDDQDELKKEMVKVVAKILRADMVLFLEKISENYVFTAGFGID
FT                   RNQLLVESIPQSHPFISKIEKSDSGILNIKTQIDFASIPVKSLIAVPLRLQDRILGVLI
FT                   AINKISEEGYRTRYSFDEFDLSTLHEVARRISLAYTRLEYQNNLKKEIEKLKNYTKRYE
FT                   DLIKQQQLYLKKMDLVHNISNAMRASYDPNNVYKILLLGLTSGRGLGFNRALLLLRDRK
FT                   TETLFGKIWLGPSSEEDITKIWREAERRAMSYGDFSQYLREEALMLDISNGLTKKIEGK
FT                   MFHYKDHPVFERVVLRRKLIHITPPLAKSMGEAVKDLTNLLETEEFAVVPLIGKWDTIG
FT                   VLILDNKFTGNPISEIDTEVLKIIADSAGLTIENATNYEELRKKTESLEQQKNMIDYLR
FT                   KFSESILQNLTTAVIVIDRQGKVLECNKRVEQLLGLPKERVIGSAYTDFGEAFQDVFGV
FT                   AMKVFERGETITLSRYRIETANGERFFDTKYSPLWDIAGSSMNGVIVTLEDVTDQYLLE
FT                   QERKDKEKLALLGEMSARVAHELRNPITVIGGFLNRLKKNISDPQARERYLNILSNEVD
FT                   NLQNIVSEILEFSRSARNIDESKFQINELIEEVAFFMQEKAARNKINLEFMLSPLQEVV
FT                   ADRNRIKRVLINLVQNAIEATPQGGRIILKSQQDQDRVLVSVFNTGEPISEENLRKIFV
FT                   PFYTTKTYGTGLGLPICKKIIEDEHGGRIWAESKPEGTEFKFEIPIKREGE"
FT   gene            complement(413482..413937)
FT                   /locus_tag="Tlet_0385"
FT   CDS_pept        complement(413482..413937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0385"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   ape:APE_2177.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32952"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8F468"
FT                   /protein_id="ABV32952.1"
FT                   /translation="MFFVDRMLGKLAKKLRLLGFDTMYINNIKEEAILQLCQQTGRILI
FT                   TRDKTLHRKAIKKGLKSFLINSEMWRDQLVELSKVFDLRKKDKIMMRCSLCNVDLVISS
FT                   NEQIRKKVPLYVQETQDVFYTCPICGRVYWEGTHVQHIFEEFRRLGF"
FT   gene            complement(414269..414634)
FT                   /locus_tag="Tlet_0386"
FT   CDS_pept        complement(414269..414634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0386"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mta:Moth_2210 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32953"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F469"
FT                   /protein_id="ABV32953.1"
FT                   /translation="MRGRRGRGCGGQFLFSGEMLIPSILIILKKKSIHGYSLIEDLESI
FT                   GIDTSLLHPSIVYRTLRMMEMHGLVASDWNTEGTGPARRIYTITDTGKGFLREWCLKAK
FT                   RDIEMMEKLIKEAEGGE"
FT   gene            complement(414648..415076)
FT                   /locus_tag="Tlet_0387"
FT   CDS_pept        complement(414648..415076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0387"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: tma:TM1816 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32954"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8F470"
FT                   /protein_id="ABV32954.1"
FT                   /translation="MYTCVYIDNMHIDAKIIYEKITGGDSMVIAIPALDNNGLKSRISE
FT                   HFGRAPYFAIVELTDEKIDVKHIANTGEHFHGGSRAIDVVINHNASVVIAHSMGQKALD
FT                   NLHQAGITVLKTIAKTVEEAVFEYKQGKLPEMTEGHVH"
FT   gene            complement(415371..416321)
FT                   /locus_tag="Tlet_0388"
FT   CDS_pept        complement(415371..416321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0388"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: tte:TTE1948 sugar phosphate isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32955"
FT                   /db_xref="GOA:A8F471"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8F471"
FT                   /protein_id="ABV32955.1"
FT                   /translation="MPDPMFQGGQIMKIGFLTVALGNTSIEEIVKWASKEGFEALEVAT
FT                   WPLVNERDFSSTTIDVDQLDKSKIDRIKALFEKNSMIISSLAYYDNNLDANLEKRKKIN
FT                   EHLRKVIDAASLLGVELVGTFIGRDITKSVEQNLEEFEKVFKPLITYAESKNVKLMIEN
FT                   CPMVGWQEHEKVGNIFYSPQLWREIFRITPASFGLNYDPSHLFWLGIDYIKVIEEFSER
FT                   IFHVHAKDVEINRQTLYEQGIFGYYGTNLHGKSWWIYRLPGLGEINWEALSKTLRKAGY
FT                   DFVISIEHEDPVWAGETERSKIGLRMGHEFLRKLF"
FT   gene            complement(416348..417292)
FT                   /locus_tag="Tlet_0389"
FT   CDS_pept        complement(416348..417292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0389"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: dge:Dgeo_2825 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32956"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F472"
FT                   /protein_id="ABV32956.1"
FT                   /translation="MKKVLIFLLLIVTILSFAKFRVGVAIPAADHGWTGGMVWWAQYAI
FT                   KQYANDPDVEFYLVTAKEPSEQIAQVQALLAKGIDALVINPYESAPLTPICVQAFRDGI
FT                   FTIIVDRGINSEEYNVYIAGDNYMYGYLAGKYIAEKLGGKGNVVVIEGIPSTINTERVE
FT                   AFKKALEPYPNVKIIAQQPGYWSREKAFEIMQTLLTKFPNIDAVWTGDDDMLHGVLLAL
FT                   KQAGRDKNIVLVGGACEKNIVKMIMDGHPLIGVDFTYPPNMISTAINLAVMALKGEHLN
FT                   GFYQRGIPRKIILSTETVTKENAKDYYFPESVF"
FT   sig_peptide     complement(417236..417292)
FT                   /locus_tag="Tlet_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.926) with cleavage site probability 0.639 at
FT                   residue 19"
FT   gene            complement(417328..418284)
FT                   /locus_tag="Tlet_0390"
FT   CDS_pept        complement(417328..418284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0390"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ctc:CTC02349 ribose transport system permease protein rbsC"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32957"
FT                   /db_xref="GOA:A8F473"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8F473"
FT                   /protein_id="ABV32957.1"
FT                   /translation="MIFIKTLPKFSFSKYGIIFVLIALMIFSGILSPAFLSRRNILNIF
FT                   WQTSYVGIIAVGITFVMIAGGIDLSVGSMVALMGAFAITMVNKFGDSNLSVVFSIFLTY
FT                   VLGAVMGFGVGLLTTKGKIPAFVTTLGGMAIYRSLVLNFANGGVYMSMSQKYSSIGMKH
FT                   ILGLPLTMIIFIAYTIFAYILLDKTRFGRYVYAVGANETAAIYSAIKVDWVRTMTYVIS
FT                   GISVVTSAVLLSSMMGSVSSSSTGNNFELDAIAAAVIGGTSLSGGKGNVIGTFFGALIL
FT                   GVINNMLVMLNVAVYLQGMVKGLIIIGAVLLQNLKKQ"
FT   sig_peptide     complement(418174..418284)
FT                   /locus_tag="Tlet_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.725 at
FT                   residue 37"
FT   gene            complement(418281..419771)
FT                   /locus_tag="Tlet_0391"
FT   CDS_pept        complement(418281..419771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0391"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_CH03646 probable sugar ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32958"
FT                   /db_xref="GOA:A8F474"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F474"
FT                   /protein_id="ABV32958.1"
FT                   /translation="MSEAVLSARNICMDFSSVRVLHNIDVDFQKSKIYGVVGENGAGKS
FT                   TLMRVLSGFLKPVEGDIFLEGKKVSLDPLKAKELGIILIPQELNLVESLRVYENVFLGN
FT                   EIERGFLIDKRKMIEKTEQYIKKLGLNIDPASYVSKLSPAQKQMVEIMKAISKKVKILI
FT                   MDEPTSSLTDEEISKLFEVALDMKKSGITVVFISHKLKEVKSISDELIILRDGRKVHQC
FT                   ETKELTEKQIAELMVGRDLGKMYPEKPAPSEQIALEVKNITTKDECVKNVSFKVFRGEI
FT                   LGFYGLVGSGRTELMEAIIGLRKHNGKISVFGKEVKIENPEEAKKLGIAYLPEDRKQSG
FT                   IISIMEIFKNTTLMSLKKFSKILLNNHKEVEAFKKYQANFDIKARSPWQPVGTLSGGNQ
FT                   QKVVISRLVETGANILIFDEPTRGVDVNAKHQIYEIMSNMIRELKITFIVVSSELPEII
FT                   GLCNRVIVMRNGTVAATISGDEINEKNLIYYATGLKGG"
FT   gene            complement(419764..420801)
FT                   /locus_tag="Tlet_0392"
FT   CDS_pept        complement(419764..420801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0392"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: csc:Csac_1172 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32959"
FT                   /db_xref="GOA:A8F475"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F475"
FT                   /protein_id="ABV32959.1"
FT                   /translation="MAEKIRFGVIGAGKISEVLHVPNIYNCEYAELIAISDPNAARLDF
FT                   FKRKLNDHRVHFYTDYMELLDKENIDAVVVAVPNSLHAEVALQALKKGKHVLVEKPMAA
FT                   NSEEALKMVKLAGENKKVLMTNHSQRFFPHHQKAKEIVQSGILGEIRLVKTMFSHSGPE
FT                   NWSPTAGWFFRKDSAIFGALGDLGVHKIDLIRYITDLDIIRCVSVTDTLEKKANVEDIA
FT                   CAILKLSNGALATLDANWITKGLEENYIVIYGEKGTMKVGQTNPSKIEIYLEKPVKFHG
FT                   EINMKPLFTNEDPYWKLPVVDHFTKVCLGMEKAIVKPEDGYIAIKIIEKIAESFQKKGE
FT                   VIIDV"
FT   gene            complement(420817..421446)
FT                   /locus_tag="Tlet_0393"
FT   CDS_pept        complement(420817..421446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0393"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: aau:AAur_0760
FT                   uncharacterized protein, LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32960"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A8F476"
FT                   /protein_id="ABV32960.1"
FT                   /translation="MKKILVTAAHSDDLVIGMGGTLKNLSTLGHKIWVVSACGDRISGF
FT                   EDAMHHLGVEALSFPYRYGEIDEEEFSRKIEELFKELKPDIVFTHWQNEILYDHELVGR
FT                   ITLKIARKEEKEVYLFEIPASSLNFDFDIAIDITDFFGHKKQAIEMMKDAFDEKVFLKE
FT                   IMPSVVYTPGFRGIQVGCDFAEVFKHCGSRFPLAPFRKKLLDIARI"
FT   gene            complement(421443..422441)
FT                   /locus_tag="Tlet_0394"
FT   CDS_pept        complement(421443..422441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0394"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: tte:TTE0201
FT                   Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32961"
FT                   /db_xref="GOA:A8F477"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F477"
FT                   /protein_id="ABV32961.1"
FT                   /translation="MFKLKDVANLTNVSISTVSKVLNGKGRVSEKKRREILKVARQLGY
FT                   TPNYHARTMARRSRILTIGLIVPDITNPFFAKLTKGVEKTCGEDALIILMDSFRNLERE
FT                   EKLIKNARFFGIDGIIIGNSRVNDELVLEVSKYIPVVVFDKDYECENVVSIVLDNYHGA
FT                   YSATKHLIENGCTHVVHLGGTHELFVSLQRANGYEAAMRESGFQPRIFATGYDENKGYE
FT                   NMKKILKQGETVDGIFCMNDLVAMGAMKAVKEFGLNIPKDIAIVGFDDDENLCEIISPS
FT                   LSSVHQPVEEMGQISAKLLFELIKKDLKIKRYVFSPHLVIRQSSLKGRESQ"
FT   gene            422723..424024
FT                   /locus_tag="Tlet_0395"
FT   CDS_pept        422723..424024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0395"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Obg/CgtA; PFAM: GTP-binding protein HSR1-related;
FT                   GTP1/OBG sub domain protein; GTP1/OBG domain protein; KEGG:
FT                   tma:TM0098 putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32962"
FT                   /db_xref="GOA:A8F478"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F478"
FT                   /protein_id="ABV32962.1"
FT                   /translation="MQKEDFVDRVTIFVKAGDGGNGAVSFRREKYVPKGGPDGGDGGDG
FT                   GFVILRANPGLSTLLNFKYQRRFIAQNGQHGKGKKQSGKSGEDLVIDVPVGTIVKDANT
FT                   GEVLADLDRSWMMVCVARGGKGGRGNIHFATSVFRAPRIAEKGDKGEERWLELELKLLA
FT                   DAGLIGFPNVGKSSLISAMSNARPKIADYPFTTLVPNLGVVKIDENSEFVLADIPGLIE
FT                   RASEGAGLGNLFLRHIERCSVLVHVIDISGSEGRDFIKDYDVIVQELCKYNEQLSRKPQ
FT                   IIVANKIDLLEKDELEKRLETLEKHANQKIYPVSALLRINIDILKQKIFEIVGKSRLLL
FT                   QKQPVPVFEKPKPIRTKIEERFDFEIKKTQDGFEICGEQIDKWLSRYSLEQKDALERFL
FT                   DTLERNGLSEKLKQMGAHDGDTVWIGQYSFEYKE"
FT   gene            424008..424601
FT                   /locus_tag="Tlet_0396"
FT   CDS_pept        424008..424601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0396"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: cytidyltransferase-related domain;
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   PFAM: cytidylyltransferase; KEGG: tma:TM0097
FT                   nicotinate-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32963"
FT                   /db_xref="GOA:A8F479"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F479"
FT                   /protein_id="ABV32963.1"
FT                   /translation="MNTKNKIGIFGGSFNPPHIGHLIISQYAIEMLQLDLLYIVPTYIP
FT                   PHKSNDLAPFELRFKWCKITFSGPHISISDYEKNRQGISYSLYTVLYFSQLHRTKPYFI
FT                   TGEDSLSYIQNWHKYRDLLENCHFVVYPRYCNKPYEEHTRSVLKELYDSIIFLQAPLIQ
FT                   ISASDIRKRIKERKSIKGMVHPQIEKQVIEYYSL"
FT   gene            424630..425547
FT                   /locus_tag="Tlet_0397"
FT   CDS_pept        424630..425547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0397"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG: tma:TM0096
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32964"
FT                   /db_xref="GOA:A8F480"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A8F480"
FT                   /protein_id="ABV32964.1"
FT                   /translation="MAGITNRAFRKICTFWGAQFSFTEMISAESVVRNFKTVQRMLPKD
FT                   EPNVAVQLFGNDPKTLAQAAKIVEPYAAWIDINAACPVKKVIKKNSGGALLNDLERLEK
FT                   IIGSVKSSVQKPVTVKIRIGFEKNILDQIVHSCIKAGADGIEVHGRTVVQKYSGKAFWD
FT                   LKLSQYGISTAVSGDIFEAEDFHKALEMSGANSALIARGALRKPWIFAQITQKRTPKIT
FT                   EIKETFTKHLKMQIEDEGERSIYKMRQFVAGYTHGMRGAREFREKFMKLNKPEDMEKAI
FT                   EEFFNSFLMNECNNKIVEWIEEQS"
FT   gene            425563..426933
FT                   /locus_tag="Tlet_0398"
FT   CDS_pept        425563..426933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0398"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   tma:TM0571 heat shock serine protease, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32965"
FT                   /db_xref="GOA:A8F481"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A8F481"
FT                   /protein_id="ABV32965.1"
FT                   /translation="MKKLFLVVLMLVASMVSFGYVNPDYQSPVVAVVEQCAPAVVKVEA
FT                   VKYTTSPYFDPFMEEFFKRWFGYNPFGGTQESTSLGSGFIFDKEGLILTNEHVVDGSKD
FT                   ITITLLDGTTYKAEYVGGDEELDIAVLKIKPDRDLPVLEFGDSDSLKIGEWTIAIGNPL
FT                   GFQHTVTIGVVSATGRRIPKPDGSGYYTNLIQTDAAINPGNSGGPLLNIHGQVIGINTA
FT                   IINPTEAVNLGFAIPINTVKRFISQLVETGKTQKAYLGVRVMTVTENLAKAMGLKVNQG
FT                   VLVVQVLENSPAERSGLKENDVIVKFDNVSVSTDAELVSLIHSHIPGDTVKLLVNRSGK
FT                   EINLTVTLGSSAEEGVETAQAAQEFLGIVVDEITDSDRESYSLPASLDGVIVRQVKNSA
FT                   QIQKGDVIYQIAVNGKNNTIKSVNDWNNIVSKIKQGDFVAIFVYRKGAKMIYSFTYR"
FT   sig_peptide     425563..425622
FT                   /locus_tag="Tlet_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 20"
FT   gene            426965..427609
FT                   /locus_tag="Tlet_0399"
FT   CDS_pept        426965..427609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32966"
FT                   /db_xref="UniProtKB/TrEMBL:A8F482"
FT                   /protein_id="ABV32966.1"
FT                   /translation="MKGVKFWLFAIATVAVLAMVGCGPMIPIKSSFAHNVVEVTANVVD
FT                   DDLEDLASWCDGKNILMLWYDFDSQPAGFGDRDDVFSGSPVADKNVYIDNQYAGNYDIE
FT                   TIETIENSINNLKVSLSGTLILYLKANDLLGTSWDLIIGEDNETKAITNYVLVEFEVDS
FT                   TGVYKVTKVQVNGEWENLRSVPKNITDITNKGFAFFRIDDDKVVDARVIYP"
FT   sig_peptide     426965..427066
FT                   /locus_tag="Tlet_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.939 at
FT                   residue 34"
FT   gene            427623..429224
FT                   /locus_tag="Tlet_0400"
FT   CDS_pept        427623..429224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0400"
FT                   /product="PEGA domain protein"
FT                   /note="PFAM: PEGA domain protein; KEGG: tma:TM0841
FT                   S-layer-like array protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32967"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:A8F483"
FT                   /protein_id="ABV32967.1"
FT                   /translation="MRKTLLVVLALIVAAMSFADMQLKNIIIVPKPSELEVKVWLNKPE
FT                   GSVYQVNESLNIFFKANKSCYILIYDIRTDGKITLLFPNKYDSNNYIAPNVTYKLPISN
FT                   LYSFKITPPEGKEYIQIIASTTFLPIIQQLKNLGTTQSFPLLSEDAENYVQKQIMPYLT
FT                   GEWASDITYFYVGKAARTGIAQLESNPSGAYVYVDGKYIGRTPARVELDEGQHFATFYY
FT                   ENDAVTETFFVTANRTVVVTGNFVRKTMLNITTTPPRAQIFLDGNYVGLSPLEIEIQPG
FT                   QHTVLATKDGYKPFQQSFSVSTGETKNINLTLSPISAQLNVFTTPSGASIYVDGKYVGI
FT                   TRPSGLNVDVEPGTHTITARLSNYEDATLTINVQPDEVRTVNITLSPVVRTGTLNIFTT
FT                   PVNASIYVDGKYVGVASSNGLTIDVEAGTHRIVASYPDYEDASINVRVNANEVRTVNLT
FT                   LEPVVKVGTVNINTTPSNAMVYINGYLKGVTPLKIELDYGTYQLVLLKGGYYVEVMDLK
FT                   VNKQNVTVSTTLRIIQ"
FT   sig_peptide     427623..427682
FT                   /locus_tag="Tlet_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(429246..429887)
FT                   /locus_tag="Tlet_0401"
FT   CDS_pept        complement(429246..429887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0401"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   tma:TM1140 acetoin utilization protein AcuB"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32968"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8F484"
FT                   /protein_id="ABV32968.1"
FT                   /translation="MFVRDVMTTDVVTISPDASFSEAMELIRKRGVRRLPVVKNDKVVG
FT                   IITEKDLLSASPSQATTLDVWELTSLLGKLKIKQIMKKDVIHVHPNTPIEEAARIMTDK
FT                   KIGSLIVLENERMVGIVTETDIFKVFINMLGARENGIRYVFRVQNVPGILSKILYLMYQ
FT                   CGGNLIAVTTYEKSRDEYNVVVKVRDLYKQEFERKFLEGMPFASIIDVRE"
FT   gene            complement(429932..430939)
FT                   /locus_tag="Tlet_0402"
FT   CDS_pept        complement(429932..430939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0402"
FT                   /product="Kunitz/bovine pancreatic trypsin inhibitor domain
FT                   protein"
FT                   /note="KEGG: sat:SYN_02414 Kunitz/bovine pancreatic trypsin
FT                   inhibitor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32969"
FT                   /db_xref="InterPro:IPR019283"
FT                   /db_xref="UniProtKB/TrEMBL:A8F485"
FT                   /protein_id="ABV32969.1"
FT                   /translation="MLKKFLILLFSTIALKIYADMGAIHATDAVINENSQKAIIFHNGD
FT                   EEILILSTDLVADKETIIVRFIPFPSQPQVDLAFPKVFETASELIKKYKLQLLEMSKGG
FT                   LSSQGVEMRFHERLGAHDITIIKINDRFQFREWVNDFFQKNGMSYKKEYPEIEKIIEDY
FT                   VERNITYFVFDLVKVSENIHLIEPIMYRFKNRKIYYPLKTTNTFKNQGEVDLILITPWT
FT                   VCFPSQTPFEEYEGFPEYPASTRATTSANIAIYDINKIYPNAENFFKDKRTIIQLIRIS
FT                   YPDNYKFNNDLFIDLSKTLPYAVELAPDYDPFNNIFKDEEDIEKDIFSRWKKEE"
FT   sig_peptide     complement(430880..430939)
FT                   /locus_tag="Tlet_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.937 at
FT                   residue 20"
FT   gene            complement(431174..432553)
FT                   /locus_tag="Tlet_0403"
FT   CDS_pept        complement(431174..432553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0403"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: nca:Noca_3849 PHP C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32970"
FT                   /db_xref="GOA:A8F486"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A8F486"
FT                   /protein_id="ABV32970.1"
FT                   /translation="MNRVLSLLILLTCFFTVFAVKIAGIVTDGENHPIVAQVRFLNPEN
FT                   GILLTDYTNWFGRFQQELPAGKYTIEVCKGPEYEIKRISIELSHDTEEIHINLKRLYNL
FT                   ESMGWFSGDAHLHTIYSDGKQDVETVAKACVACGLSWAILTDHNTIKGGIEWTAASKYG
FT                   LLPILGEEVTTPLGHFNALGISEIVNWKVNEKQDIGRIFADISKQSAIAQINHPFDMKD
FT                   YFVDWDIKGYDVIEIWNGGSAPNLNGMGNYEAKMYWFKILNTGTQIHATANSDCHDVYS
FT                   NYSMLAFLPVDKVLSAIEKEFSEPTMKNYVMENESAMRNWVKYGLYPGTPRTYVKATKL
FT                   TPFAVLKALARGNSFMTNGPLLLIEIDGKGPGEMVSALNKESLNLDIKVFSNTPLEKIT
FT                   VIQGGEIVQEIDVNGQRECILSKEINPDNGSWIVVEAYGPYPVYAISNPIYLSNSYQTT
FT                   R"
FT   sig_peptide     complement(432494..432553)
FT                   /locus_tag="Tlet_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.978 at
FT                   residue 20"
FT   gene            432771..434009
FT                   /locus_tag="Tlet_0404"
FT   CDS_pept        432771..434009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0404"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rxy:Rxyl_0621 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32971"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F487"
FT                   /protein_id="ABV32971.1"
FT                   /translation="MKSKLFMIFLLIVAVLATAGEVTIWSWRSQDAEVWKQVEAELRKA
FT                   GYDIKINFTAYAPTEYDAKIALALQTGTGPDIVYSRRLPGGRTQTMIENKLYLPLNDYV
FT                   DFSNFSSTILKSVTHEGKIYGVPFAVQVVGIFYNKEYYEKYGLKEPETWDELVENAKVL
FT                   KKNGITPFFIPGKEAWALTMQHAMCGVSVLGPEWIKKLTDGETNFLDPKFTDLNKKLND
FT                   LKVYYQDGFLANSTTDQDAAFAFGQAAMVFYGIWGYQNWKNLNPDIQVGYFMVPPATKD
FT                   QKPYAYVYMDGAITLTSNVKNKKDAIEVLKFCATPQFGTIFANITKNIPGVSGATLPKE
FT                   PLFEEIMDVYVNHASPYVYWVGSVFVTQKPSLYDDVLSPGMQELYAGKITPEELSKRAQ
FT                   DAISQWYPPLMKK"
FT   sig_peptide     432771..432830
FT                   /locus_tag="Tlet_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            434054..434953
FT                   /locus_tag="Tlet_0405"
FT   CDS_pept        434054..434953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0405"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rxy:Rxyl_0622
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32972"
FT                   /db_xref="GOA:A8F488"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F488"
FT                   /protein_id="ABV32972.1"
FT                   /translation="MKVKLRYILIFVIPAMLLYTMFVTYPLFDSLRLSFYSWRGVGEKT
FT                   FVGLKNFKELFTGGFSKEVFNALSHNIYFFILVSALELGLGFLIALLIASKIKGAKFYR
FT                   TVVYIPNMIPLVMVGFMWNLFLHPQIGLVNQFLKAIGLGAFARPWLGDPNLALTTIILV
FT                   NVWRNLGFYVLVILASILNISPELIEAAYIDGASNWRVTWKIIFPLTVPTFRTLLILLF
FT                   IGSFNVFDMIYALEGVQAGPFRSTDVLGTVFYRTAFGGLGSAYTDMGLGAAVTVFIFMI
FT                   VMPMSILYVYLVERREKR"
FT   gene            434950..435777
FT                   /locus_tag="Tlet_0406"
FT   CDS_pept        434950..435777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0406"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rxy:Rxyl_0623
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32973"
FT                   /db_xref="GOA:A8F489"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F489"
FT                   /protein_id="ABV32973.1"
FT                   /translation="MIKFSKLNRLIVYIVLSIYAFIIAGPFFVMVMNSFKSMRDIFLRP
FT                   FSLPSKFMYENYLQAWRQAGIGKGYINSTIIAVSSVVAVVFLASMFAYMISKYDFKGRR
FT                   FLFVYSMLGLALPARLAVIPIFLLLRSINLTNSLLGLIIVYSSVNIPFSAFILKNFMDS
FT                   VPNELCEAARIDGASVGNIYYKIILPLIKPALSIVAIVTFVNVWNDFFFPLILINDKSK
FT                   ATITLAVSIFFGEYSTQWHLLFSGLTLSIAPTVILFLIFSRYFIAGMTQGAIK"
FT   sig_peptide     434950..435045
FT                   /locus_tag="Tlet_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.502 at
FT                   residue 32"
FT   gene            435788..436939
FT                   /locus_tag="Tlet_0407"
FT   CDS_pept        435788..436939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0407"
FT                   /product="uncharacterised conserved protein UCP016719"
FT                   /note="PFAM: uncharacterised conserved protein UCP016719;
FT                   KEGG: gtn:GTNG_1290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32974"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A8F490"
FT                   /protein_id="ABV32974.1"
FT                   /translation="MELGIDVFVKKYLSKFRGLQIGLVTNATGVNSDLRRNIDLFLENG
FT                   LKVVKLFGPEHGVFGTAPDGEKLSDFIDPKYGIPVYSLYGEKLRPTEDMLKGIDVLVYD
FT                   IQDVGLRFYTYIYTMIYCMEECAKYGVRFVVLDRPDPLSCKIEGPVVKKEFESFVGGYG
FT                   LALRYGMTPGELAKYVNAAFRIGADLCVIEMEDYEPSLFYDEAGLLWNTPSPNLPSLEH
FT                   TILYEGFCLLEGVNVSVGRGTVHPFKYIGAPWIDSERFYREIKKLSPAGVVFRERVFLP
FT                   AAFKLQNKPCYGLEFFVTDRREIKPLHLAVDVISTLRRIHPYDFRWDSYFHGDNERYHF
FT                   DLLIGDDFYRKAIEDGALSKDFEQIWESESEQFENIIGKFRIY"
FT   gene            437006..438076
FT                   /locus_tag="Tlet_0408"
FT   CDS_pept        437006..438076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0408"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tma:TM0034 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32975"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8F491"
FT                   /protein_id="ABV32975.1"
FT                   /translation="MAIVYFTDMSTNGNVNLLKKVELLLEKIGLEKIIIRDKFVAVKLH
FT                   FGEYGNLAFIRPQYIKVIVDQVKKFGGKPFLTDSNTLYRGHRSNAVDHLLNAYLNGFSY
FT                   EVVGAPIVIADGLRGSDEMRIRIDKTYVKEAKIGSAIALADVLIAVTHFKGHEQTGFGG
FT                   VLKNVGMGSASRAGKLEQHSESKPVVASEKCVACRMCERNCPVNAITVSKFAAINYDVC
FT                   IGCGQCIAMCNYGAMVPKWDSSSEILSKKMAEYTYAVLKDKKSVFISFIMDISPDCDCW
FT                   HTNRPPIAPDIGIAASTDPVALDQACIDLVVQSTGGDPFLKVHPKVTWKTQLEYAENLG
FT                   LGSRQYELVKVACNLK"
FT   gene            438087..439403
FT                   /locus_tag="Tlet_0409"
FT   CDS_pept        438087..439403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0409"
FT                   /product="transglutaminase domain protein"
FT                   /note="SMART: transglutaminase domain protein; KEGG:
FT                   csc:Csac_0385 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32976"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8F492"
FT                   /protein_id="ABV32976.1"
FT                   /translation="MHFMMCSLPQDIQREEGLGNFRKALKLIERWLKDERISSIQKERL
FT                   LYEKERINRLLETYPFSEKQAIVKAKEIIQDFSTEEFHSLLEEGYIDYIVVEGEKKFEK
FT                   RFIPNIGFALNEYRERIKKDPDSEKARSSLNDRLVELTSGAKPKKYRVHARIEAKIEDG
FT                   AGFFRVWLPFPKEEFQISDVKFLRASQKDCFISPNSSEQRIVYFEGKEKEYFVEFEYTV
FT                   REWVHNSGYNIDSNLDQYLCEEPPHIVFTPYIRKLTDTVTGEEKDPYLRARKIYDWITK
FT                   HVRYSYVRPYATYENIAQYVAENLKGDCGFQAILFITMCRIAGIAARWQSGWYANPYFA
FT                   SPHDWALFYVQPYGWLPADLSFGGARRDNEQFRQFYFGNLDGFRMVANSGFARDFVPKT
FT                   NFYRDDPTDNQVGEAEAEDRKVRLKSKIQIVKFEEIQEG"
FT   gene            439407..440438
FT                   /locus_tag="Tlet_0410"
FT   CDS_pept        439407..440438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0410"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: csc:Csac_0386 mandelate racemase/muconate
FT                   lactonizing enzyme, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32977"
FT                   /db_xref="GOA:A8F493"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A8F493"
FT                   /protein_id="ABV32977.1"
FT                   /translation="MSKIIDVKFNLKYFQYEKPFHITGSVSSETKNVEVEIVTDSGIKG
FT                   IGEASPSFRVNGEKVEMLMSLENIVKDMFVGLDVKEYRKIFELTSKFFATPSLKAAVEY
FT                   AVLDAFAESAGVEVYQLLGGALKKIETDRTVGIDTVENRVREAKSIFDDGFKVIKIKVG
FT                   ENLKEDIDAMLEIHEVTRGAKYIVDANMGYSPKQAVEFAQQLYSAGIDVAVYEQPVTAT
FT                   DIDGLRFVRFNNPFPVAADESARTRFDVIRLIKEEAVDYVNIKLMKSGISDALSIVELA
FT                   RSANLRLMIGCMSESSVGINQSVHFALGTGVFDFHDLDSHLMMKEHEFRGKFVQNGPEI
FT                   KAR"
FT   gene            440448..441791
FT                   /locus_tag="Tlet_0411"
FT   CDS_pept        440448..441791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0411"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: gka:GK1392 glutamyl-tRNA(Gln)
FT                   amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32978"
FT                   /db_xref="GOA:A8F494"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A8F494"
FT                   /protein_id="ABV32978.1"
FT                   /translation="MFIYEIQKLIRKKEIKPSEVLEECIKNIEANAKLGAFITLTLDSA
FT                   VKQAKKQDEMLQTADPEKLPPLFGIPIALKDLIFTKGIRTTGGSLFWKDFIPHEDAFIV
FT                   KKLRKAGAIFIGKTNMHEIALGVTNNNPHFGPCLNPHDSSRISGGSSGGSAVAVASGMC
FT                   LAAIGTDTGGSIRIPSALCGVVGFKPTYGRVSLRGIMPLAWHLDHAGPITKCVEDARIV
FT                   LKVIEGYDSKDPFSIRMRNSKIDGKKTTKIKVAKGVGDFVGKADERILKLVDEFSKELE
FT                   KLDMKIEMENTDWLKDVAAANGLMTQVEAAAFHRNRLEEKPEWFSEDVRERLIQGKSAS
FT                   GVEYALARHTQSIAKHRFNEFFKAYDLLLLPTVPVIAPPLHGEGAVELSRKLTRFTASF
FT                   DITGLPAITIPYGKIEGLPVGVQLVAASGRDAFLLKISRIIEQVLANQ"
FT   gene            complement(441785..442417)
FT                   /locus_tag="Tlet_0412"
FT   CDS_pept        complement(441785..442417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0412"
FT                   /product="HEAT domain containing protein"
FT                   /note="PFAM: HEAT domain containing protein; KEGG:
FT                   tma:TM1637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32979"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:A8F495"
FT                   /protein_id="ABV32979.1"
FT                   /translation="MDLDNYKSLIERIVTEKGVDAIPKLVELLTDENDEVREIAFETIQ
FT                   RFGDNAKPILLKIFKDRVHRAQQNDIVLLYLIDVLADMEEKCIKQDLYQLLSRYDNESA
FT                   QLVIYEALAKLGDGDTVIDILCYFVLEDEYKDQLAEQAIMALAHIPSEKSLNCLVDAYK
FT                   NKSFSTEIRQDIIKAISMITMKNPALWDKFTKLNEPELVEKVRQFVY"
FT   gene            complement(442408..444972)
FT                   /locus_tag="Tlet_0413"
FT   CDS_pept        complement(442408..444972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0413"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: tma:TM1636
FT                   exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A8F496"
FT                   /protein_id="ABV32980.1"
FT                   /translation="MSKLRPLTIEIENFLGIKKCNLSFKDGVFLIIGQNGAGKSSLLEA
FT                   IVFALYGTGVRYGKKSPSEYIRSRSSSCQIKFSFLRNGKKYEVIRRIKASGGSEASLSE
FT                   NNAVVTTHRTLVDKELRKIMDISYDSFITTFFLPQGRAAHLLTARRSEINDIVFDVISP
FT                   KKTIKAMQEKISEIVRKLESEHEKYQARLADFRGRLEKLSSQNPHKQISELTNAIQNLS
FT                   GKIDIKQKELKQIEKEKDLWNEINQIEKTLENLEKKKHRVLEEAEEEKKISLAKSLGAE
FT                   YQIFLTSKKQMESLKDDAKVLEKQINSLEYEFKKVNTQLEQLFTKQQDIDKRISQSTSE
FT                   LEKLQKIDIESNELLKKLNELKAVKLRISKDIDDLQNSLNKTQDLIEEKQRLLFQKQKQ
FT                   FFEQESEFNQIKQKAIIHMAQEIAQTLQDGDICPVCGNSYKKSEFSTTVEEKIEKYEYL
FT                   KKAIEMLSKEIDQIQFELKNLLEEKENLTRKLLETQDDLSLHEEEISTVSKKLLQIGYS
FT                   DDLKSKIHNLSKQIQNAMNNKITVQSEISQLKERSDQINKRISELKERLKKNSEQQEKT
FT                   AKELRSNKEKFFEKLGEINFTLEQFESYFKKQLPTHSAVQVLQKIESEIVYNKEKLTQL
FT                   RNLTKISAQQCESLFAELNNTVELLKKQRDNFIRQKAVMEHLIKELEEIRREKENLERI
FT                   FNQIHKEYQIAQSVKSTFSAREFQSYIAKIVLENILIKVNDILDILTDGRFRLSIDENG
FT                   FVVIDDGTKRNADGLSGGEKTLVSLSLAMSIAEIAAGQMEAFFIDEGFSALDEDNKAKV
FT                   AQTLKQMEKLNRVIGFVTHDPQFAEFFDKKLVVEKGGVVKWI"
FT   gene            complement(444944..446047)
FT                   /locus_tag="Tlet_0414"
FT   CDS_pept        complement(444944..446047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0414"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: tma:TM1635 exonuclease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32981"
FT                   /db_xref="GOA:A8F497"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A8F497"
FT                   /protein_id="ABV32981.1"
FT                   /translation="MKILHTSDWHLGLESWTGSKTVDRLAETENALRFLVTAAKKESVD
FT                   LIIITGDVVHNKISPKIEALNVLTNILAEFSSLAPTFLVLGNHDWRGIKALKNLPVKNL
FT                   HIIDSRTEISSGEFKLFFLPYLDFQKTLDESNDFAGDYLSSVFTDIRNNIDREKINLLA
FT                   AHIMIEGLIESERENSMEVQIKASMIPTGLDYVALGHIHALSIVEQSPLMCYAGSPIAM
FT                   DFGEEKDRKGAIIVDFSGERTKIRIVDTPRKQLKTFRKTDYSEQSLESLSNELKSFEGY
FT                   VRVIFNAPPSNEVRKYLMENFECVKKVEFRNEHEKGGYQNLNQQKFDIIQLYQAYIKGK
FT                   YGNLEQPMVKLVEKLFREVEQTEATDN"
FT   gene            complement(446049..446846)
FT                   /locus_tag="Tlet_0415"
FT   CDS_pept        complement(446049..446846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0415"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase; KEGG: tma:TM1728
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32982"
FT                   /db_xref="GOA:A8F498"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F498"
FT                   /protein_id="ABV32982.1"
FT                   /translation="MNVNKFKSMKGKKPIVMLTAYDSVFASIVHQAGVDAILVGDSLAN
FT                   NVLGYSDTLPATMEDMIRHTQAVRRGAPEAFIIADMPFLSYQCSSDEAVRNAGRFLKEA
FT                   GANAVKLEGGSFFSTTIERIVKSGIPVMGHLGLTPQSVNVFGGYKVQGKGDKSAKYLLE
FT                   EAKALEEAGVFSIVLEMVVEETAKMITENLSIPTIGIGSGRFCDGQILVINDLLGMNPS
FT                   FLPKFAKRYSNLFQISLEAVKNYVSDVQNHRFPFEENVFKAGE"
FT   gene            complement(446846..447646)
FT                   /locus_tag="Tlet_0416"
FT   CDS_pept        complement(446846..447646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32983"
FT                   /db_xref="GOA:A8F499"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A8F499"
FT                   /protein_id="ABV32983.1"
FT                   /translation="MNINVVGTSKVAFVLCKILLEEDFSIGCVVSRSKQRAEDFVAKIG
FT                   QGFPKTYEEDFTLKGVTFFAVPDQSISEVYHKLKNRLEEASAFHFSGFLDSEIFKDFDQ
FT                   KGWARGSIHPNLSFADEENALKYIKTCCFGIEGNREGLLVAKQIVEKISNCWVEIPYGS
FT                   KGAYHLAAVIASNFNVALAYLSEKLYKLYNIKGFQEVIPKLMMSSVHNILKKGVQKSLT
FT                   GPVAREDWLIVEKEREIFVKTFPEYKKLYDDMIDILIKIKGEVG"
FT   gene            447724..448629
FT                   /locus_tag="Tlet_0417"
FT   CDS_pept        447724..448629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0417"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="PFAM: thiamine biosynthesis protein; KEGG:
FT                   tma:TM0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32984"
FT                   /db_xref="GOA:A8F4A0"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A0"
FT                   /protein_id="ABV32984.1"
FT                   /translation="MKCRKCSKTAVIRLRQHNTAFCEEHFNEYFEKRVERTINEYSMFN
FT                   KSEKLLVAVSGGKDSSVAWYVLKKLGYTTSGLFIDLGTENNTEIVKKISEKTGEELLIV
FT                   NGKQYFGGLTVAEISRIVKRPTCSICGLIRRYIMNKVAYEKNFDAVITGHNLDDEVSFL
FT                   LGNVLNWQVEYIKRQAPVLESNGRLIKKAKPLVWLTEKEIYVYALINRLTFSTERCPFS
FT                   KNASSLKYKKVLNELEITQPGVKLRFYKEFQKKDLFGSDNEEKARLSECAICGYPTTGK
FT                   VCSFCRLEEMVKDAMGKQED"
FT   gene            448604..449689
FT                   /locus_tag="Tlet_0418"
FT   CDS_pept        448604..449689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0418"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: tma:TM0839 rod
FT                   shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32985"
FT                   /db_xref="GOA:A8F4A1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A1"
FT                   /protein_id="ABV32985.1"
FT                   /translation="MPWENKRIEFYIPVFVALLMIIGLAVIYSATRDSGMNYLKRQIIW
FT                   DILGIIVLFASVFLRERDIRRSVWMVYFAAIASLALVLVFGTTSGGARRWFDLKAGYFQ
FT                   PSELGKIAVVLVSATLLSKPTVKRVLVSLISMSAVLLLIAAEPDLGTAVLIAAVWFIIL
FT                   VCSKASMKLISIILIMIIAMIPFLYFFGLKDYQRDRILSFLSPSTYAQSSAYNVIQSLH
FT                   AIGSGGLLGRGYLKGPATIWKYVPKNHTDFILSVLGEEFGFAGVLTCLFLYMALAFRIL
FT                   RTIMFAKDEFWQLINTGIMATFVLHVFENMGMAMGITPVTGIPLPFISYGGSSTLFFCI
FT                   QLGLVMKSYAVGKAGKKLEGG"
FT   gene            449692..450318
FT                   /locus_tag="Tlet_0419"
FT   CDS_pept        449692..450318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32986"
FT                   /db_xref="GOA:A8F4A2"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A2"
FT                   /protein_id="ABV32986.1"
FT                   /translation="MVRKTRESIVTFLIFLFIVALIGGLFLSVFSFFYYLNQKKEYEKS
FT                   LTSLEKKITTLNERINRLENFIGPNSTMDKLISISGFLSNTTVDLERIVEEIYDDPTTG
FT                   YIRLFVMGQENVWVTFRKNETIYFSRELKPGLAPYKFYYFKSPAVQTEYSLEIPRDCTI
FT                   VIGKPGLVSFLVYGVGTRYHPTKIVTWKDAKISNLEADLSLYIPK"
FT   sig_peptide     449692..449787
FT                   /locus_tag="Tlet_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.344 at
FT                   residue 32"
FT   gene            450465..451307
FT                   /locus_tag="Tlet_0420"
FT   CDS_pept        450465..451307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0420"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: tma:TM1639 electron transfer protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32987"
FT                   /db_xref="GOA:A8F4A3"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A3"
FT                   /protein_id="ABV32987.1"
FT                   /translation="MSNEILKKTKLAPQVYDFIIKNEEIAKRAKPGQFVVVRIREKGER
FT                   IPLTIADTYENSFRMVVRAVGKTTYELCMMEEGQHLSDIAGPLGNPSEIDYFGDVMLIG
FT                   GGVGIATLLPIAKELKRFNNRLHVILGGRNKDYVIMLEEFENLCDELIITTDDGSMGIK
FT                   GVVTDGMDLVMKNTKINIAWAVGPTIMMKFCSIKAKELGIEKIWVSLNPIMIDGTGMCG
FT                   ACRVTVDGKMKFACVDGPEFDGEKVDWDELLKRLSQYRDEEEISFGKFKEQVGDLSWL"
FT   gene            451298..452713
FT                   /locus_tag="Tlet_0421"
FT   CDS_pept        451298..452713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0421"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tma:TM1640 glutamate synthase (NADPH)
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32988"
FT                   /db_xref="GOA:A8F4A4"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A4"
FT                   /protein_id="ABV32988.1"
FT                   /translation="MALKPPAKKVRMKEQEPQERIHNFFEVALGYSEREAMEEAKRCLQ
FT                   CVHHPCVSGCPVGIDIPGFIKKIKENRFYEAVKILKYYNNLPAVCGRVCPQETQCEAKC
FT                   VVGKIPGSEPVAIGRLERFVADWEAVNVKDNQIELPENKNKKVAVIGSGPAGLTAAADL
FT                   AKQGYVVDVFEALHKPGGVLVYGIPEFRLPKSIVDREIAYIKSLSVRILVNTPVGRAVT
FT                   VEELLQNYDAIFIGVGAGTPKFMNIPGTNLNGVYSANEFLTRVNLMKAYLFPEFDTPIR
FT                   KGKKVVVVGGGNVAMDAARSALRLGAQEVTVIYRRTEQEMPARKEEYFHAVEEGVHFRW
FT                   LTQPIEYLGDEKGTLIGVRCITMELGEPDKTGRRKPIPIEDSDFVIEADTVVEAIGTDA
FT                   NRFLLNQFKGLSINKWGYIVADEQTGATTLKKVFAGGDIVTGAATVIEAMGAGKKAAYW
FT                   IGKYLEGEFNPWK"
FT   gene            452727..453140
FT                   /locus_tag="Tlet_0422"
FT   CDS_pept        452727..453140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32989"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A5"
FT                   /protein_id="ABV32989.1"
FT                   /translation="MKITCIFVNISEEFVKQVRNFFRLSEFNLRCVFVSNDVDEITEMI
FT                   FNYAEKENDLLLVFGGVDTREGATSSIALKRICDQRVYTLETLVCEMLAREKRCLLTSP
FT                   TVGMRRKTLIMCLPQDESVFNIISLAIGALKGG"
FT   gene            complement(453149..454306)
FT                   /locus_tag="Tlet_0423"
FT   CDS_pept        complement(453149..454306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0423"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   tma:TM1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32990"
FT                   /db_xref="GOA:A8F4A6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A6"
FT                   /protein_id="ABV32990.1"
FT                   /translation="MKILFKGAHVFPISKKPFTGDVLVENGKIRQIGEKIKPGKGTEIF
FT                   DVSGKYLFPGFIDAHCHIGLYPEGLGATESEGNEMTDPVTAHLQALDAFYPDDVAISKA
FT                   LSGGVTTVFVVMGSANPVGGQGFIAKFNGKTAAEMCIKNPAGVKMAFGENPKRVYSEKK
FT                   IMPNTRMGTASVIRSFLMKSQDYMKKKESILKEGKEFTERDPKYEVGEKLLKRELPARM
FT                   HAHRADDILTAIRIAEEFNLSFVIEHCTEGYKIADILASKKVPVVAGPLLTFATKLELR
FT                   DMTMGALKILSEKGVLTALMCDHPVIPLEHATVQAAAAMRYGVKEEELLKMLTINPATI
FT                   LGLSEKVGSLEPGKDADIVIWSGHPFDMKSVVEKVFIEGNMVYSK"
FT   gene            454409..456094
FT                   /locus_tag="Tlet_0424"
FT   CDS_pept        454409..456094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0424"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: ttj:TTHA0989 GGDEF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32991"
FT                   /db_xref="GOA:A8F4A7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A7"
FT                   /protein_id="ABV32991.1"
FT                   /translation="MGETLLSKLNKLLIFLIALCIFLLSLYIFYLSNSTKARQRIIQAE
FT                   KTLKGAVEFVGMTVHENFFRDDNVYRAVIQEDEVFLKQKLQEIIDKYPNVIRVYIEEVE
FT                   QEYLNSLEIFTVDIVNGNFRLSFKICKKDLSAYVSGKLARVILNAQQFINSLGFDDIQI
FT                   NGASYEYSGPLISSLEILTSALIALCSTFIFAFVARWRKLNLEKRYHEKLHRRTLCQEA
FT                   ILNFTKIVLSGQVEDSYQFLLEKAVELVPGAQAGSLLMKKNDVFVLTHVAGYDPKIAGK
FT                   MFFKPHELAQQIDGRIRIIKDLHQINTQNLDEVRKEFLYSVDKVAKIKSLLSIPIIAKD
FT                   EVVAFLNLDNFENENAFNEEAVNIAELFAGHVGVLFERMRLEEELKIQKQLMEYLSYHD
FT                   PLTDLPNRRMLEEYVEKTFAIASRENKPVCVIYMDLYKFKDVNDTFGHPVGDDLLKILG
FT                   NRLKKEIRRGDMVARFGGDEFVFVLYDVSVEGAIEFSRRLLEFIQKPIVLQNKIFTISA
FT                   NLGIAVYPADGDNFETVLRNADMALYTAKRKEQPFAIFSQISQS"
FT   sig_peptide     454409..454522
FT                   /locus_tag="Tlet_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.406 at
FT                   residue 38"
FT   gene            456111..457844
FT                   /locus_tag="Tlet_0425"
FT   CDS_pept        456111..457844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0425"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32992"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A8"
FT                   /protein_id="ABV32992.1"
FT                   /translation="MKKWALLFSAFLLLCGCLKLDSSKGSLVVKILSEKVIPDSTAVQG
FT                   LIILQNDSRTIQQFFNFPGQSEIGFEGLETGFWNIEVNLLDSHGYALYSAHKQVTVVAG
FT                   QTTSTSISLELNKADLELVISVNSDQIDRINIELSCNEEKIEEQSTVINNAAFFNFSGL
FT                   LSAVWNLRIELYSLDNLIMVCPSSGAYGLELQPGRTNVFQIEIDNFGSVTIEILSNDLE
FT                   AVSNATAVNLDEGISIQWEAVYGADYYDIYRKEGNLWVKMNTDDLSETNFVDTYVEEGE
FT                   EYSYVINARSIDGKHSGFSQPFTIVRDIRRVFVFSNEKIYVFHWNEDRLDNFQEIQVSE
FT                   TLLDIGAENRYLITVGHYPCTFTRYNGTTFSKECQNIFQAYPLSASFNGDYFYTVAGNY
FT                   LLKLSSKTLDYQQFPFPGVARISVDDFLCAADNTGMVSIYALSDFSNYLDRVNGSFAFT
FT                   RGGSVYVFSQGQINIYHVDGQDVTLNKQIAFSRDPLNMRVYNNYIYAGTDNGVYIINID
FT                   DGSQNTIASGLLIRDLEIFDKKLYIVENNELLVYDLINPSMPVFITSTIFPVNCFGVSV
FT                   D"
FT   sig_peptide     456111..456179
FT                   /locus_tag="Tlet_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.465 at
FT                   residue 23"
FT   gene            457859..458335
FT                   /locus_tag="Tlet_0426"
FT   CDS_pept        457859..458335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0426"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: tma:TM0230 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32993"
FT                   /db_xref="GOA:A8F4A9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4A9"
FT                   /protein_id="ABV32993.1"
FT                   /translation="MWLIISDTHDNIPKIRQFLDEAKRRNVTHIFHCGDVISPFALAEF
FT                   LKQDCDFYGVFGNNDGEKILLNQKSSGRMKKGPAELIISKYRILMMHEPISIDAFLEAN
FT                   FFDFVFYGHTHKVDVRKSSKTVVLNPGDASGYLSNQATAVFLEPETGQLEVYHL"
FT   gene            458636..459862
FT                   /locus_tag="Tlet_0427"
FT   CDS_pept        458636..459862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0427"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: tma:TM0802
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32994"
FT                   /db_xref="GOA:A8F4B0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B0"
FT                   /protein_id="ABV32994.1"
FT                   /translation="MRRVLITGMGIVSPIGIGKEKVLESLKKSYIAADTIKSFDPADLP
FT                   VKIASEIKDFNPEEFLDRKLVRRTDRFVHFALVAVKEALEQAKLDLSLHSERTAVLIAS
FT                   GMGGFITLDNENNKFLSGGPGKVSPFLIPMLLINMASGIVAIEYGLKGVNFAPVSACAA
FT                   SGHAIALGSMLIRHGYADVAVVGGAEATIAPLPITGFANMKALSTRNDKPKEASRPFDA
FT                   SRDGFVMGEGAAVLVLEAEEIAKDRKADVLAEVKGYGMNDDAYHMSAPDPEGTGAEKAM
FT                   RMALKDAGISPDKIQYVSCHATSTPAGDAAEAKAIEKLFGREVFVNSTKTLMGHLLGAA
FT                   AAAETVVGILQMHNHFLHAMPNLDEKDPEIKINVVGKKPVEIHFDNFVKNSFGFGGHNT
FT                   SLVIGRYES"
FT   gene            459859..460281
FT                   /locus_tag="Tlet_0428"
FT   CDS_pept        459859..460281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0428"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: tma:TM0801 (3R)-hydroxymyristoyl-[acyl
FT                   carrier protein] dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32995"
FT                   /db_xref="GOA:A8F4B1"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4B1"
FT                   /protein_id="ABV32995.1"
FT                   /translation="MNIDEIKQILPHRFPMLLVDRIVEKSEDHAKAIKNVTASEIFFLG
FT                   HFPAYPIYPGVLIIEGLAQTAGLMLLNRGESVIPVFAGIDNARFKSEVRPGDVLEYEVW
FT                   LKERKLGMAKVEAIAKVQGKIVATATLLVGVRKNEK"
FT   gene            460271..461209
FT                   /locus_tag="Tlet_0429"
FT   CDS_pept        460271..461209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0429"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   tma:TM0800 enoyl-acyl carrier protein(ACP) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32996"
FT                   /db_xref="GOA:A8F4B2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B2"
FT                   /protein_id="ABV32996.1"
FT                   /translation="MKNRVTELLKIKYPILMGGMAWAGTPALAAAVSQAGGLGIIGSGA
FT                   MRPDELEIAIRTVKNLTDKPFGVNIMLASPYADQLVEVVISEKVPVVTFGAGNPAKYIP
FT                   NLKKSGAAVIPVVASDSFAKLVERAGADAVVAEGMESGGHIGEVSTVVLTNRVSKSVTV
FT                   PVIAAGGIADGRGMAAAFALGAEGIQMGTRFLATIEAEIHESYKKKILTASIRDTVVTG
FT                   AKLGHPARVLKTPFAKKVCELEVNNSLEAEQVLVGSLREAVLNGNLERGSFMAGQCAGL
FT                   IDEILSVKDVIEKIMREFVETVKKLYEEVKK"
FT   sig_peptide     460271..460360
FT                   /locus_tag="Tlet_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.782 at
FT                   residue 30"
FT   gene            461206..462111
FT                   /locus_tag="Tlet_0430"
FT   CDS_pept        461206..462111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0430"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: tma:TM0798
FT                   malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32997"
FT                   /db_xref="GOA:A8F4B3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B3"
FT                   /protein_id="ABV32997.1"
FT                   /translation="MKAFLFPGQGSQYSGMGNDLTSFSRAYYFFETAREVLGIDIFQVM
FT                   NGDEDFLKLTENAQPAIYIASYIAFDELIRAGYVPSLLAGHSLGEYTALAAADVYDFET
FT                   GLYLVRKRGEYISQSVKPGEGTMAAVIGAKIDEIEAAISDIDNVWVANHNSEDQVVISG
FT                   MVESVRIAIERLKKIAKRVAELKVSGPFHTPLLESAREKMAHELRGIKFRKPRWPIVMN
FT                   STGRETTDPEKIRENILSQICGPVLWYDSINRMIQLGAKSFIEVGPQKVLTNLLKRSKS
FT                   APCKHFTEIVFERQFEAVGI"
FT   gene            complement(462115..463686)
FT                   /locus_tag="Tlet_0431"
FT   CDS_pept        complement(462115..463686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0431"
FT                   /product="Chloride channel core"
FT                   /note="PFAM: TrkA-C domain protein; Chloride channel core;
FT                   KEGG: cno:NT01CX_0195 voltage gated chloride channel family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32998"
FT                   /db_xref="GOA:A8F4B4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B4"
FT                   /protein_id="ABV32998.1"
FT                   /translation="MGGSGYRKNRYFADILSTKKVLTNKLIFKSFLTGAVSGLVVVLYR
FT                   LSITCAENIRSSIKYGSWFIFWIFMTVGFSLIIWWITKKVPHVNGSGIPQVRAILLRKI
FT                   NYEPLKVLLGKFFGGFLAIINGFSLGREGPSVQIGASVGLIFSNKFAKNDLEKKHMIVA
FT                   GSSAGLAAAFNAPFAAVIFSIEELQRNISPLTLLTSMIAAITAGYISKVVFGVAPIFDL
FT                   KLSSVLPLKYYPLILGLGVVIGIFGAFFTKSILWFSEQMGKLKVFSLMIPTIAAWFFLL
FT                   KIPQVLGGGHELIMDVAHGLFSAKMLIVLLVLKFYFTMISYGSKAPGGIFLPMLAIGAL
FT                   IGSAYYHLINVFWNFNDSYLTNFVVLGMASYFASVVRAPITGIALVTELVGSFNHLLSL
FT                   SVVSISAYIISSLFKVSSVYDMLFERLPLSKTAQAKRTSVIRVTVTPDSELAGLKIKDC
FT                   VLPESCLIAFIKRDNNEIIPNGETVIHPGDVLTIILNQNDEIPHFLPPGRGVIESNEVL
FT                   SFIKNE"
FT   gene            463902..465671
FT                   /locus_tag="Tlet_0432"
FT   CDS_pept        463902..465671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0432"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: mta:Moth_1449 ribonucleoside-triphosphate
FT                   reductase, anaerobic"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV32999"
FT                   /db_xref="GOA:A8F4B5"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B5"
FT                   /protein_id="ABV32999.1"
FT                   /translation="MKNMVEQYLLLKDWRIRENSNMNYSLQGLNNHIVSEITSDYWLKC
FT                   VYTEKISKAHMEGDFHIHDLNLLAPYCCGWDLRDLLINGFGGVDQKIESKPPRHFRVAL
FT                   MQIVNFFYTLQGEAAGAQAFSNVDTLLAPFIAYDKLSYQEVVQCLQEFVFNLNVPTRVG
FT                   FQTPFVNITMDVVVPKYMANEPVIVGGQFQEKTYGEFQQEMDMFNKAFCEVMLEGDARG
FT                   RVFSFPIPTYNVTGNFPWESEVGYMILQMTAKYGIPYFANFVSSGLSPEDVRSMCCRLR
FT                   LDNRELYIRGGGLFGANPMTGSIGVVTINMPRIGYLSGTEEEFFKRLNSIMEIAKESLI
FT                   VKRNAIEKFTEWGLYPYSKVCLKKVKKFFGQYWHNHFSTIGLVGMHEALMNFFKRGIDT
FT                   PEGKTFAMRVLDFMREKLLIFQQETGTLFNLEATPAEGASYRLAKLDKECFKNIYTSGE
FT                   NEPYYTNSTQLPVNYTDDLFRALQIQEDLQLKYTGGTVFHIFLGEKVEDAYSLGALIKR
FT                   IFENYRLPYITVTPTFSICRDHGYIGGEEYSCPVCGQPTEVWSRVVGFYRPVQNWNPGK
FT                   REEFIHRVNYVVN"
FT   gene            465685..466386
FT                   /locus_tag="Tlet_0433"
FT   CDS_pept        465685..466386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0433"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: tte:TTE1849 pyruvate-formate
FT                   lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33000"
FT                   /db_xref="GOA:A8F4B6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B6"
FT                   /protein_id="ABV33000.1"
FT                   /translation="MYVQGWVKVSLLDFPKEPCSTVFISGCNLRCPYCHNSMLVTVDKS
FT                   LAQTKWKEVLAWIKSNRKLINAVCITGGEPTLRKDLYLMIHLAKELGIKVKLDTNGTQP
FT                   YIIEKLIRLKMVDFVAMDIKAPLSKYEKVCRASVDLDSIKRSVEVIRSLAPEYEFRTTY
FT                   HPDLLSVEDFLEICKWLDRSSNYVLQRCRIGENLDPSFNKMPVYYSLGEIIKLLRNHFQ
FT                   HFTLRGFSEFA"
FT   gene            466437..467243
FT                   /locus_tag="Tlet_0434"
FT   CDS_pept        466437..467243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_1349 phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33001"
FT                   /db_xref="GOA:A8F4B7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B7"
FT                   /protein_id="ABV33001.1"
FT                   /translation="MRVGFLIDGICPGANQFIYTLTNYLSSITGFFHGWQGLLENDFKL
FT                   IRANEIEQFKKMGGSIVGSTRKISIFHDWKSKVIRVLTMNHIDLLVVLGSERSFPMVSE
FT                   LFSAGVKVVLLPCADSGSFCFSYRLGLTTVTLQLLNFFHSLNRYDHGSVTVLFPNGIED
FT                   VISKLRLASDFVLLRESDKASVIFRNHPARETTTIKILGMLSSAFPEKKDIEFARVCAK
FT                   KLVDYLDNPKGGVLAEIDGGLKIIPLQYIKSQTEFTVERILEKVRE"
FT   gene            467247..467771
FT                   /locus_tag="Tlet_0435"
FT   CDS_pept        467247..467771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0435"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: tma:TM1551
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33002"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B8"
FT                   /protein_id="ABV33002.1"
FT                   /translation="MKGEHPYVKWAIKSIEAWLKEKRLLNPLKDGAPVELLKRRAGAFV
FT                   SLHKLDGSLRGCIGTYVPTKENLAEEIRDNAIAAAVEDPRFLPVSTNELDDIKVSVDIL
FT                   SEPEEVSGINQLDPKKYGIIVAKGYRRGLLLPDLEGIDTVQEQLKIARRKAGILDNEKI
FT                   TVYRFTVERFY"
FT   gene            467783..468772
FT                   /locus_tag="Tlet_0436"
FT   CDS_pept        467783..468772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0436"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: tma:TM1552
FT                   pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33003"
FT                   /db_xref="GOA:A8F4B9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4B9"
FT                   /protein_id="ABV33003.1"
FT                   /translation="MQKMALYFTSLSDEKIKCELCPHHCVLENGQIGFCLTRKNKEGIM
FT                   ELLNYGQITSICVDPIEKKPLFHFNPGEKILSVGTFGCNMKCAFCQNWEISQQPAPTRR
FT                   VLPEQLVSIALERGSRGIAYTYNEPFVWFEFVLDTSRIASKEGLYNVLVTNGLVEEDPL
FT                   SLLIQSIHAINVDLKAFEEETYRRLGGDLNTVKRTIKVAVEAGIHVEITTLIVPGISDD
FT                   MEHLEEEFKWLASLDKSLPLHLSRYFPNYRMSNPATSNSKLIEAYNLARQYLDYVYIGN
FT                   LWDSNYESTVCPSCGTLVVRRDRYEIQNEGLDREGRCKKCGKKIAKVF"
FT   gene            468742..469794
FT                   /locus_tag="Tlet_0437"
FT   CDS_pept        468742..469794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0437"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: tma:TM1553
FT                   thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33004"
FT                   /db_xref="GOA:A8F4C0"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C0"
FT                   /protein_id="ABV33004.1"
FT                   /translation="MRKKDRESFLRTNRLLFILLFVGLAIIFSLTAAVFVRSQHNYYEY
FT                   DGFTLGTYCRIVVSSKKGSKSLAEIMFDEMDRIYKKYNLNDENSFLSKINTSKDWVDLD
FT                   EETFVLLDAAVKFSEITSGAFDPALGNLIELWGFNKIAEHSPETVPSKFDIAETLKKSG
FT                   VRNVELDRNTRRIRLLNGVKLDLGGIAKGYALDRAYQIAKEIDPECTGFVEAGGDIRIL
FT                   GPKFGSRPWVVGVKDPRKADSVVTYLYLTEGAVATSGDYERYFILDNVRYHHILSPETG
FT                   YPAQGAQSATVVAKDAVTADALSTAAFVMAKDWEYVVLEYPKFGGSVLIITEDGSVCRS
FT                   PSMRVYEQAK"
FT   sig_peptide     468742..468840
FT                   /locus_tag="Tlet_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.950 at
FT                   residue 33"
FT   gene            469778..470143
FT                   /locus_tag="Tlet_0438"
FT   CDS_pept        469778..470143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0438"
FT                   /product="protein of unknown function DUF1312"
FT                   /note="PFAM: protein of unknown function DUF1312; KEGG:
FT                   tma:TM1554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33005"
FT                   /db_xref="GOA:A8F4C1"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C1"
FT                   /protein_id="ABV33005.1"
FT                   /translation="MSRRNKFFRKADFLVILVILLIIVISFFVKDKNSSQVEVWKNGEI
FT                   AMVIKQAGEYELREGDNHLMNIYFDGKTVFVKNSSCSLKICEKTGKVGPGGVIICVPNR
FT                   VLIKFSGKMPKADVITW"
FT   gene            470140..470715
FT                   /locus_tag="Tlet_0439"
FT   CDS_pept        470140..470715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0439"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: tma:TM1555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33006"
FT                   /db_xref="GOA:A8F4C2"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C2"
FT                   /protein_id="ABV33006.1"
FT                   /translation="MRAKRIALTALMISLGVVTYVLESVVPFPIPNGKWGFSNFVVLLS
FT                   IFAFGGVEGIKVAIGKSLIGSILTGHFMDVAFFMSVAGSSSAALIETVLSRVGFFGLFG
FT                   VSLCGSIANNIAQIFVGSVFLQSKSFFIILPYMLFLGIPGALANAYIVKRVLPYVERIQ
FT                   VSTGFDFTTKENAAQETVPQIRNNRSGN"
FT   sig_peptide     470140..470211
FT                   /locus_tag="Tlet_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.673 at
FT                   residue 24"
FT   gene            470612..471214
FT                   /locus_tag="Tlet_0440"
FT   CDS_pept        470612..471214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0440"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: tma:TM1556 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33007"
FT                   /db_xref="GOA:A8F4C3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C3"
FT                   /protein_id="ABV33007.1"
FT                   /translation="MLKEFRLVLASTSPRRKMLLKKLFRRFEIIAPEIEEKNFETAQET
FT                   VEKLSILKALNVYEKVSDAIVIGADTIVEVDGNILGKPENNSEARCYLRMLSNRSHIVH
FT                   TAVAVVSRGEVWTKYRYTTVKFRKIPDEFLDSYISIYSFDKAGGYGIQDLGGVLVEGID
FT                   GDLYTVMGLPIGDLWEYFYSKGWWSFETEREDAENWI"
FT   gene            471177..471854
FT                   /locus_tag="Tlet_0441"
FT   CDS_pept        471177..471854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0441"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: helix-hairpin-helix motif; DNA repair protein
FT                   RadC; KEGG: tma:TM1557 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33008"
FT                   /db_xref="GOA:A8F4C4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C4"
FT                   /protein_id="ABV33008.1"
FT                   /translation="MKPRERMLKIGSEGLSKEELIAILLRTGTRGKGVLELANELLHSF
FT                   NSSLKMLANAEIEEIASVDGVGIAKAASIKAALELGKRLYRELSDNRILLDKPESVYEY
FT                   CHEMRFFEKEVLRVILLDSKLFSVFHKDITQGTNNQTIFHPREIFRIAIRSNATSIIVV
FT                   HNHPSGDPSPSAEDKKATEMLISAGDILGIEIIDHLIVGRERYYSFRENRLLGDRKGGR
FT                   RKR"
FT   gene            471835..473055
FT                   /locus_tag="Tlet_0442"
FT   CDS_pept        471835..473055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33009"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C5"
FT                   /protein_id="ABV33009.1"
FT                   /translation="MEEEKDERILNLLRLKMELEKDLQKRGVKQTDHPKRSFVPPKVKV
FT                   SIEEDLNVPVNEIWSLYDLNRFTYGEDELLIEKSVQKRIISVGDKNQRLILEKIVHLLK
FT                   GDYDGCVGLSKKSDQYLDSIDLIADLYKNQTPPVEKMVSLLRNYSSSPVALLSAGEVLL
FT                   SMGRFREVAKLFKIAYETSKDPYILLLTSAYDSAQIDGALFANCASKGNYKLLVLLISA
FT                   LTEDESKADKVIDVIKKKQYTCVRYIVSRANLSIDELFPFCPRSLILNNAIQFMETGRF
FT                   DEDLISTLSKHDPQAYLLLLSNALRRGDLVMAREILSMIINSAEGVSVTPVNKSKAPVC
FT                   LQSVVSMRKPMGKSILIDDPDEGLTIIQKSIEQFGDVYVTFKDIEFLRLYYGERFCKNN
FT                   YLQEGSK"
FT   gene            473052..473600
FT                   /locus_tag="Tlet_0443"
FT   CDS_pept        473052..473600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0443"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tma:TM1558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33010"
FT                   /db_xref="GOA:A8F4C6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C6"
FT                   /protein_id="ABV33010.1"
FT                   /translation="MISREEALELVKLHVKSKNLIKHCLAVEVVMKFLAEKFSEDVNLW
FT                   AISGLLHDLDYDYTKDNPENHGLKTIELLKNYDIPQSVKDAILAHCDKKNRVTNMEKAI
FT                   YVADPTTGFIVAAALITPEKSLSSVDTDFLLRRFKEKLFAKGANRDQMKRCEDLGLSLE
FT                   EFLTLSLDAMKSISHDLGL"
FT   gene            473611..474345
FT                   /locus_tag="Tlet_0444"
FT   CDS_pept        473611..474345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0444"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   tma:TM1559 deoxyribose-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33011"
FT                   /db_xref="GOA:A8F4C7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C7"
FT                   /protein_id="ABV33011.1"
FT                   /translation="MSSLEYLIEERIVRYKEEYKFEPFLKEVSREMVRKSIEHTLLKPT
FT                   ATVEDIVALCEQAKEYKFCGVCVNPSFAETSLQLLKGSGVKVISVVGFPLGTNTQLSKA
FT                   QEASELIRIGVDEIDMVIHVGMLKSHEWSYVYEDIRGVVEACKGKPVKVIIETCYLTNE
FT                   EKIAACVISELAGASFVKTSTGFGPAGATAEDVNLMKWSAPKLSVKASGGIRSYNQAID
FT                   LIKAGATRIGTSSGTKIISEEV"
FT   gene            474348..474986
FT                   /locus_tag="Tlet_0445"
FT   CDS_pept        474348..474986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0445"
FT                   /product="Formiminotransferase-cyclodeaminase"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase; KEGG:
FT                   tma:TM1560 serine cycle enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33012"
FT                   /db_xref="GOA:A8F4C8"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C8"
FT                   /protein_id="ABV33012.1"
FT                   /translation="MSIEKISLREFTEKVSDRNPTPGGGAVSAFVGSLAASLVEMVANL
FT                   TLLREDYSEWHTEMERVIELMEETRVALLESVDLDIKAFDEVMNAYRLPKSTNEEKERR
FT                   TQAIQEALKAAAHVPYETCRHLKEIAKCALIVAKWGNVNAISDAISAAELAMGSFYSAR
FT                   ANVLINLKSIKDEDFKNNMLHELKTFAGEMEGALKSVRQIASERAKILF"
FT   gene            474955..476136
FT                   /locus_tag="Tlet_0446"
FT   CDS_pept        474955..476136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0446"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase; KEGG: tma:TM1561
FT                   tRNA guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33013"
FT                   /db_xref="GOA:A8F4C9"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4C9"
FT                   /protein_id="ABV33013.1"
FT                   /translation="MLQKEQRSCFEIVSKFGEARVGKLHTNHGDYETPVFMPVGTNANV
FT                   KLTDTMRLKEIGAGIILGNSYHLAVRPGLDVIRLHGGLHQFMGWKGGILTDSGGFQVFS
FT                   LRKLRDIGDDGVLITSPVDGSKMLLTPELSMEIQSTLNSDIVMVLDHCPGPEDSYTESM
FT                   VSAKRTYNWAMRCLKHGVNEHQLLFAIAQGGVYEDLRKLSAEQLSQLPFDGFAIGGLSL
FT                   GEPFEKTLYLTQITVSALPSENPRYFMGGGSPALIIQLVEMGVDMFDSVFPTRLARHGA
FT                   ALTWKGRLNIKSARFKRDLQPIEENCDCFVCQNYSKSYLHHLFDRKEVLGGILLTYHNL
FT                   HFMMKFMNKIRNSIEDGTFKTLKREVLDVYGKGKKADLYVDAAISDNNNGRYN"
FT   gene            476120..476911
FT                   /locus_tag="Tlet_0447"
FT   CDS_pept        476120..476911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33014"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D0"
FT                   /protein_id="ABV33014.1"
FT                   /translation="MGDIIDFSGDGRYASATGPWAFRMNPAGIVENEFRQLLISNTLRM
FT                   GSNNVRSFSVSLLQPSEDSLAGVLQLSSDFTDFEMGRLSFLYGIAGRASTVDLGLNIGF
FT                   ERIEEDSQEDYSVFIDVGARGKFSEDSYAYYSIVVKKFRVWSSKSDLMNTADIGGGVSL
FT                   EFDQMKFSFDVMYVSNELWNFSPAAELSLAPVNLYVCIPLFYLPENSKSALSVDFGGDV
FT                   QIGNFNIGASVFYPFTKLNSSDLFGELGYDWHIDFRVGVRW"
FT   gene            476905..477444
FT                   /locus_tag="Tlet_0448"
FT   CDS_pept        476905..477444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0448"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: pth:PTH_1813
FT                   pyrimidine operon attenuation protein/uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33015"
FT                   /db_xref="GOA:A8F4D1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D1"
FT                   /protein_id="ABV33015.1"
FT                   /translation="MVRKVKVLSEDDIERSLKRIAHEVLEKNRGAQDLILMGIMTRGVF
FT                   LAKRLAALIESIEKVTVPVGELDVGPYRDDGKKTDYCKTKVRFPIDGKIVVLVDDVLFT
FT                   GRTVRAALGALSDIGRPRMVQLAVLIDRGHRELPIRPDFVGKNLPTSKNRERVNVNLSE
FT                   IDGEDGVYIIHLEESV"
FT   gene            477444..477686
FT                   /locus_tag="Tlet_0449"
FT   CDS_pept        477444..477686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33016"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D2"
FT                   /protein_id="ABV33016.1"
FT                   /translation="MGISFERYIKAIEKVLNNMVEKERVNVDVSELWIDTSIPEDLIVE
FT                   IIKNCQLEYPEALESITYDGKTLWKRDHDLRDSNI"
FT   gene            477661..479874
FT                   /locus_tag="Tlet_0450"
FT   CDS_pept        477661..479874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0450"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; KEGG: tma:TM0178
FT                   primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33017"
FT                   /db_xref="GOA:A8F4D3"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D3"
FT                   /protein_id="ABV33017.1"
FT                   /translation="MIYEIAISKIPLRKSFLYQYSGELESGERVLVSFNSRDCVGYVLC
FT                   QSELSDNIDLREIKEIKERIDGLSFVNPRDVELIKWVARRFYSPIGQLFDMMIPAFVDD
FT                   YAKTMVESTSELIPLESMSLSEFISKYGEKTLKMYLKKGYIKLRRIFAAKQPRPRVGNL
FT                   YLFLNKNLEEAILTAKNPDEYDVLNYLFANEGATVNQVVESTGVTVKKIRKMMDKGLLR
FT                   ASDMPSIQSALIEKNRENQLIIDDNEPEKKVISGGTVEERFNLILPLIKNAIESGCSVL
FT                   YLVPLSSQIPYIAGMVQKSLDVRTYVYHGNLSKSQKALVWISAYKGETGVYIGTRNTVF
FT                   LPIKKLGAIVVENDEDESYYQFEEPVFDCVEVAQKRAFLYDVPLILSSASGRLDDFSDL
FT                   ENSCILKLQTSSRNVILVDMKKQNSFLSDQLVENMRKVLNDGKNILLLTRRKGYSPFVR
FT                   CLVCGYTVLCPNCDVAMSFHKSENLYKCHQCGYVEQVSDICPKCGAHALYPKGFGTERI
FT                   ERLIKYNFPSARVARIDRDTTNFRELLNRLFEFQKGELDILVGTRIILHGFTYPKLGLL
FT                   GFVDIDSLLFQPDYNSKIRVYQQLRQGLQMAPNALMVIQTAEPDSDLIKYLFSSEYCFY
FT                   QEELERRKSGNYPPYSFLVQVVLESDNPSIGWDLISSCVDSLRDEEVLGPVEHAVFKLK
FT                   GKYRFHFLIKTRELDDTLSKLDGKLNEIGWKGWRVFINPPHLW"
FT   gene            479886..481238
FT                   /locus_tag="Tlet_0451"
FT   CDS_pept        479886..481238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0451"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: tma:TM1629
FT                   glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33018"
FT                   /db_xref="GOA:A8F4D4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4D4"
FT                   /protein_id="ABV33018.1"
FT                   /translation="MRCIVLAAGMGVRMNSKYAKVTHTVCGKPMIRWILDTVLNLLDKV
FT                   CVVVGHDADSVKKLLPENVEVVHQSQQLGTGHAVMSARNFIDPADNLLILYGDMPLITE
FT                   GTIQKIINSHNLSNCDATVVSVEMNDPTGYGRIVRDKSGKFVKIVEESEASNREKAIVE
FT                   VNTGVYIFNGRKLLEVLPMINCKNKKGEYYLTDVFAFLERVNIYKSERSCEFIGINNRI
FT                   QLAQAEKFRRQWILEELMIKGVTIVDPETTYIDADVKIGRDSIIYPMSFIHGDTKIGED
FT                   CIIGPMTRIIDSYIGDRVTIVRSECKGARIMSDVSVGPFSRLREGTVLCNGVKIGNFVE
FT                   IKNSEIDQNTKAQHLTYLGDAVVGKSVNIGAGTITCNFDGKRKNQTVIEDEVFIGSNTA
FT                   LVAPVKVEKGAFVAAGSTINRNVPAWSLAIARARQEIKLNWVIDKRKKEED"
FT   gene            481238..482188
FT                   /locus_tag="Tlet_0452"
FT   CDS_pept        481238..482188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0452"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase; KEGG: tma:TM1628 phosphoribosyl
FT                   pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33019"
FT                   /db_xref="GOA:A8F4D5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D5"
FT                   /protein_id="ABV33019.1"
FT                   /translation="MPFQRNDLKLFAGNSNPELAKRVADYLGLRLGDCQVSRFSDGEIN
FT                   VKINETVRGHDVFVLQSFSPPVNENVMELLIMIDAFRRASANSVAVVLPYYGYARQDRK
FT                   AKGRDPITAKLVANLITVAGANRVLTVDLHAEQIQGFFDIPLDNLYSFPVFIDEIMRMH
FT                   GDEKEKLVVVAPDVGAVKRASKFAEKLGVPLAILDKRRPTDNVAEVVHVIGEVKGKVTV
FT                   VFDDIIDTAGTLVQGAEILKKSGAERILACATHGILSGNAVDRIEKSDIDKVYITDTVY
FT                   HKGLSSKFHVVSVSALLGEAIIRIRKNLSVSILFR"
FT   gene            482203..482853
FT                   /locus_tag="Tlet_0453"
FT   CDS_pept        482203..482853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0453"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG: tma:TM1627
FT                   50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33020"
FT                   /db_xref="GOA:A8F4D6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D6"
FT                   /protein_id="ABV33020.1"
FT                   /translation="MRLKAMLRNERGKRSVRKMRAKGLIPAVVYGPETEPLSINLNKSE
FT                   VEKLLAKASEALPVGLEIKYDDRSEEMEVFIKKVQVDKVTDEIVHIDFYKPAKGHTMKI
FT                   NVPIRVFGKAIGVEKGGILEIVHNELPVETLPSALIDHIEIDVTHLELGQSVHVKDLRL
FT                   PSGMKALLHPEEALVTIVVPRGLLVEEAHEAVEVQETAEPEVIKKGKKEEEED"
FT   gene            482850..483413
FT                   /locus_tag="Tlet_0454"
FT   CDS_pept        482850..483413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0454"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase; KEGG: tma:TM1626
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33021"
FT                   /db_xref="GOA:A8F4D7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4D7"
FT                   /protein_id="ABV33021.1"
FT                   /translation="MKVIVGLGNPGPRYAFNRHNVGFMFVDRFKEFKKCSTWQHRDRYT
FT                   FSQCKDIFLVKPNTFMNLSGIAVIKCQRDFHVTTTDIIVVYDDVDLPCGRLRIKAQGGS
FT                   GGHRGLQSIIDYIGTNEFVRLRIGIGPKPENIDLADYVLEDFTEEELRLIDKVLDKAVE
FT                   AVDVMLNEGLSKAMSVFNSYEVVL"
FT   gene            483410..483841
FT                   /locus_tag="Tlet_0455"
FT   CDS_pept        483410..483841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33022"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D8"
FT                   /protein_id="ABV33022.1"
FT                   /translation="MKCNSCGGPGEKFIRFVSDGMVKEINYCTDCLRRSLREAPVFSKE
FT                   GIKYIAAHIEIVQDTDLREISPDGSGTSDVIFSIAPVAVLRILFDKDNVSQTDLNEAAK
FT                   RRIYVLQHRLEEALKQEDYKTANKIKKQINDIRERILEK"
FT   gene            483844..484713
FT                   /locus_tag="Tlet_0456"
FT   CDS_pept        483844..484713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0456"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: tma:TM0158 prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33023"
FT                   /db_xref="GOA:A8F4D9"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4D9"
FT                   /protein_id="ABV33023.1"
FT                   /translation="MVGRIIIFGLCFVLLFFFLSNVFSGNLILSSAILKLGRFEIRYYS
FT                   VFILTGVILAYILARKRALKEGVKAEQLDELIFYAIIFGIVGARLFYVIFNWNYYRNNF
FT                   IEIFMVWHGGLAIQGAIVFGITVFILYSKIKKNLTFSIFQALDLGALYLPLGQSIGRWG
FT                   NLFNYEAFGGPTTLPWKMYVPSGFRPIKYINYEYFHPTFLYESIWDFSIFLLLILYIER
FT                   HRKNHGEVFALYLCFYSLGRICIESLRLDSLFWGEVRVAQLFSAILMIAGFILFIYRRG
FT                   GLSDLRDR"
FT   sig_peptide     483844..483918
FT                   /locus_tag="Tlet_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.967 at
FT                   residue 25"
FT   gene            484742..485323
FT                   /locus_tag="Tlet_0457"
FT   CDS_pept        484742..485323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0457"
FT                   /product="bis(5'nucleosyl)-tetraphosphatase, ApaH"
FT                   /note="PFAM: metallophosphoesterase; KEGG: tma:TM0742
FT                   serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33024"
FT                   /db_xref="GOA:A8F4E0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E0"
FT                   /protein_id="ABV33024.1"
FT                   /translation="MLLNLLPLEKSDRLIFLGDYVDRGPDSKLVLNKLISLRDVYDCVF
FT                   LRGNHEWMMLNYLDEGRDFELWSINGAMATIRSYGGIEKIPREHIEFLHSTVFYHVETD
FT                   FVFVHAGVRPSIPLEKQSYFDLVWIRDEFIFCDEPLKDYTVVFGHTPFEKVFFGKNKIG
FT                   IDTGCVYGGNLTAMRLYDRKIFQIKCGDLR"
FT   gene            485320..485814
FT                   /locus_tag="Tlet_0458"
FT   CDS_pept        485320..485814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0458"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase; KEGG: tma:TM0741
FT                   pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33025"
FT                   /db_xref="GOA:A8F4E1"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4E1"
FT                   /protein_id="ABV33025.1"
FT                   /translation="MKAVYPGSFDPITYGHLDIVNRALKIFEELWIVVMSNPRKSPVFT
FT                   VEERVEMISDLVKKEPNVHVDSYQGLLVDYLRSRNIKVVIRGLRAVTDFQYELEMAIAN
FT                   KSMCKEFETVFLMTDERFSFLSSGLVREVASMGGDVTKWVPPNVAEALEKLRSKGKQFM
FT                   L"
FT   gene            485860..486456
FT                   /locus_tag="Tlet_0459"
FT   CDS_pept        485860..486456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0459"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   tma:TM1605 elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33026"
FT                   /db_xref="GOA:A8F4E2"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4E2"
FT                   /protein_id="ABV33026.1"
FT                   /translation="MQITADMVKKLREMTGAGVMECKTALTEADGDFEKAVEVLRKRGA
FT                   AVAQKKAGRLTKEGIVTSYIHFNDKIGVLLELGCETDFVARMPEFKELAYNLAKHVAAM
FT                   NPKYVTREDVPEEVLEKEKEIYRAQLENSNKPAAVVEKIVQGKLEKFYEEVCLYDQKYI
FT                   FDDEKTVKEVVDELIGKIRENIRVTRFVRMRVGEE"
FT   gene            complement(486479..487615)
FT                   /locus_tag="Tlet_0460"
FT   CDS_pept        complement(486479..487615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0460"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: tvo:TVN0174
FT                   cystathionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33027"
FT                   /db_xref="GOA:A8F4E3"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E3"
FT                   /protein_id="ABV33027.1"
FT                   /translation="MKGFSTKAIHIGEIHLLDSVTTPIFQTSNFLMSAEKYESNDRNSY
FT                   IYSRMSNPTVRMLEKKLAALCNGEDGVLLSSGMAAISCSLLSVLSENDKVIFSAELYGG
FT                   TYAMIREVLSKFCIKCEFTPVDELNHRDFSDAKVVFVESLTNPLLKLADIDSLAKKAHE
FT                   QGALLYVDNTFMSPYNFRPLKFGADVEIHSLTKYVGGHSDIILGFVTARHQKLIEKIWR
FT                   QMYTFGANPNPFEAFLTARSVKTLSLRMTQHNKNAEIIVDFLLKHPKIKEVRYPSLQQN
FT                   IPECYKDCPGFGGVIYIDLETTDNALRFASNLKLFRQATSLAGVESLVTIPCLTSHSAL
FT                   NDEELQKAHISKGGVRLSVGIEDVQDLLEDLSQALNKI"
FT   gene            complement(487618..488586)
FT                   /locus_tag="Tlet_0461"
FT   CDS_pept        complement(487618..488586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33028"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E4"
FT                   /protein_id="ABV33028.1"
FT                   /translation="MRDLSKIFEDLNPRIQRINDEGLMIPPDINYQNQFTLLEDDSIDS
FT                   GRFLDDIIFVDSRRRTFESITVSGYVTLLCQIITGSVRFKKGECFPLFSPDDGPKSKLV
FT                   LGIPKDFANIANLKDGEELNIGKLNCITCVGEDAKSAIEIYMQHAEQLEVENQISECLT
FT                   IKDGSIDFATPAFKKNRGPIGLVKNVQKAFVNFETFNAYAFMKSGERSKSIIAELGHDR
FT                   NLLRIMSYLKLINKPGLRGLVRIETIIDKSEFNQTKESIFSTFNSLARTLPLLTDQSSI
FT                   IPRTPEDVLPVIFLEKYLDRYFYDPVYVHCAVLESFGEKVG"
FT   gene            complement(488583..489137)
FT                   /locus_tag="Tlet_0462"
FT   CDS_pept        complement(488583..489137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0462"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: tma:TM1101 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33029"
FT                   /db_xref="GOA:A8F4E5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E5"
FT                   /protein_id="ABV33029.1"
FT                   /translation="MLKFLIISDTHGSVKSWEVIERLSGSVNKYYHLGDVLYHGPRNPI
FT                   PEGYSPSKLAQILKDKNIIYVRGNCDADVDLSVLHNEDMPKFMILTFGHYKAVLLHGEN
FT                   LHSDEDMIELLNAHNADILFYGHTHIPRLEKIQSKILFNPGSPSLPKSNCPPTYGVVEF
FT                   SNKLYLGIYTLSGDLYMEMSL"
FT   gene            complement(489144..490247)
FT                   /locus_tag="Tlet_0463"
FT   CDS_pept        complement(489144..490247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0463"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tma:TM1100
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33030"
FT                   /db_xref="GOA:A8F4E6"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E6"
FT                   /protein_id="ABV33030.1"
FT                   /translation="MIRLILTEVNRVFKNKLSFLIMFLVPIVVVFLTLIMFNSFSVLNT
FT                   KIGILNLDDDPLSRFTVGTVMSLFRGGTISYVGPNYQSKLLSGEYSAIVIIPKDFSKNL
FT                   YAAKQTTLSFIPSPVDLQVSTIVYRLFNSMFEDLQGSPFFDPQVMKYLFTSPGYPAPKL
FT                   ILPEKEKLMSFESLLTPIAIFLSAAFVIIAISCSSTTLDRQIKLTDMYMTYNLSGFLYI
FT                   AAKVIAYSLIGMVESAIACLIFVSIGVYLPVGLLIFLTFMNSFFHASFGVMLSCITDNL
FT                   QIASLLGVGTIIVSFFLSGMVVPISSMPEIVQTISKYSPLFSVNYVLRKSQIYDVVSAA
FT                   ELIKVALIAVTTFALVLLTGAFNFKRR"
FT   sig_peptide     complement(490122..490247)
FT                   /locus_tag="Tlet_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.891 at
FT                   residue 42"
FT   gene            complement(490244..490852)
FT                   /locus_tag="Tlet_0464"
FT   CDS_pept        complement(490244..490852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0464"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: tma:TM1099
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33031"
FT                   /db_xref="GOA:A8F4E7"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E7"
FT                   /protein_id="ABV33031.1"
FT                   /translation="MLISFEGIDGSGKGTQLRLFLSYLKNKNLPYIHVREPGGTELGEI
FT                   LREIVLKGQFQIYPKAELLLFLASRAQLVSQIILPALKENKVVVADRFIDSSVVYQGVG
FT                   RELGPELVEKLNDFATDGLKPDLTFYIDVPVETALKRKRIFDRIESEGIEFLKKVRKAY
FT                   LELARKEKRIFLMNGEKAIEEIHSEIILIFEQLYWGIIR"
FT   gene            complement(490871..491140)
FT                   /locus_tag="Tlet_0465"
FT   CDS_pept        complement(490871..491140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0465"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: afu:AF0818
FT                   acylphosphatase (AcyP)"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33032"
FT                   /db_xref="GOA:A8F4E8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4E8"
FT                   /protein_id="ABV33032.1"
FT                   /translation="MQALFIKISGRVHGVGFRYFTYKLANKMKIKGYVRNAEDGSVEIH
FT                   AEAPEEILVEFLKAVSIGPPMATVISVKYERVAGQNFTSFDIVP"
FT   gene            491214..492671
FT                   /locus_tag="Tlet_0466"
FT   CDS_pept        491214..492671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0466"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: CBS domain containing protein; IMP dehydrogenase/GMP
FT                   reductase; KEGG: tma:TM1347 inosine-5'-monophosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33033"
FT                   /db_xref="GOA:A8F4E9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4E9"
FT                   /protein_id="ABV33033.1"
FT                   /translation="MIFEEGITFDDVLLIPGYSEVLPSQTDVKTKLVGDIYLSIPLVSA
FT                   AMDTVTEAELAKALAREGGVGVIHKNMSIEEQAHQVLVVKRTENGVIYDPVTIHPEDTI
FT                   HDALMLMSTYKIGGLPVVDEEGKLMGLITNRDIRFEKNYSRKVRELMTPRTQLIVADPS
FT                   ISLDEAKGILHTHKVEKLPLVDSDNHLAGLITIKDIMSVVEHPFAARDSKGRLIVGAAV
FT                   GTGNDTLERVQALKDAQVDFVVVDTAHGHSKKVIDVVKMIRSDFPELLIVAGNVATSEG
FT                   ALALIEAGANCIKVGIGPGSICTTRVVAGIGVPQLTAIMSCSKVCKNHEITLIADGGIR
FT                   YSGDIVKALAAGADSVMIGSIFAGTEEAPGEAILYQGRKYKAYRGMGSESAMRRGSADR
FT                   YFQSENFKFVPEGVEGMVPYKGTIKDVVHQLVGGLRAGMGYVGAKDLRELQEKARFVKI
FT                   TTAGVKESHPHDIIITRESSNYGSFSN"
FT   gene            complement(492697..494712)
FT                   /locus_tag="Tlet_0467"
FT   CDS_pept        complement(492697..494712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0467"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, beta subunit; KEGG:
FT                   tma:TM0217 glycyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33034"
FT                   /db_xref="GOA:A8F4F0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4F0"
FT                   /protein_id="ABV33034.1"
FT                   /translation="MTNTALLEIGIEELPASEMSQIQQQLQLLTEKLFTEKRLAFRTVL
FT                   SVVTNRRMAVLVKEIAERQEDSILEKRGPSKSTAFLDGKPTKALIGFLSANEASEEDIY
FT                   LKDEYVYIRKKVPGRKASEVLPEIFTEVIQSLKFTKSMRWGNGKYLFVRPVKWVVLMLN
FT                   NQILPFQIFGKNSSNKTQGHPNLQKVITVENCADYIDLLKNHYVLVNQEERIEKIKAEL
FT                   AKIEKEHFLTCDRDKELIKKISNLLEWPTAIVGKFKEEYLNLPEELITVTVKHHLSAFT
FT                   TFENQKITPYFVAFIDNPFGNIEKITIGYSNVVNARLEDARYYFEIDKRYNLEDFNERL
FT                   KGMVFQKELGTLFDKVLRIKKLSLYMAEKLGLSQMAEKIGRAAILSKADIASHVVYEFP
FT                   ELQGTIGKLYALMNEEDAEVAEAIEEQYFDEPKTITGSIIAIADRIDTIIGNLAVGNIP
FT                   SGSRDPFGLRNKSDVIFKTIVNRKWDLDLEELIRETLKLLSITCKWEIISDFMSNRYYA
FT                   FLSGEGFNYDLSRAVNHLWSKPLRGFLSARALAEMVKNNSFNELCVGFERVHNITKNFN
FT                   DTKFDGALFEENAEIELLNRFIEVKSTVVSSLKELDYERGVSSLITLKPFIDKYFDDVF
FT                   VMVNREDIRKNRLAFLKNIDELFMMIGDLTQLIKRE"
FT   gene            complement(494709..495554)
FT                   /locus_tag="Tlet_0468"
FT   CDS_pept        complement(494709..495554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0468"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit; KEGG:
FT                   tma:TM0216 glycyl-tRNA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33035"
FT                   /db_xref="GOA:A8F4F1"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4F1"
FT                   /protein_id="ABV33035.1"
FT                   /translation="MYLQDIIKKLNDYWSGFGCLIDQPYDMEVGAGTFHPSTFFGCLKH
FT                   SEWSVAFVQPSRRPTDGRYGENPNRLQRYFQYQVIVKPSPDNCQEIYLKSLESLNINLK
FT                   EHDVRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKSIPLEITYGIER
FT                   IAMYLQNKNSIFDVMWNDKISYGQLYLENEKQFSKYNFDQSSPQKLFQLYDIYQSEFEN
FT                   QIENGNYLVAYDYMIKCSHTFNLLDARNAISVSQRQEYIRSIRSMAKRCAETFQGGSSK
FT                   "
FT   gene            495741..497555
FT                   /locus_tag="Tlet_0469"
FT   CDS_pept        495741..497555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0469"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase; KEGG: pab:PAB0798
FT                   formaldehyde:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33036"
FT                   /db_xref="GOA:A8F4F2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4F2"
FT                   /protein_id="ABV33036.1"
FT                   /translation="MILRVNLSTKKVVAERLNKMDLENFIGGRGIAAKILWDEVKHVDP
FT                   LSESNKLIIAAGPYNGLRTPSGGKLVVAAKSPLTGGYGDGNIGTMASVHLRKAGYMALV
FT                   VEGASEKPVYIYIDNENVSILSAEGLWGLSTFETERKLKDVHGNNVGVLSIGPAGENLV
FT                   KYAVIISQDGRAGGRPGIGAVMGSKKLKAVVIRGTGDVQVRDVEAFKKYTTDVYKMIPT
FT                   LPAYDFWMRQGTLATLEWANKNKALPVRNFGQVKFEYARTVDGYSMEAMKVTKRGCPNC
FT                   NMICGNVVLDMEGKESELDYENVGMLGPNMGMPFLNKVAVLNRLADEYGIDTISLGAVM
FT                   GFIMEASEKGYVKGAPKFGDYDNTIELVRKIAYRDGELANILADGVKEASEKLNLQHLA
FT                   MHVKGLEVSAYNCYIYPAMALAYGTSAIGAHHKEAWVIAWEIGSTPLEEATTSEYVMTY
FT                   TPEKARKVVEQQRIRGGLFEMLTACRLPWVELGVDLEWYAKILSAITGEQYTLDRLYEA
FT                   ADRVYSLIRCYWIREYRGKWNRHMDYPPQRWFENDINGMKLERDKYDLLLSEYYKLRGW
FT                   DSNGVPTPETLRRQKLDFAIEELGDIIR"
FT   gene            497669..497744
FT                   /locus_tag="Tlet_R0007"
FT                   /note="tRNA-Thr1"
FT   tRNA            497669..497744
FT                   /locus_tag="Tlet_R0007"
FT                   /product="tRNA-Thr"
FT   gene            497754..497840
FT                   /locus_tag="Tlet_R0008"
FT                   /note="tRNA-Tyr1"
FT   tRNA            497754..497840
FT                   /locus_tag="Tlet_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            497865..498014
FT                   /locus_tag="Tlet_0470"
FT   CDS_pept        497865..498014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0470"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: tma:TM0451 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33037"
FT                   /db_xref="GOA:A8F4F3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4F3"
FT                   /protein_id="ABV33037.1"
FT                   /translation="MRVKISLKCSECGKKNYYTDKNKTAKEKLSFRRYCPKCNKHTVHS
FT                   ETKL"
FT   gene            498022..498097
FT                   /locus_tag="Tlet_R0009"
FT                   /note="tRNA-Trp1"
FT   tRNA            498022..498097
FT                   /locus_tag="Tlet_R0009"
FT                   /product="tRNA-Trp"
FT   gene            498126..498323
FT                   /locus_tag="Tlet_0471"
FT   CDS_pept        498126..498323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0471"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: tma:TM0452
FT                   preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33038"
FT                   /db_xref="GOA:A8F4F4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4F4"
FT                   /protein_id="ABV33038.1"
FT                   /translation="MEKIKKFFREVAAEAKKTHWPSRNELLTSTSVVVLILVVMGVYFF
FT                   VLDMVFSGAIRTFLKAIGIG"
FT   gene            498329..499393
FT                   /locus_tag="Tlet_0472"
FT   CDS_pept        498329..499393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0472"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides Ouzounis Woese) domain protein; KEGG: tma:TM0453
FT                   N utilization substance protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33039"
FT                   /db_xref="GOA:A8F4F5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="InterPro:IPR040473"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4F5"
FT                   /protein_id="ABV33039.1"
FT                   /translation="MKKKWFILRTMAGFEQTAKENLEAKIRSTGFERYFGRILVPEETI
FT                   LDATSKSIKRFAVSLNAKLVVKSGADVERGDLLAEEPPIHARHSGVVVNVKNYRKVTVE
FT                   TIDRKYSKTYFLPEGSKLETGIKIGARIKQGMPLTKDFEHICELDGKIVENERVKRVEI
FT                   QREDGEIDIYHIPLDVYDSQKVFKGKQAKNGELLADGRKIYATSGGRVEIVDLGTRKEI
FT                   RIAKTHKRRLFPGYVFVEMMMNDETWQFARNVPSIIDFVSSGGQPLEMKPREARVILRL
FT                   AGLETYEEKMKPIKVELDFHIGDVVKITSGPFEDFAGVVKEIDAEKQELRVAVTIFGRE
FT                   TPVTVKISEVERIQ"
FT   gene            499440..499865
FT                   /locus_tag="Tlet_0473"
FT   CDS_pept        499440..499865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0473"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: tma:TM0454 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33040"
FT                   /db_xref="GOA:A8F4F6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4F6"
FT                   /protein_id="ABV33040.1"
FT                   /translation="MAKKVVAEVKLQLPAGKATPAPPVGPALGQRGVNIMEFCKRFNAE
FT                   TADKAGMILPVIITVYEDRSFSFVVKTPPASFLLKRAAGLEKGSGEPKRKNVGKVTRKQ
FT                   LEEIAKIKMPDITANDLEAAVKIVEGTAKSMGIEIVD"
FT   gene            499886..500587
FT                   /locus_tag="Tlet_0474"
FT   CDS_pept        499886..500587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0474"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: tma:TM0455 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33041"
FT                   /db_xref="GOA:A8F4F7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4F7"
FT                   /protein_id="ABV33041.1"
FT                   /translation="MPRHSRRYQEIRQKVDRTRFYSVDDAIELVKQTATAKFDETVELH
FT                   LSTNIDTKRPEQQVRSTVTLPHGTGKRVRVLVFAKGDKAEAAKNAGADYVGGDELVEKI
FT                   TNENFTDFDVAIATPDMMRSIGKLGKILGPRGLMPSPKSGTVTEDVETAVKAFKMGRIE
FT                   VRNDKTGCIHIPVGKCSFDGEKLRENLLSAYRQIIALRPAGVKGQFIKRVVLSSTMGVG
FT                   IKIDQSDLENI"
FT   gene            500700..501275
FT                   /locus_tag="Tlet_0475"
FT   CDS_pept        500700..501275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0475"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: tma:TM0456 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33042"
FT                   /db_xref="GOA:A8F4F8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4F8"
FT                   /protein_id="ABV33042.1"
FT                   /translation="MRPFLLKGGAKLITRQQKEAVLEKLENDFSNSSLVMFINYSGFNV
FT                   AMMRDLRRRLYSKYEREARFTVAKNTLIGRALSKVGYAEKDFQSILAGPTAVLYVLSDD
FT                   PIEAIKITHSFSKEKKLEGIFKGGFLEGNYFTADDVSKLASLPTKEELYAMVVGRVQAP
FT                   LTNLVYVLSGTIRKLLYALNAIHDKKSK"
FT   gene            501291..501680
FT                   /locus_tag="Tlet_0476"
FT   CDS_pept        501291..501680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0476"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: tma:TM0457 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33043"
FT                   /db_xref="GOA:A8F4F9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4F9"
FT                   /protein_id="ABV33043.1"
FT                   /translation="MNVEQIVEAIEKLTVAELAELVKALEEKFGVSAAAPIAVAAAAAP
FT                   AAGAQQAQAEEKTEFDVLLKGFGSNKIGVIKVVREITGLGLKEAKDLVEKAGSPDAIVK
FT                   SGIPKNEAEDIKKKLEEAGAEVTLK"
FT   gene            501843..505361
FT                   /locus_tag="Tlet_0477"
FT   CDS_pept        501843..505361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0477"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase beta subunit; RNA polymerase Rpb2
FT                   domain 3; KEGG: tma:TM0458 DNA-directed RNA polymerase,
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33044"
FT                   /db_xref="GOA:A8F4G0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4G0"
FT                   /protein_id="ABV33044.1"
FT                   /translation="MRTVCYGKRERLTFGRIHDAVKVPNLISIQIDSYKDFLENGLIEV
FT                   LKKFSPITSQPHKGDLKKGEKGFVLEFVSTKVGQPNAPVEECKQKGLTYTVPVYTTVRI
FT                   TDVNTGEMREEEAFLGSIPHMTENGTFIINGAERVIVSQLVRAPGVYFVDEIPKTQVVS
FT                   PIYVAHFLPVRGAWLELLYYSADNMFYARIDRKRRINLFLLFKALGFTDDLEILDLFPD
FT                   PIDADDEYTMEKAVGSIILHDVVLDGKKIVERGGVLTKAASQAILESKIATVVRAHPAA
FT                   QKTLEKMVDTYGEVDSSKAYVEIFRKLKPGEIPRVNTAKAYLTSLYFSTERFELSDVGR
FT                   YKINKRLTQAYRRYLAQVKGLPEEEVESVEYNPEDPVLTPMDIVLASRYLLDVSKNPEI
FT                   MDTKDHLGNKRVRTVGELIKLEFERAFARAQRLIQERLTLYASLDKISIQSLINVKTII
FT                   AGINQFFATSPLSQFMEQVNPLAELTHKRRLTAVGPGGLKRERARFEVRDVHHSHYGRM
FT                   CPIETPEGANIGLITSLAVYANIDKFGFLTTPYRKVVNGVVTSEIVYLTADEEEHYNIA
FT                   PCTIKIDKDGRILDERVPVRFMERLQFVEKNKVQFMDVSTKQIVSVSTSLIPFLEHDDA
FT                   NRALMGSNMQRQAVPLVKPEAPFVATGVEYDAALYSGYVVQAKYSGRVKKVDSRKIVIE
FT                   RMDENGKPVLKNGKPVLDEYRLMKFMRTNQDTTVNQRPIVDIGDIVKAGDVIADGPATD
FT                   MGELALGKNVLVAFMPWEGYNFEDAILVSEELLEEDTFTSIHIEVYETQARDTRLGPEE
FT                   ITVDIPNVSKEALRNLDENGIVRVGAYVGPQDILVGKVTPKGEGETTPEEKIIRSVFGE
FT                   RGKDVKDTSLRLPHGTDGRVIDVKVFDKDEETDLGAGVNKLVKVYVACRKTLEVGDKLA
FT                   GRHGNKGVVSKILPKEDMPFLPDGTPVQLVLSPLGVPSRMNVGQILETHLGWLAKLTRN
FT                   WFATPVFDGAKENEILPWLYEERRAVGLEEGDSDNEPSGKVVLRDGRTGESFAEPIVVG
FT                   YIYMMKLVHIAKDKIHARSTGPYSLIHQQPLGGKAQFGGQRFGEMEVWALEAHGAAHTL
FT                   NEMLTIKSDDIKGRNEVYKAILKGKNIPEPGIPESFRVLIKELRGLALDIRVYDENGNE
FT                   IDIDRV"
FT   gene            505386..510338
FT                   /locus_tag="Tlet_0478"
FT   CDS_pept        505386..510338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0478"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein; KEGG: tma:TM0459
FT                   DNA-directed RNA polymerase, beta' chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33045"
FT                   /db_xref="GOA:A8F4G1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4G1"
FT                   /protein_id="ABV33045.1"
FT                   /translation="MAISTFKRKIASVRVSVASPEIIRAWSSGEVKKPETINYRSFKPE
FT                   RDGLFCEKIFGPTKDYECACGKYKGKKYEGTVCERCGVRVESKEARRKKMGHIELAAPV
FT                   VHVWYLKSSPSILSTLLNIPARDLENIVYHGSRRIIERSYIITDSKKTQFAAGDVLYET
FT                   EYEVYKKVLDFDAEIAVTVKNPKSPVVSDIDGEVSIKSEQTNTGREIIWITVKDSKKIP
FT                   IQLQPGMILLSKNGQEVKEGTILVPEKQIAPFYAPFDGTVEIDEIASTLTIKPLTTSKE
FT                   QPVTVTIPYCVRVLVKNGSKVKAADELLSGGTIPAITSPASGKVVFGKELNVRPLEDDT
FT                   YEVLSAGMLYVEQLIQEKRYPIFEGSLPYVNDGDKVKAGDYLADRFLFEDEVLSAHEYK
FT                   IFEDYYPQQFTVEAEVENDRPIVAVTEIDDELSKETGLSVGSIITESEYEAYKELYPGK
FT                   IEAHYGAAAVKKLLEKIDLEKLKAQIESELSQLPRSSGKALKLLKRLKIVKNLIKSGTK
FT                   PEWMVLEAVPVIPPELRPMIQIDGGRFATTDLNDLYRRVINRNNRLRRLLDLNAPDIIV
FT                   RNEKRMLQESVDSLIYNGRIGKAVADRNGRALKSLTDLVKGKKGRFRRNLLGKRVDYSG
FT                   RAVIVVGPDLKIHQCGLPKKMAMELFRPFVLAQLLKEGGESSKTARKMKKAIIEKEMPE
FT                   AWDILEEVIKGHPVLLNRAPTLHRMSIQAFEPKLIEGNAIQLHPLVCPPFNADFDGDQM
FT                   AVHVPLSAAAQAEAKYLMLSRYNIISPAHGKPISMPGKDIIVGVYYLTAIGKDFDDVKT
FT                   EEIRYRFGSTEEAILAYSLGYVDLHTPVLAKVKVSDQEKIVKTTVGRIIFNEIILPDLR
FT                   DYTRVFGKKEIKNLIYDTFKRHGIDATADLLDDMKDLGFHYATVSGLTISLKDLIVSPK
FT                   KDEIIRGAEQRVEQVEEEYRRGFLTFDERYREIIKIWNKATEDVQFVTQQALGENPFNP
FT                   IFMMVNSGARGNIDQVKQLAGMRGLMADPSGKTIEIPIISNFREGLTSMEFFISTHGAR
FT                   KGAADTALRTSSAGYLTRRLVDVAQSIVITTTDCGTHEGLKAVELISDDLTVQKLKDFL
FT                   FGRVLSRDVVDPLTGEVIKNPVTGREYVRNAMLSDEDAEFLAEYVVSVPVSVEQVLDLQ
FT                   GLQLPHCYAEVCEEIRTVDGVYYEEGTELNWDVVRNAKNAGKKQLKIKMYPVVGTISEQ
FT                   VIKDKKGEKELVVLREEIDELTAKILEENGVSQIKVRPNIYVRSVLTCEAEKGVCAMCY
FT                   GMDLSNHKVVNVGEAVGIIAAQSIGEPGTQLTMRTFHTGGIATTADITQGLPRAEELFE
FT                   ARKKLKEPEGIFSTETGFVKDIKEVEGRQKIYIEDYSGGIHEYEVPEKTKVKVRIGQKV
FT                   LPGTPLTTGAIRLRKLMDTLGVEATAMYLLKETQKVYVEQGVEIHNKHFEIIIKQMLGR
FT                   VEIVDPGDTDFLPGQLMTISEAEKINEKILRENANAQSNRNFVLGKILAKKVVAKVSDE
FT                   VEEIASEGTEVTEEILEKAVESGVKEICIYDEGKQITYQIAPKEPMRYRRRLLRITKAS
FT                   LEQKGWLSAASFQQTPQVLTEAAVEGSIDLLEGLKENVIVGQLVPAGTGLETFANIQIE
FT                   ETPRAAEAEKMA"
FT   gene            complement(510367..511434)
FT                   /locus_tag="Tlet_0479"
FT   CDS_pept        complement(510367..511434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0479"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: cth:Cthe_3084
FT                   putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33046"
FT                   /db_xref="GOA:A8F4G2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G2"
FT                   /protein_id="ABV33046.1"
FT                   /translation="MELVVLCSAGLEKAPCIELKKLGFKIKTTTSGHVHFDGHLIDIPK
FT                   LNLYLKSADRVMINVTDFPSETFDELFEGTFSANWNELVHKRGTIVVEKVKITNSKLSA
FT                   KGAVASIVKKAIYSKIKSDNQPDGIIYPMYIYIKNNFVSLMLDTTGKNSLSKRGYRMKT
FT                   SSAPLRETIAAALILISGWDQEVPLIDPFCGSGTIAIEAARIALQMQNNKRSFSFENWP
FT                   LFKDLKPSIVNQHECKRTVAIGYDKNPDILQVANENAIRAGVKKYVRFHCSDFEKLPIF
FT                   HEKLHIVTNPPFGLRMREGNASFYRKLSKLRKIFPDARLCLITPREDLQKMISIELQRK
FT                   FRFQNSGLWTWCYIF"
FT   gene            511510..512898
FT                   /locus_tag="Tlet_0480"
FT   CDS_pept        511510..512898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0480"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   tma:TM0726 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33047"
FT                   /db_xref="GOA:A8F4G3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G3"
FT                   /protein_id="ABV33047.1"
FT                   /translation="MLDEKVVQDVIVYGIKKGAEFVEIFSEDRTSTVMTMTDGRIDTAS
FT                   SDREFGIGLRLFKNDQQVYAYTNVFAREQLISMVDRLIQALSAGNGSEKKIDMTRNDVK
FT                   NNHLIFYYPQEVSKTDKARIMKLAYEGAKGYSSLITQVLIRYWDYDQKVFIANSDGLIA
FT                   EDRRVRTRLMVNAVASKDGEQESGFYGPGAAMGIEFFNLFNPHDIGAEAARVADRMVKA
FT                   DHAPAGKMPVVIANEFGGVIFHEACGHALEATSVAKGASVFARKLNQKVAAECVSAVDD
FT                   GTIPNAWGSANIDDEGTPTQRNVLIENGVLKSYLVDRFHAKKMGMKPNGCGRRQSYKFA
FT                   PTSRMSNTFILPGKHLPEEIIAATEYGLYAKKMGGGSVHPSTGEFNFAVAEGYLIEKGR
FT                   ITKPVRGATLIGKGTDVIAKIDMVANDLARGQGMCGSISGSIPADVGQPTIRVSELIVG
FT                   GRNK"
FT   gene            512895..514220
FT                   /locus_tag="Tlet_0481"
FT   CDS_pept        512895..514220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0481"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   tma:TM0727 PmbA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33048"
FT                   /db_xref="GOA:A8F4G4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G4"
FT                   /protein_id="ABV33048.1"
FT                   /translation="MKIDDFRDKVFLLAKKKGFDDSQLLLTNRKEFGVVISKQNIENYT
FT                   DAESFKIVFKGIKNGKSSFSTSEILDEKTAEFLVESAYENLEVTDTLEEDVIYDGSGEY
FT                   SPAQNFVDEFERISVKEKIDFAKMMEQKALSVDKRITMVIMSAYEHERRNITLFNTSGL
FT                   QLKESTGLGAAFIYLIASDGQKPKRGTKVCFASKPSDIDFEEVVSQAANEALSQLGASS
FT                   VSSGKYRAILRRDVFAELFTAFLPIFSAENVQKGLSPLKGKLGVQIASEKLTLIEDPLS
FT                   NKTPVRRSFDNEGVPTMKKEFVKDGTLTTYFHSLKSAKKDGVLPTGNVFESKCVPLNVI
FT                   VEPGSKSFDDLLKELDSGLVITALDGLHSGVRTVSGDFSVSALGYQVEGGKIVKPVEQI
FT                   TISGNFIDLLRRIEGVGNDIKLVSDSFYTPSVLVEFLDVAGD"
FT   gene            514464..515222
FT                   /locus_tag="Tlet_0482"
FT   CDS_pept        514464..515222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0482"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: ionotropic glutamate receptor; KEGG: aha:AHA_2800
FT                   amino acid ABC transporter, periplasmic amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33049"
FT                   /db_xref="GOA:A8F4G5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G5"
FT                   /protein_id="ABV33049.1"
FT                   /translation="MRRFFVILIVTALLFTGLASLIDDIQKRGVLRVGQDEGYMPLYGT
FT                   DEKGERVGLEVELINKIAEILGVKVEYVIVNWDGIIPALISGKFDIIFSGMTITPERAL
FT                   KVNFSAPYLTVGQAILYNKSVFKTPPTYQDLADKPVKIAVQLGTTGEFTARRKFPKAEI
FT                   LTFSTMDEAAFQVVSKRADIMVNDSIYVKFLTQKYETLGMTNELLSREDLGIAIRKGDM
FT                   EALRWFDTFVQWAKTSGLIEELHQKWLGNE"
FT   sig_peptide     514464..514529
FT                   /locus_tag="Tlet_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.499 at
FT                   residue 22"
FT   gene            515255..515974
FT                   /locus_tag="Tlet_0483"
FT   CDS_pept        515255..515974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0483"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: gsu:GSU2650 amino
FT                   acid ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33050"
FT                   /db_xref="GOA:A8F4G6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G6"
FT                   /protein_id="ABV33050.1"
FT                   /translation="MKKVYAIAMTAGVMIAIYLAISRVYPFDWTVVLKYRRVFINGLVM
FT                   TMSLSGFSLLISFAVGIVFALMRRSSGIFREFAILYVFFFRNTPLLVVILLTYYGLGSI
FT                   IPFDRFWAAVMGLSAFEGAYIAEIVRSGLDAVDKGELEAAFSLGLTKSEVFFYVHFPQA
FT                   IRISLPALIGQSISLVKDSSLASVIALAELTMTGRQVGTQTLASFESYLTIAVFYVAVT
FT                   SILSLIGHWLERRLAIP"
FT   gene            515971..516702
FT                   /locus_tag="Tlet_0484"
FT   CDS_pept        515971..516702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0484"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: afu:AF0680 glutamine transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33051"
FT                   /db_xref="GOA:A8F4G7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G7"
FT                   /protein_id="ABV33051.1"
FT                   /translation="MSLLKVVDVHKSFGNTKVLNGVSLQVDKSEIVVIMGPSGAGKSTL
FT                   LRIMNYLVKPDEGYILFKGEKLSDDMRVLRQIRSQIGFVFQHFNLFRHLTVVQNVMLGL
FT                   LRVKKLSKSEAYDLAMNCLEMVGLSDKARSYPSQLSGGQKQRVAIARALAMKPDLILFD
FT                   EPTSALDPTLVNEVHQVMKKLAADGHTMVVVTHEIGFARNVATRIVYMENGVIIEEGNP
FT                   VDFFTCPHTTNVRDFLSSVYT"
FT   gene            complement(516703..517338)
FT                   /locus_tag="Tlet_0485"
FT   CDS_pept        complement(516703..517338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0485"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tma:TM1638 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33052"
FT                   /db_xref="GOA:A8F4G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G8"
FT                   /protein_id="ABV33052.1"
FT                   /translation="MNKSFSARKALDSVSFHVCANSVAILGLNAAGKSTLLRIFATILK
FT                   PDGGTISINGLDILRDYRKLRQIMAFVPETSFLIEELSAVENIRHFSTLRKVRVDPSEI
FT                   IQKFSISPAKKPARTLSKGMKQRLMIAIALIGKPELLILDEPTTGLDREAKMALIEILS
FT                   GMRNQGTSIILSTHSEKEVREIADSVVVLEKGKVLLYGSTDQVLKDLT"
FT   gene            complement(517362..518465)
FT                   /locus_tag="Tlet_0486"
FT   CDS_pept        complement(517362..518465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0486"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: tma:TM0262 DNA polymerase
FT                   III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33053"
FT                   /db_xref="GOA:A8F4G9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4G9"
FT                   /protein_id="ABV33053.1"
FT                   /translation="MVRLKTNVGEFTSKISIVSKTIPSKTIKPIMACILFDISHDGTFL
FT                   HATDLETGVKARMESEADGEGKFAVDAKTVYEIVRTLPNEEEVLLEFSSNLMTLECGRS
FT                   KFRLPTMDPGDFPEISLTTEGNTLMLDAKTINDMIERVTFCAAKDEFMRNLNGVFWEIG
FT                   NGFLRLVASDGFRLALSEERLNAQSESSFLISLKSMKELQSIVESCLDSEITIRYDGKR
FT                   LSLNTKDIETVMRVVEIDFPDYRKVLPKAFKSKVVLPRDEISEALKRTMVIAKRGSESV
FT                   RLEISEDTLILSSRSPDYGEVNEEIPIKKEGEDITIAFNPLFLLEAMRHVHTEEVELNF
FT                   VDSTSPLQINPLNVEGYLYIIMPIRIV"
FT   gene            complement(518458..519369)
FT                   /locus_tag="Tlet_0487"
FT   CDS_pept        complement(518458..519369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pgi:PG1071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33054"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H0"
FT                   /protein_id="ABV33054.1"
FT                   /translation="MAQRIVYVIGNTKNAGKTTVVKHLLKQMKNACIASIGLDGENLDT
FT                   LSNVPKPSIQIPAGTYVVSCEKFLQGSHFELLELLEDNPLAGAVFLARALVESKVVIAG
FT                   ANTSVISSIQKRKEFDSIIVDGALDRIVHAGFADNAEIAIVIGTSNHSNTVELQKFIER
FT                   ILSSLMIPLAPFQIKKLFENKHTVCGLTSDGKVKDLGSSLLNDLKTIEKYEWIFVPGVI
FT                   TEEIVERLRDIRICLLNPFSFFGIASKFDNIYTMRKLFVRGIYLNFFNRPDLEIRICKT
FT                   LESFGYKAVDILYVTHRRDNDG"
FT   gene            complement(519354..520613)
FT                   /locus_tag="Tlet_0488"
FT   CDS_pept        complement(519354..520613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0488"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein; KEGG: ctc:CTC00890
FT                   L-lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33055"
FT                   /db_xref="GOA:A8F4H1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H1"
FT                   /protein_id="ABV33055.1"
FT                   /translation="MRDFREISLWKNVTEDEWNDWKWQLRNRIMNLDVLQEVVNLTDQE
FT                   REGVRHSLKFLRMAITPYYATLMDPENPRCPIRMQAIPTAKELNISQEEMIDPLHEDVD
FT                   SPVKGLTHRYPDRVLLLITDQCSMYCRHCTRRRFAGETDSPLSDELLNSAIDYIKQNKR
FT                   IRDVLLSGGDPLTLSTEKLENIISRIREIEHVEIIRIGTRVPVVLPMRITEELTSMLKK
FT                   YHPIWLNTHFNHPKEITPQSRRALSMLADAGIPLGNQSVLLRGINDCPQIMKKLVHELV
FT                   KNRVRPYYIYQCDLSRGLSHFRTTVAKGIEIIEYLRGHTSGFAVPTYVIDAPGGGGKIP
FT                   VEPQYLISMGEGKVVLRNYEGGIFVYHEPRNYKSECNDNYLEEERKSTDGIASLLSGER
FT                   RYLIPESADRIRRIKNWHRE"
FT   gene            complement(520625..521101)
FT                   /locus_tag="Tlet_0489"
FT   CDS_pept        complement(520625..521101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0489"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: tma:TM0932
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33056"
FT                   /db_xref="GOA:A8F4H2"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H2"
FT                   /protein_id="ABV33056.1"
FT                   /translation="MILIWITLILLLCLLLLYAFKRRKKSTILKEKWKTGFSDGWEFEK
FT                   FIAEVFKNAGYRSTLTKGSHDFGADLIIKKRKVSYAIQIKYYSNPITLKALEEALVAAA
FT                   IYGVDRIGVVTNGEIPQSLKKFAQEIEKKTFVKKVILIGKNDIESMLNGKKTFL"
FT   sig_peptide     complement(521027..521101)
FT                   /locus_tag="Tlet_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.542 at
FT                   residue 25"
FT   gene            complement(521098..521481)
FT                   /locus_tag="Tlet_0490"
FT   CDS_pept        complement(521098..521481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33057"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H3"
FT                   /protein_id="ABV33057.1"
FT                   /translation="MFWVKILVFIIISILLVKIAKKPVSSEKNIRESLINSGWKCCAGV
FT                   KSGKTWIGLYRKSFQKKIVLICENSLNFADVKKAVVMALLSNTRLIKLYCSEITPHAQK
FT                   ALNKLSKTKKLHRIKFVQEERFL"
FT   gene            521518..522735
FT                   /locus_tag="Tlet_0491"
FT   CDS_pept        521518..522735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0491"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   tma:TM1866 membrane bound protein LytR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33058"
FT                   /db_xref="GOA:A8F4H4"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H4"
FT                   /protein_id="ABV33058.1"
FT                   /translation="MIKLSLEVQILRKPTFILLIVAVVMSLSFLLFAIFFSQRILTDLF
FT                   FKKIEVNPYCLLVVGTDAVIERTVRTDVIMVVIIDHEKGNVLLTNIPRDLLIGDGKINA
FT                   KYEKTGISGLKDTVSDLLNLEIHGYAVIDYDVFKFLGDSLGPIEIQIQEPMKYVDSVQN
FT                   LNIDFQPGTYLMNGEQLLAYIRYRRGSMGDISRIERQKEVLLKLIDRARTLDLAKMVSI
FT                   FSHVYRNVTTDVGMGEMAYLFSRLKKKMNMSFLSFPYKLDSDGNVIIDSQKLESYRNSI
FT                   ITQNLSEDVKIPKILIINCSTNKTRGFLVRLEELWNSKVGFLPHQIVWEDIGVNYSKNT
FT                   VFVLNKAMKTEITKVVEAVYPEITFDVKIISLTSGMDEYLGIIKKMSDSRIYPSFPFDA
FT                   LVVVVR"
FT   sig_peptide     521518..521619
FT                   /locus_tag="Tlet_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.690 at
FT                   residue 34"
FT   gene            522732..523409
FT                   /locus_tag="Tlet_0492"
FT   CDS_pept        522732..523409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0492"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="PFAM: Endonuclease V; KEGG: tma:TM1865 endonuclease
FT                   V"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33059"
FT                   /db_xref="GOA:A8F4H5"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H5"
FT                   /protein_id="ABV33059.1"
FT                   /translation="MKELHKWNLSPKEAIEEQKKLVELLERSSIKKVDLVAGVDLSFPK
FT                   EDQGCAVIVVLNFPTLKIVDYVTEVSNISFPYIPGLLAFREGPVFLRAWEKLKIRPDVV
FT                   MFDGQGIAHPRRIGIAAHMGLFINLPTIGVAKSHLYGTYKQPGKHKGEYEFIYDESEII
FT                   GAVIRTKNNCKPVFVSPGHKCDVQSAIELVLSCCVGYRLPEPTRIAHLISQKQRVKEKG
FT                   FSS"
FT   gene            523422..524510
FT                   /locus_tag="Tlet_0493"
FT   CDS_pept        523422..524510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0493"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   tma:TM0920 alcohol dehydrogenase, iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33060"
FT                   /db_xref="GOA:A8F4H6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H6"
FT                   /protein_id="ABV33060.1"
FT                   /translation="MWQYFMPTKVIFSKNVLEKNIDLFKNFGSKALIITGKHSSKKNGS
FT                   LQDLEKSLQSAGVYYEIYDKIEENPTYSLIREAVYSLRDRNFDFIIGLGGGSPLDSAKA
FT                   IAVLLKNKDMNVEDLYNASKYEQSLPICAIPTTSGTGSEVTQYSVLTDDSGYKKGFAHL
FT                   SIFPALALIDPIYTISMNASLTRSTGLDALCHAVEGFVSKRATPVSDLYAVRAMELIKE
FT                   NLPKALENPEDLGARENMACASCLAGMVISQTSTTLAHVLGYPLSTFKGIRHGDATALF
FT                   LDSIVNQAEKEIPEKIATIKKIFTDIGEFIASVGLKVSVQITDEELESWVNRAKQAAHN
FT                   QWTRGIFDEKLLRHLYERVKKD"
FT   gene            524524..525672
FT                   /locus_tag="Tlet_0494"
FT   CDS_pept        524524..525672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33061"
FT                   /db_xref="GOA:A8F4H7"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H7"
FT                   /protein_id="ABV33061.1"
FT                   /translation="MNKFKRNHHPWIYKNEIMTIKGDFEDGQIVDVFLKSGQFFARGYI
FT                   NTKSKITVRILTFEPKTIEQILQSRIEQAIHRRRFLLKYEQACRLIYSESDWLAGLIVD
FT                   KFGPYLVIQINTLGMEKLKELSVKILLQQVEVSGIYEKSDSPARLKEGLEKRSGWIYGN
FT                   GPEIIYYRSNGLTLASDLKGQKTGAFLDQRLNARALFPYAEGKKCVDVFSYTGNFALHL
FT                   LKYGAKHVKLIDYSQRSLQIADQLMKLNGFEGRYDLICANAFDWLKRETSLTEQYDLIV
FT                   LDPPSFAKTSSAKESAERGHKEVNLRAIKLLKKPGLLVSSSCTQILSAFDFERVMQSVA
FT                   SDCKVNLRIAYRGGQPEDHPILLGVPETEYLKFYIFEAWRRD"
FT   gene            525672..526871
FT                   /locus_tag="Tlet_0495"
FT   CDS_pept        525672..526871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0495"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tma:TM1698 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33062"
FT                   /db_xref="GOA:A8F4H8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H8"
FT                   /protein_id="ABV33062.1"
FT                   /translation="MRISERSKKAPASPIRKLVPFAEEAVKKGKKIYYLNIGQPDIPTP
FT                   SIYFQYEEKHRPQIVAYTHSAGLLPLREAFTKYYARFDIDVFPDEIIVTNGGSEAVLFA
FT                   MTVVADPGDEILVLEPFYANYAGFAAQLGINLVPVRTRPEDGYQIPKMGDFLEKISHRT
FT                   KAIIFSNPCNPTGAVYDEKQLEVIAEVALKRDLFVISDEVYREFTFDGFRAISMMSFSN
FT                   ISDKVIVVDSISKRYSACGARIGTFITKNKDIYQAAMKLAQARLCPAMTSQYGTIGLLT
FT                   LDDLYYSQMRKEYEMRRDVVYEELQRIDGAVFKKPHGAFYISVKLPIDNSEDFVKFMLT
FT                   EYEVEGKTTMVAPLSGFYVTPSTGMSEIRIAYVLEREQLRDAVAILTSGLKTYIERRNK
FT                   "
FT   gene            526873..528315
FT                   /locus_tag="Tlet_0496"
FT   CDS_pept        526873..528315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0496"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM: multi
FT                   antimicrobial extrusion protein MatE; virulence factor MVIN
FT                   family protein; KEGG: tma:TM0086 virulence factor
FT                   MviN-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33063"
FT                   /db_xref="GOA:A8F4H9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4H9"
FT                   /protein_id="ABV33063.1"
FT                   /translation="MPQIFQYGILFSLATLISRVTGLIRDVLLAHKFGAGVEFDSYVIA
FT                   ISFPFLLRRAFAEGAMTSAFVPLYNDRGKSNEFASAVITSIGIVTISLTVFVEIYPKIV
FT                   PILLSSGASQEVRLLTSSLSRFSMPFVVFIFLWAVLYAIQNSHNKFFIPALSPMLMNFG
FT                   VILGTLMSDLFEPAVLGPTIGFTVGGALMFVSLIPGARKSGFRYKPTFKGTGDFLRLFF
FT                   PALLAMTVSEFNVLIDINVASLLGPGGVSAMQYANRFYQLPFGVFGVAMATVVLPVISN
FT                   EMQNSKKYTSESIRLSLFLTVPSAVGLMALSERLISLVYQHGAFTYEDTIKTSAVLFYY
FT                   SIGLPFYSIMAVLSRVCHAKKDMRTPFIATVISFIVNSVLDFVLGLTMNIIGIALATSL
FT                   AGLCGMIYLAFRIKPTIDWKHIAKILVASSAMGIIIMIISLFGSSHMLTLLLVLLGMVI
FT                   YVIFCKLLNLPELNEFFRLIRK"
FT   gene            complement(528296..529135)
FT                   /locus_tag="Tlet_0497"
FT   CDS_pept        complement(528296..529135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0497"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   tma:TM0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33064"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I0"
FT                   /protein_id="ABV33064.1"
FT                   /translation="MRRTAVAAGSFYPASPERLKFSIEEAFTSSLGPGHIPDKPDQPLK
FT                   KHSSVIVPHAGYIYSGPVAAHAYAEISKLGKPELVVLVGPNHTGYGRPIGVYNRGTWVT
FT                   PFGELHVSTDAAEIFLQYCDEANADFKSHISEHSIEVQLPFLQYLFDDFQILPIAVFPI
FT                   FIKSCEKIAIALDHIAENFPSTLFVFTTDFNHYESDEITVKKDQMVIDKILTKDPTGLY
FT                   SVVAKEKVTMCGLSVVTSFLFMKHFGLPRLLKHATSGDVTGERSQVVGYASFICESI"
FT   gene            complement(529132..532671)
FT                   /locus_tag="Tlet_0498"
FT   CDS_pept        complement(529132..532671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0498"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   KEGG: tma:TM0088 comE protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33065"
FT                   /db_xref="GOA:A8F4I1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I1"
FT                   /protein_id="ABV33065.1"
FT                   /translation="MKKIWTVLLLLISIFLFAAEINSILPVYQQNEVIFQIQSSEPFNK
FT                   ADIFVEKSASNAVISVHLKGTELLNTPFFLPIAYGPVDSLRAIGTYQGTLLIFQLLIPV
FT                   DAKIDISQQTLQVKFPVSEKRIDLVLTSESDFETAVKFLAEEMNLNVVVSDSVKSIKMA
FT                   LKLSGISPEDALRNLLITAKVGDEPIAYSYMPDGTLHIGTRNEISFRFNQFWGIYDVKN
FT                   EEVVKKLETILSPTTVMTYLPNKAVLFVYGSLFEQDLISKILSVTPPSITKEITISVPK
FT                   DDVFKLLDSLRNIYNFEYNSIEGLNKIIIKGDSKIVQSVLSYIKELETKFQQISKSTEE
FT                   STPVVQTKIKQFKVVYPEEATEILSQIGLETVKMPFGVIEVKGSDSQLKIAESILNDFG
FT                   FFKAEYEHIFIPEKFQESLISILSNIFGIPASRFIKSEDNGIIVFAPEDIRKSARDISD
FT                   DFVKFLMSRKKSEIFFLNDYEVASQVSDILKQIYGIESNSVQNVLKVVGTDEDLNKARN
FT                   FIATFVKDRTIRSLEVQLDDDVYSELKTLMESTLDVKFEANLKSLRRILISSYNKEDLN
FT                   KAAAEIKKITETISSLKIEKDTKLVPALETINFDDIKLLLTKLYEVDVEKTDLFYILSG
FT                   EKAKIEQAEKFLSQLSGQLSEKPSKVYRITQIPEGFSVQELVEVLNKLTKVEVLTAGQT
FT                   MVLWADKQSVENAEKILQELIANLPKVSETEKKITVKVIEYSEKVPFEEFTGFLQSIGN
FT                   TSKLSAYPNLGVVVISGYEEDVQDAINNYKNFQEIVQQKSELAKVETQPVKISKNEDGS
FT                   IAVKCNEISLREVISEIARELNISMVFIAVPEEKITMNVSSINWKQFTDLIQSQYGYAF
FT                   LESDNVTVLIKPRSVTDTTTEEKFVYTLPHNLDRIKSLIEFYGGKVYIDELNDLMVVTG
FT                   LSKKMKDQLDQTILQIAQPLKQIEIEAKLVDRSLIDEITRQNSLSISLPGQAPEITVSS
FT                   TSLSLSTSVINLFDYQKLFSYLSGASVTAVFELNNSNNLDNLLASPRIVTSSGKEARIL
FT                   IGDRVPYQTIDADGNVIVNFLDTGIELRITPYVRTDGTIELNIFTKVSKPTYYPNIDIP
FT                   GESTRETETDVILKNGDTLVIGGLMRETKEETSAKMPFLGDLPFIGQLFRSKTEKADKR
FT                   ELLIFITARVIEQ"
FT   sig_peptide     complement(532615..532671)
FT                   /locus_tag="Tlet_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 19"
FT   gene            complement(532684..533151)
FT                   /locus_tag="Tlet_0499"
FT   CDS_pept        complement(532684..533151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33066"
FT                   /db_xref="GOA:A8F4I2"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I2"
FT                   /protein_id="ABV33066.1"
FT                   /translation="MSKRLIGLLILATAVWIVALYFLLFYDKTPRQTAQESQQQIEPLR
FT                   RRLTDQQLEEIVGYIKTDFNNIDFFEPYLLKFNVEELTTQMLSSMSNLQGYTFAGYARG
FT                   DKEQFILLARDKNVLKVSLDDVLDGRYLPIHITSFAVAVLDLRTGSILAIR"
FT   gene            complement(533144..533611)
FT                   /locus_tag="Tlet_0500"
FT   CDS_pept        complement(533144..533611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33067"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I3"
FT                   /protein_id="ABV33067.1"
FT                   /translation="MPRKMAILIAVLAFVVCAAYFDIYDYLKFNAVLKKADSELVRLTE
FT                   LDKDVSLKREYLLKLEALLKPRIKLEEIENTVKQVGGSFKIEKDESYSLYGVWSSETTR
FT                   AILEKILDSANINVTSVSLTNNLQIPVSISNMEQQPYIEVKMIFSGVMLNE"
FT   sig_peptide     complement(533555..533611)
FT                   /locus_tag="Tlet_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.911 at
FT                   residue 19"
FT   gene            complement(533614..534135)
FT                   /locus_tag="Tlet_0501"
FT   CDS_pept        complement(533614..534135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33068"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I4"
FT                   /protein_id="ABV33068.1"
FT                   /translation="MILLVSLILPVIAVRFTSEFYKQSALASLEAQHHQILSKYNLDLT
FT                   VSSLEKQVDDIASENRSLFLLGRKLQNTINQIESHLIRYTNGTHPIKEVFNLWSKSSSN
FT                   WMMLSELKFDGSMKLTIYELYQNGFSPAVDRISQKLIELGYTVSKSVEYDTSMDFLSKR
FT                   LTKVTVEGRR"
FT   gene            complement(534149..535144)
FT                   /locus_tag="Tlet_0502"
FT   CDS_pept        complement(534149..535144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33069"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I5"
FT                   /protein_id="ABV33069.1"
FT                   /translation="MQIFHKMITAIDITKRYVEVIRGRKSRGVLTLLDKFYQQGEDTSK
FT                   ILEQLAKKVNSDVEDIVAVNFPSENLLFFTIDIPGGLKMKDERDYTKTEISRLLNLSAQ
FT                   EIVVEPIRNPLNKALVIVAKQRDVNEAITKVVSAGFPEPDVMLPDIFKYLELVEIKNSS
FT                   ITTLIVLAPDYGAIILFMAQTPIGVRTFTYSSWEILDILREETGITAEDFMNNPAILKD
FT                   NTSADSIIESVLVDLPYTVERETIFLLNTILPGTSIREISKFYLLFDPPILTEQSVKIF
FT                   NSIDSFQNKIENVKLSVNPDKVGLGALGIFIRGGAEFGKNKLVQTQKTDS"
FT   gene            complement(535149..535559)
FT                   /locus_tag="Tlet_0503"
FT   CDS_pept        complement(535149..535559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33070"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I6"
FT                   /protein_id="ABV33070.1"
FT                   /translation="MLLKMVFNLLLVAVFLSTVLPIMSVIDRITQHIQPYYIKCAVFKA
FT                   LEWVRREIPGQVVINNTSGTKKLIIKTIRIDEKETKILSLDFKNTVEFNTRNNNAIELS
FT                   PICVSNAGSIDLGSWTITFPPAVVKVNIREER"
FT   sig_peptide     complement(535485..535559)
FT                   /locus_tag="Tlet_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.757 at
FT                   residue 25"
FT   gene            complement(535564..536757)
FT                   /locus_tag="Tlet_0504"
FT   CDS_pept        complement(535564..536757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0504"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   tma:TM0094 general secretion pathway protein F, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33071"
FT                   /db_xref="GOA:A8F4I7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I7"
FT                   /protein_id="ABV33071.1"
FT                   /translation="MAFYKYIAVEKSGKKVKGVLEADNESQIIDLLKKRQYVVLNVQQV
FT                   SSRKSRELLNVSLSELVVFSRQLATMVGAGVRIKDALSILSNQVVFSSRFRKIINHLVV
FT                   SLETGSSFSEALRNEGVFDSIFINLVSAGEEGGVLDKTLDKAAEFYESSKRLQDEVKSA
FT                   MAYPMFVLVFAIGVIFVISFYILPRLIGAFGSIPSSGIIGFLMGVNKYLSTHWLSTIIV
FT                   LLTVILGFVLFMKTKYGNYAKDFFAGLFPPAAKLRKMMSVERFCRTLSVLTGSGVLLTK
FT                   AIEMSAAASNSPKMVKKSKIVSERVKEGASLRQAMIEATIFPQIVYELVGTGEETGKLE
FT                   EVLAKVADFYEEQVRIGVKKLVSLVEPMLIAGVGGFIAFMAFTMYNTIFQLQQTIGR"
FT   gene            536804..537037
FT                   /locus_tag="Tlet_0505"
FT   CDS_pept        536804..537037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0505"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   tma:TM0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33072"
FT                   /db_xref="GOA:A8F4I8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I8"
FT                   /protein_id="ABV33072.1"
FT                   /translation="MRIDKYLKTTKLIKRRTIAQQMLKHEKIFVNGRAVKASYEIKTND
FT                   IVTIIHPLRRIVVRVVSDSEYEIINQSNIENL"
FT   gene            complement(537017..537730)
FT                   /locus_tag="Tlet_0506"
FT   CDS_pept        complement(537017..537730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0506"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; KEGG: tma:TM0224
FT                   biotin--(acetyl-CoA carboxylase) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33073"
FT                   /db_xref="GOA:A8F4I9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4I9"
FT                   /protein_id="ABV33073.1"
FT                   /translation="MIGEKIIWTAILPSTNDFLKENWRTLSHGTAVVAEMQTNGRGRYN
FT                   RNWLSPQGGLWFSILFKPRKSLRPAFFTKVCSLSVIKALQALKVEARIKWPNDIYINGK
FT                   KLAGILTESVFDENIPKAIITGIGINVNNNIPQELSNKAISLYQITGQIYDPKIILKMI
FT                   LRQIDGMIRRYSKKPEIATRLWKKYMIQKEGQVISFIKSNIIQSGKLLKILEESLLIEI
FT                   DGKKIEISSLEILDV"
FT   gene            complement(537727..538359)
FT                   /locus_tag="Tlet_0507"
FT   CDS_pept        complement(537727..538359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33074"
FT                   /db_xref="GOA:A8F4J0"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J0"
FT                   /protein_id="ABV33074.1"
FT                   /translation="MLPLNVLLGHIVADHAFTNNAKIRTYKGSKLIGHILWSVLAILAF
FT                   TFDTLLKSPSGIALLIVFVSLHAFLDIGRVKMYQKNKRIVDLIEAAGILLAIIINTLCF
FT                   DTLSQSYLTPEFVLYLLGMSAVSVGVTYLFRNFYPAKEFLPDVDGISERLAIFIFLLAS
FT                   KPLFVVISIVIAFLYRLVFVKKADHTWWISPASGILISLLWKVLLYT"
FT   gene            complement(538319..539605)
FT                   /locus_tag="Tlet_0508"
FT   CDS_pept        complement(538319..539605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0508"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: tma:TM0744
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33075"
FT                   /db_xref="GOA:A8F4J1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J1"
FT                   /protein_id="ABV33075.1"
FT                   /translation="MKIAMFTDSYLPQTNGVATSVYLYKRALERMGHEVYIVSPIGPKD
FT                   ETVLVLGGIQFKWEKNHIIPSSGRILPIIDFVKKKQIDVIHSHAPFALGFRALIVQRRL
FT                   FLPHVHTYHTLLVEYRHYIPRPLTPSAKSVEEFSSWFCNMTNQVIAPTEKIKLELLRYG
FT                   VTKPVHVVPTGIDVELFEKPNDFDIKKRHSIQPKSKVLLFVGRLAKEKNVTFILRVFKI
FT                   LLEKNYDVHLIVVGDGPERNALQQLAKDIKVDHRVIFTGYMPRTELANYYRQADLFVFG
FT                   SQTETQGLVVLEALAASTPVVAVAKMGIADVLKEGKGALLTKEASTTEFVEKVEQILSD
FT                   EGLAEKLRLEGKKYILHYWSIDSKAKLIEKIYETAVEEGACFSDFKSNIWLELMVEKMR
FT                   GISAKIFESTSNGGARRAAIKRAVRTHRR"
FT   gene            complement(539583..541919)
FT                   /locus_tag="Tlet_0509"
FT   CDS_pept        complement(539583..541919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0509"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: gme:Gmet_2819 putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33076"
FT                   /db_xref="GOA:A8F4J2"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J2"
FT                   /protein_id="ABV33076.1"
FT                   /translation="MFLGEFIVKYRIPIVLIFIAAAIFLGYFGITNLTINSDLAGLAPQ
FT                   GNSFYTEQIDFLAEKLSSNTLTVIAYTDKNIQKTKAALQILKDRFENTDHIIETMKLDN
FT                   PELFIKYGFLAIDSTGLKTVSDTLNLSVENMLDFSEWRKVITSFSTAQQLLEEYISQQG
FT                   IDQYTMLSPDNRVMVINFVLKDNIIDVGNVSNAIQNLKKIANQVTKETGVRFLFTGTAV
FT                   GVYESNEQVKKDFFLTTSISFIGICLLIYFGYGSLWILIFLMISMAIAMCITLGIVKLF
FT                   SGEINIVTSFVNAMILGLGIDYGIHMITKITSHSLSGKIEEKSIVASVKEFFRPALAAL
FT                   MTTIGAFSSMFFGLSKPFMQMSIFSIVGVVSFFSTMLFFLPALLIIIKPKFKEKGKNRR
FT                   FDFSFLVAGRTRKILRFIAIGAIVVFLPLGIINLKNYWYTPSGLVSEKSESSIAFSEVK
FT                   KSFQKVGFGEICVIADNLEELERISNLIKNSGFMTTPLSMMSILEYASYENIDKLPSVY
FT                   SDLFQIVNNPVLTAVFKKVGVYRQILEMLSMAKNSKNLQDVINELKKDVPMLFYEKDGV
FT                   TKYVLYTDTTEDLYKENRIKRVFNFFKENNVQSYGYPTILYSVMNDMRGTIYWIALLVS
FT                   AGVLVMLLIDTKSLKMSAVILACVMAAVVIAFGIGYVLEIHASFMTLLLIPILVGIGVD
FT                   GMIHIKHISESNSRELISRTLKSITFCTFTTVAAFGSFSLAEGKLLQEFGILMGIGLSA
FT                   SWLITVFTAGYLLKGGDQFEDSDVH"
FT   gene            complement(541898..542362)
FT                   /locus_tag="Tlet_0510"
FT   CDS_pept        complement(541898..542362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33077"
FT                   /db_xref="GOA:A8F4J3"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J3"
FT                   /protein_id="ABV33077.1"
FT                   /translation="MNYLVLLYSPKKISKSSDYRSMIVPFLLTSTLWFSFSKEVHYIFL
FT                   CTNLAIKFVEFNILIYTYIMILCGLIAFIEKTPKKVLSFPMFFLPYFFTPIYFRILELL
FT                   NFPAMMAFTISFVHSLFLSRNQYGLYLHLIRTSAFIIVLLVVRRCFLVSL"
FT   gene            complement(542359..542952)
FT                   /locus_tag="Tlet_0511"
FT   CDS_pept        complement(542359..542952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33078"
FT                   /db_xref="GOA:A8F4J4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J4"
FT                   /protein_id="ABV33078.1"
FT                   /translation="MTSTGMAVTCFLICISLFLFIILSMNQEKQIYQIQPFPNVVLVSP
FT                   LDWFLNQMKIVAERILLYKKALLTGKRIDIDLLSNRTVFRVKSLDAYRGLFEEARKKAP
FT                   SVFERKKFLKFGDYEKLMEASFEFNGVLFVYKPCVTLTNNGYILSEHIDVARVIILALN
FT                   GEGPEVNILESNKDLINSLLSMVEKYRIEVARTE"
FT   sig_peptide     complement(542872..542952)
FT                   /locus_tag="Tlet_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.721 at
FT                   residue 27"
FT   gene            complement(542949..544160)
FT                   /locus_tag="Tlet_0512"
FT   CDS_pept        complement(542949..544160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0512"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41; KEGG:
FT                   tma:TM0747 carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33079"
FT                   /db_xref="GOA:A8F4J5"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J5"
FT                   /protein_id="ABV33079.1"
FT                   /translation="MKKNSLGFIVILAVAVVAISWLLSAAVTPKEVNTALEPFYQTLSY
FT                   ILNTYYEKDEIDLNKLMDYAIDGLVKGLGDDFSYYENPESTEEKQIELEGEYGGLGIEV
FT                   TYDSEYKAIKVISPMYGTPAWRTGLKAGDRIVTIDDEPVSEMTYMEAVRKLRGQPGTTV
FT                   RIKVLRENVESLLSFEIVREVIQIIPVKHAFIETSKGRIGYTLITRFGAKTSQEMAEAL
FT                   DDIFSKGIKGLIIDLRDNPGGYLNSAIEVASYFIDNGIIVKTKNAYGVEEVYESKGNNY
FT                   PNIPMVVLVNGGSASAAEILTGALKDHQIARVVGTKTFGKGSVQTGFPLNNGGTLYLTT
FT                   AHYMTPSGKDIHRIGIEPDVFVEESTDVSHESVVIDYTKKIIDVNTEDPFIIKGLETLL
FT                   ELIE"
FT   sig_peptide     complement(544083..544160)
FT                   /locus_tag="Tlet_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.825 at
FT                   residue 26"
FT   gene            complement(544164..544943)
FT                   /locus_tag="Tlet_0513"
FT   CDS_pept        complement(544164..544943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0513"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; tRNA methyltransferase complex GCD14
FT                   subunit; KEGG: tma:TM0748 protein-L-isoaspartate
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33080"
FT                   /db_xref="GOA:A8F4J6"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J6"
FT                   /protein_id="ABV33080.1"
FT                   /translation="MSEFIKQDDRVLLLFEDDTTFIVQVQDNILGTHKGVVELKNLIGK
FT                   AYGDRAETKNGEPFLILRPRLVDEIFKMKRKTQIVYPKDMGYILMMLDIKEGDVVIDAG
FT                   VGSGAMCAAIARMIGPDGKVFAYERREDFKKIAEANIAKWGFSERVVFKLKDIKDGFDE
FT                   KANAIFLDVPDPWNYIPHCHKSLLGSGNIAIVCPTTNQVQLVLKELHGHAFVDIEVWES
FT                   LLRQYKPVPDRLRPFDRMVAHTAFMVFARKVNDFKEG"
FT   gene            complement(544940..545401)
FT                   /locus_tag="Tlet_0514"
FT   CDS_pept        complement(544940..545401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33081"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J7"
FT                   /protein_id="ABV33081.1"
FT                   /translation="MRNLKFSILMCLVVVTAFCRNFTLFYLNDNLSPVSYTIDYEGDNA
FT                   VAFLMEKLAQPVKDTISFVPKELLRAYFFVERSLVIDLKSSAIKNLNFDQERYLLHQIL
FT                   RTIFENFKGLDSVYILIDGKRQDKLVNYVDIRYGFSRKIWSSWPVEGGL"
FT   gene            complement(545402..546325)
FT                   /locus_tag="Tlet_0515"
FT   CDS_pept        complement(545402..546325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM0750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33082"
FT                   /db_xref="InterPro:IPR032547"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J8"
FT                   /protein_id="ABV33082.1"
FT                   /translation="MRKLSFFLAFIAFSLCFSIEIYVGTNMIYSSPAENFTVDWNTFAT
FT                   IWENYCKLMGLEEPATGEIGDFSYFVWKGHTAGFSRQASTFFIDGVAKKSDKIPLKDTL
FT                   DTFDIPAMIENNRLILPQMIVEDMKFDENMIEVVYKGRNELIFSEHDGQITVSSVNYVS
FT                   YRGLLYKPGQMIAAFDTPQRKIDQLIELKGLIRVILYSKELIPGNVVLIPFFSEHKVDQ
FT                   NGILLFYAEGDGRIIIRPYSPDFEGSDWAVYAQTKEIAEKIANHFGLKIEICPIYDIPV
FT                   GKIGMILLLDNQDIEQVRKFVEEMLE"
FT   sig_peptide     complement(546269..546325)
FT                   /locus_tag="Tlet_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.642 at
FT                   residue 19"
FT   gene            complement(546322..547989)
FT                   /locus_tag="Tlet_0516"
FT   CDS_pept        complement(546322..547989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0516"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   tma:TM0751 uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33083"
FT                   /db_xref="GOA:A8F4J9"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4J9"
FT                   /protein_id="ABV33083.1"
FT                   /translation="MIKLYFLETNEELIVPEGTKLIDYVSKFSKYHQTAIVAAKIDNSI
FT                   VELNKKLDRGGNVSFIDLTTLDGLRIYQRGVLFLLHMVLKEMYQDYQLWVLHSVGNALY
FT                   CELRKNGYRKEFSEEEIVKIKSKMSELVKMDITFEKHEFYKEDAFKIFTEQGDADRIRL
FT                   FKFRKKKTIKLYKCLNHYDYYYGYMPPSTGYLTHFDLQKDGEGFLVVLPDRTNPENISS
FT                   PKKLPKLSSVFLEYARWLDVIGINTVADLNELIARGEREVVDLMILNEALHEKRIAQIA
FT                   EQFSESMARLILIAGPSSSGKTTFAKRLLVQLKVFGYKPVTVSLDDYFVDREKTPKDEN
FT                   GNPDFESIEAIDLDLFNQHLVQLLDGKEVELPKFDFKIGKRIPSGKKVKVDKNQPIVVE
FT                   GIHGLNEKLTSLIDRSYKFKIYVSALTQLNLDAHNRITTTDTRLLRRIVRDYKFRGHSA
FT                   LETIMMWPSVRRGEEKYIFPFQEEADTMFNSAIVYELAVLKTFAEQLLVQISQNASEYT
FT                   EALRLTKLLDYFLPITNIEDIPRTSILREFIGRSAFKY"
FT   gene            548049..548124
FT                   /locus_tag="Tlet_R0010"
FT                   /note="tRNA-Gln1"
FT   tRNA            548049..548124
FT                   /locus_tag="Tlet_R0010"
FT                   /product="tRNA-Gln"
FT   gene            complement(548167..549765)
FT                   /locus_tag="Tlet_0517"
FT   CDS_pept        complement(548167..549765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33084"
FT                   /db_xref="GOA:A8F4K0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K0"
FT                   /protein_id="ABV33084.1"
FT                   /translation="MREWFKKWQKVIVWIIAISFVAGIAWWSVASYLSGRQESSKISLD
FT                   QAIGYLTIAGSPIEDSDTWVLPSELDSEYGNLLNNYGISQLDPIFQEPSQKASLLEDLL
FT                   KNKVILHYAKQNKLTASNKEIEAKLNEYRQQIEKDQSLVQYIKQRYGSVNVYLNAVLKP
FT                   TLEKSLTQQKVVASVANVDSEEMKKYFEENIDQLRKKYDKVDAKLVSFTDESSANKFIN
FT                   ILLEKGFDGAASEMGLSVQDIPNLTRGIFDEKFEKDIFSGATNTAVGPIPLGSSWYVLE
FT                   VQSATVLTDFENFALSDTYESEKNSLQSQKMQQWYENYTSEKNIELVIADEVYSTWRKV
FT                   SSVSTPTEYESLRKELKEKIFQDNSISPQAPDTLKSAYVVLLEKIEESLDQSDDQSSEK
FT                   LKQIMAEKEMLIKDLYEQYPTSLEVASRMYQLDQNNLQVKYNYLSLLYSEIKPYLYPEY
FT                   IQYLLQSLIEIESGFSSIALDTNASTEMRASSYYNLYDLSKSLEDATSAKFYLEQLRRI
FT                   DPNYIDFDAALNELE"
FT   gene            complement(549762..551258)
FT                   /locus_tag="Tlet_0518"
FT   CDS_pept        complement(549762..551258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0518"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: tma:TM1705 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33085"
FT                   /db_xref="GOA:A8F4K1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4K1"
FT                   /protein_id="ABV33085.1"
FT                   /translation="MIKDILSQRAKEVEELRKLGVNPYPYKFEKTHTTKTIQEKFQALQ
FT                   PGEVLQDEEISTAGRVMTVRLHGKSCFFTIKDFYGRIQAYIRQNEISEEKYNLFKKYIA
FT                   PGDIIGITGFPFKSRTGELTVYVKNFQLLSKSRRPLPEKWHGLKDKEVAYRQRYVDMIA
FT                   NDSTLERFRIRYEAIRFIRDFLNRLDFVEVETPVLNFIPGGGAAKPFITRLEALDCEMY
FT                   LRIAPELHLKRYIVGGFEKVYEIGKNFRNEGISYKHSPEFTSIEIYQAYADYNDMMELT
FT                   ESLISELVLHLYGSYKLTYQGVELDFKPPWKRIKMREFIKSRLDVDILEDNDEKLYYVL
FT                   KERGVEPDTKSREKMIEKLWDLVEEEVIQPTFLMDHPVDISPLAKRHRDDPRLTERFEP
FT                   IIFGMEMGNAFSELNDPDDQLERFKAQLKLRDAGDEEAHRMDLDFIRALEYGLPPTGGL
FT                   GIGIDRLIMLLTNSPSIRDVIAFPLVSQTEEDDLEGSAVE"
FT   gene            complement(551268..551759)
FT                   /locus_tag="Tlet_0519"
FT   CDS_pept        complement(551268..551759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0519"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: tma:TM1706 transcription elongation factor, greA/greB
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33086"
FT                   /db_xref="GOA:A8F4K2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K2"
FT                   /protein_id="ABV33086.1"
FT                   /translation="MNKKNVIYLTKEGYEELKQELDSLKQKLMYEISERIKEARELGDL
FT                   SENTEYDEAKNEQGRIGSRITELEQILNNSEIIENTDSNQISVGSYVIIKNLNTGEERS
FT                   VRLVNPQEADIFSNKISVDSPVGRALMGRKVGEVVKLKAPAGSVRYEILGISSKSLNQE
FT                   "
FT   gene            complement(551759..552223)
FT                   /locus_tag="Tlet_0520"
FT   CDS_pept        complement(551759..552223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0520"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: tma:TM1707
FT                   ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33087"
FT                   /db_xref="GOA:A8F4K3"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4K3"
FT                   /protein_id="ABV33087.1"
FT                   /translation="MKCPFCGHPDSRVLDSRPTLDGTAIRRRRECIECGARFTTYERYE
FT                   LLPIIVVKKDGRRETFDRSKLLNGVLKACEKRPISYETLEKLVEEVELALQKQGSTEIP
FT                   SKLIGELVMSKLRQIDQVAYVRFASVYKDFREIDQFLDIVRELKKDQEVD"
FT   gene            complement(552220..553140)
FT                   /locus_tag="Tlet_0521"
FT   CDS_pept        complement(552220..553140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0521"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199; KEGG:
FT                   tma:TM1708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33088"
FT                   /db_xref="GOA:A8F4K4"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K4"
FT                   /protein_id="ABV33088.1"
FT                   /translation="MSFSEEVKYELCSTEINDKKEAEAELIGFIKGKGVLRLSKKQMNL
FT                   SIMFPSIKIARRFITVMKILSSGDYELFVVQNRRLWKQKNVQLDLTVSSFGNNEIYFLN
FT                   TDIPEWVSIDPELFGVFLRGLYLVCGTVINPVASYHLEINHSDENLLNQISFTLRKKFE
FT                   IQSKVLQVRNNFKLTIRAASDLIEFLNLIGAIQSATKVEQIVQRRSVISDVNRSMNFLS
FT                   ANADRIGNSTARQLRAIKIIEESIGLDSLNDELRLLAYLRLENEDMSLRELGEMMEPKM
FT                   TKSMVFTRMKKIISLAEQIEKGKSR"
FT   gene            complement(553144..554094)
FT                   /locus_tag="Tlet_0522"
FT   CDS_pept        complement(553144..554094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0522"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: tma:TM1709 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33089"
FT                   /db_xref="GOA:A8F4K5"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K5"
FT                   /protein_id="ABV33089.1"
FT                   /translation="MKVVAVGGGTGLSVLLRGLKNTGVDLTAIVAVTDEGGSSGIIREE
FT                   LEMPPPGDVRNNIIALAKDEDLMSRIFSFRFKTNGTLSNHSVGNIILAALTRMTGSFSI
FT                   AVKLASQILAIKGKVLPVCEELIRLIAIYEDGSEIIGETEIVRQKRKIISIKLNKRVKA
FT                   LDEVINALSDADAIIFGPGSLYTSVITNLLVDNVADTINSNEKAIKIYVANIMTQPGET
FT                   AGLSLQDHVKELEKYLRSRVDFIIANNLMPPEKLLNSYARELAEPVLSNGDVDERYIFE
FT                   PLLTIEFELNDTRPKARHNPQLLAKVIMKLLERGS"
FT   gene            complement(554091..554927)
FT                   /locus_tag="Tlet_0523"
FT   CDS_pept        complement(554091..554927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0523"
FT                   /product="uncharacterised P-loop ATPase protein UPF0042"
FT                   /note="PFAM: uncharacterised P-loop ATPase protein UPF0042;
FT                   KEGG: llm:llmg_1557 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33090"
FT                   /db_xref="GOA:A8F4K6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4K6"
FT                   /protein_id="ABV33090.1"
FT                   /translation="MKRILVVSGLSGAGKSTVARVLEDIGFFCIDNLPPALLNDFMVLL
FT                   SSSSIDKVALVVDIRSAQLGNAVQAIKKLVDNYSNIVTVLFLEASDEELLKRFATTRRR
FT                   HPLEGQLSLQEAISKEKELLRDMKEMSVVIDTTGLDIHTLREKIGSLLKEEAQFVIRIR
FT                   SFGFKYGLPADTDFIIDTRFLPNPYYDRKLAQLNGTDQEIVNFFSKYPVVEDFIQYTYK
FT                   LLHIAATRYKSEGRPFMTVSIGCTGGRHRSVYVAEKLSKILKDRFYVYVEHRDVNK"
FT   gene            complement(554860..555696)
FT                   /locus_tag="Tlet_0524"
FT   CDS_pept        complement(554860..555696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0524"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu racemase;
FT                   KEGG: chy:CHY_0306 glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33091"
FT                   /db_xref="GOA:A8F4K7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K7"
FT                   /protein_id="ABV33091.1"
FT                   /translation="MKIGVFDSGIGGFTVLQKLVEYMPHNEYVYVADTLYAPYGTKTHQ
FT                   QIFERVTRIINFLALQGADCIVAACNTADAVLKLSSLSARIPPYFGILDFDINFSSAQC
FT                   IGVAATELTIKSGIYEKLLLNRGISKIIQRPCQKLVELIENNEVHGRQADIEIKECFEP
FT                   FKNADLVILGCTHLPLLIEKIQTIFPKLRFYDPAESLVKNIWLSCRQDGKIIGKISFFV
FT                   TQDPLSFHTKISKYQTLLKLPYTVQFTDLEDEKNHEENTGSLRFVWSGKKYSSESS"
FT   gene            complement(555693..555962)
FT                   /locus_tag="Tlet_0525"
FT   CDS_pept        complement(555693..555962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM1711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33092"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K8"
FT                   /protein_id="ABV33092.1"
FT                   /translation="MKKSVNIRLDDKNYDLVTDATEEELLNVLNRLQTEYSQIKNIVEE
FT                   AETDEILLVMLTNALLNEIRSEKIINHLTFKIKSFFSEKEEGKS"
FT   gene            complement(555940..556200)
FT                   /locus_tag="Tlet_0526"
FT   CDS_pept        complement(555940..556200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33093"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4K9"
FT                   /protein_id="ABV33093.1"
FT                   /translation="MDLDRLAELEKLVDKLLEEHKKAKEENEQLWKQINEALSKIEKLD
FT                   KEKRELETLVETYRNSMNSLIQKLQNMINVTESVYEEKREY"
FT   gene            556269..557792
FT                   /locus_tag="Tlet_0527"
FT   CDS_pept        556269..557792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0527"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase; KEGG: tte:TTE0844
FT                   histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33094"
FT                   /db_xref="GOA:A8F4L0"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L0"
FT                   /protein_id="ABV33094.1"
FT                   /translation="MMIEIGGSRLIVSDVVKVARYCEKVELSPESIVKMQKSREVVEQI
FT                   LKEERAIYGVNTGFGAFANVKIPKDDLLQIQKNILLSHACGVGEPLSEEIVRAMMLIRA
FT                   HSLSLGFSGVRPVIVKKLCEFLNKGVTPYVPSKGSVGSSGDLAPLAHIALPLIGEGYIL
FT                   KNGVKVPAKEVLLEKNIDPLILSEKEGLSLVNGTQAMAAILSIVVNDVANLIYLAVRVA
FT                   ALVADVLMASPDAYEDIVWISRPHRGQKIVAKLMKELFEGSQIRESHRNCSQVQDAYSL
FT                   RCIPQVYGAVLDCLEYVKKIVEIELNSATDNPLVFGEKILSQGNFHGEPLALSADFLAI
FT                   SLSDFGNMVERQIDRMVNPKVNANLPPFLVIGDEGTNSGYMIWQYTAAALCNENKILSH
FT                   SASVDTIPTSGYQEDHVSMGMNACLKLMRIYENIISLVSIELMCATRALQLRRPLKTSP
FT                   KNEELFESTVPLIDKVSGDSFVQDQFERIRSFVLEKTRVVMNEWWRSYE"
FT   gene            557785..559029
FT                   /locus_tag="Tlet_0528"
FT   CDS_pept        557785..559029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33095"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L1"
FT                   /protein_id="ABV33095.1"
FT                   /translation="MNENIWFDDIEQFLVCPRRYCIEKTSRNYERIPDEQKTRELMKLK
FT                   FSIEKPVISADLFGNTLISSPDAIVPHGEMWKILMKKTAKRFKKKYLLEAAFHGYVFSS
FT                   NGYIISQVIVESPYFRASIDWKEGIPHLFSVIENIVYSQMDDPPVPKPVSQCKTCRHVL
FT                   ECTKILVKEGSLLAIHGLNSKLKMKLIEQGVTDLPDILSKDIDYISIDTVEKLRKKVTA
FT                   LLEDKVLVISQYDRLEEGVFLDIESHPLKDFDYLFGVLVDDKYIPYLCESIEDEYRVFG
FT                   ELLDFLDRTSGPIYHYCPYEPSRFSSLVNRWSDLGTVYRKIKTRFVDVYQILVKHIALP
FT                   LFTYSLKSVARFLGYQWRTNLDGLRASRYYQLWLSTRDQEYLDILLEYNEDDTRATKLV
FT                   VEKLNYFRNQKVIYR"
FT   gene            559092..560540
FT                   /locus_tag="Tlet_0529"
FT   CDS_pept        559092..560540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0529"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: tma:TM0824
FT                   AstB/ChuR-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33096"
FT                   /db_xref="GOA:A8F4L2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L2"
FT                   /protein_id="ABV33096.1"
FT                   /translation="MAVVGGVKGLIYRQAGKLVSMVLKNTDEEGLYKLFSTLSAFTKEP
FT                   SKSGLKKLAIMAKEKHPMITSWVNVFRRSSPKCVEKIINNLIINEFAIGEPVRQQKMHD
FT                   HRVVLPKLGVISPTYACNLNCVGCYAGLYGRKYELTKEEVSKVIQQANELGIYFWVITG
FT                   GEPFYWPYLMDILEEFNDNYFLIYTNGTLITEEIAEKLSKLGNATPAISVEGFELDTDW
FT                   RRGRGVFKSIMETWDRLRRHGVPFGASITATRMNHDTLMKDEFWKFLEEQQVVYAWVFQ
FT                   YMPVGINASMDLVPTPQQRYERFFKTDEVRLGGKFAFVADFWNHGFLTHGCLAAGSKYF
FT                   HVNAKGYVEPCVFQQYAVDSIREKSVLEILKSPFFESYKRMVPYSNNLFRPCPIIDNPK
FT                   VYRAMVKHFNAIPQHEGSERVVEELAEEIDKLADEWKVYADKLWYEQGYIDRYPVNRGI
FT                   YNYETRMKRYANKEEALAVDKKMK"
FT   gene            560577..561140
FT                   /locus_tag="Tlet_0530"
FT   CDS_pept        560577..561140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0530"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tma:TM0823
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33097"
FT                   /db_xref="GOA:A8F4L3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L3"
FT                   /protein_id="ABV33097.1"
FT                   /translation="MSDAREKILQAARAAFSERGFDGVSVEEIAHRAGVKKALIYYYFS
FT                   SKETLFEEVWNNALEELEKHIFKEIEGENYYIKKIKRFLKAYVDFVTSRKILSRVIERE
FT                   KPAVLNAANSGETWSRLRDRYNVFVERVAKLIEEGKENELIHPDIDPKAAAKLIAEAMS
FT                   DSTSDPPIAESLQLLILRGLIKES"
FT   gene            561176..561251
FT                   /locus_tag="Tlet_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            561176..561251
FT                   /locus_tag="Tlet_R0011"
FT                   /product="tRNA-Ala"
FT   gene            561309..562661
FT                   /locus_tag="Tlet_0531"
FT   CDS_pept        561309..562661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0531"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase; KEGG:
FT                   tma:TM1736 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33098"
FT                   /db_xref="GOA:A8F4L4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L4"
FT                   /protein_id="ABV33098.1"
FT                   /translation="MNLVPPHNLEAEEALLGSILIDPSVVNDVMEILKSEDFYSKKHQV
FT                   VFAVMERLYERGDPIDILSVCEELKKNGQMKFVGSDLDIAKLAESVPTSAHAMHYARII
FT                   RDKSILRSLIEAGRSIVESSYEEREVDEILDEAERVVFEIAESRATKTYNHIGAIMHQV
FT                   FENLEELRTRSSNVLEPGAVVSGLPTGLKSLDRQTTGFHKSDLVIVAARPSVGKTAFAL
FT                   TIARNMAVKFNLSIGVFSLEMSKEQLAQRLLCTESSVDLHKLRTGFLTNDEWERLTIGA
FT                   SRLYKANLIVDDEPSLDPRTLRAKARRMKREYNVDAIFVDYLQLMHVRGGSSESRQQEI
FT                   SEISRSLKLLARELNVVVIALSQLSRAVESREDKRPRLSDLRESGAIEQDADTVLFIYR
FT                   DEYYKKSDRIHEPHEAEIIIGKQRNGPIGTVVLMFEPKTASFYEMERMPDE"
FT   gene            562654..563145
FT                   /locus_tag="Tlet_0532"
FT   CDS_pept        562654..563145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0532"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: MECDP-synthase; KEGG: tma:TM0647
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33099"
FT                   /db_xref="GOA:A8F4L5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L5"
FT                   /protein_id="ABV33099.1"
FT                   /translation="MNDLRVGIGTDRHPFVEGRKLILAGVEINSSVGLLGHSDGDALCH
FT                   SLIDSLLGAVCLGDIGQYFPETDEWKDASSIFLLEKIIDMIRDQGWEVVNIDTIVTCGR
FT                   IRLSDYRDDMIKNLSKIMNIPEQRISVKFKSANGLGFESQDGVSVLTICLLRGPSSRNS
FT                   "
FT   gene            complement(563116..563871)
FT                   /locus_tag="Tlet_0533"
FT   CDS_pept        complement(563116..563871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33100"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L6"
FT                   /protein_id="ABV33100.1"
FT                   /translation="MVLVLLSLICLSEAFGIDICTQLKYVHADCLLNVPLQVLLKDISL
FT                   LSMGCNQNLDIARDVGYFAGMVARSYGFNYVAFGTLDTLDELDPNPVDRISRSPYITAQ
FT                   VITYLAEGFVNSGVIPVVNATGNIDAEVVRALVNRKAIYPSLVESENKIQKLIDLGYET
FT                   VFVLVDGSVKGKLPNLRIDTKVNLSEIEQIRKKVLEGAIVLLSRSEEIINVNQPFSKTG
FT                   VLVFSNEEWLLEQAKEVIRGSRIPTGRAP"
FT   gene            complement(563819..564622)
FT                   /locus_tag="Tlet_0534"
FT   CDS_pept        complement(563819..564622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0534"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: tma:TM0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33101"
FT                   /db_xref="GOA:A8F4L7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L7"
FT                   /protein_id="ABV33101.1"
FT                   /translation="MKIFIFDLDGTILMDSHDIHPKNLEAIRLLLERGKEIVFASGRML
FT                   PSITKLLRRYFDREFSLIAYNGSVVWIENKGKILDIRINPETAEEVVKVLRILKIHRQA
FT                   YINDKLVVEEENDFAKAYSDHSQIELTVVPDLAEAVRKNAPTKILAIDSPERLEPVIPK
FT                   LRESFPNLSIFKSFENYLDFVPFEINKGRALQILAREKNWNLYEAAAFGDNDNDIPLLM
FT                   SVKVKVAVNNATRSLKEVADFVTEDNTKGGPGTFIIDMFERGIWN"
FT   gene            complement(564619..565503)
FT                   /locus_tag="Tlet_0535"
FT   CDS_pept        complement(564619..565503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0535"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   tma:TM0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33102"
FT                   /db_xref="GOA:A8F4L8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L8"
FT                   /protein_id="ABV33102.1"
FT                   /translation="MIRHLTLCLLIIARLIVAIEVIFTPMSAIDIVSILERAEYSISIC
FT                   TFSIDEPSIIKSLEGAVKRGVDVKVISETPLYASNIPLKIDAESSLFHLKVILVDQKIS
FT                   IIGSANFTSHSIQRSFNDILIINDPNMGAKFQNFFDDLWNGFFGKIRLRSDDLYATTTN
FT                   IEETVLCELSKAKKSVDVAMYALTHPSVWATLKILSSKKIRVRLLVDEWFLNNSNLCKL
FT                   PFTAIQTRVIRDMTLHSKLFIIDGKTVLTGSANATKSGYSRNAEMLIVLKNRNVLKKYM
FT                   EYFETIWERGEPF"
FT   gene            565534..566148
FT                   /locus_tag="Tlet_0536"
FT   CDS_pept        565534..566148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0536"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   tte:TTE1197 Zn-dependent hydrolase, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33103"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4L9"
FT                   /protein_id="ABV33103.1"
FT                   /translation="MIHEINEIVSLVSTGPIGTNTYILKNSPVIVIDPGFGIGHHLKEE
FT                   CVVLLTHSHYDHICGLNEIKVTKVYVSEEDLQGLGDPSVNKSRFFGNSFVYDGSFDIFQ
FT                   DTLTIGKWHFDVIRTPGHTKGSVVLSTDGMFFTGDTIFMDSIGRTDFPESDEKKMVESI
FT                   KMLLNIFKKVDPDLLVLPGHMEWGKVKELLKRNYFLREALI"
FT   gene            566145..566624
FT                   /locus_tag="Tlet_0537"
FT   CDS_pept        566145..566624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM1622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33104"
FT                   /db_xref="InterPro:IPR021636"
FT                   /db_xref="InterPro:IPR035951"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M0"
FT                   /protein_id="ABV33104.1"
FT                   /translation="MKKTLIVLLVLFFFSSCMIRPIYVPPRVYSISSAVKSLQDSYLLV
FT                   FVEEVDGYGPVEAKGVVASYVHDGKNYLFYGFKFYDESPKVYWKKIVKEIGIWSSRTYF
FT                   DLLNSGLYSSKKDGKYIVVWWKDVWMFIVESSSNAEDFANYVMNWFAKLGGSEGW"
FT   gene            566618..567310
FT                   /locus_tag="Tlet_0538"
FT   CDS_pept        566618..567310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0538"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: tma:TM1621 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33105"
FT                   /db_xref="GOA:A8F4M1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M1"
FT                   /protein_id="ABV33105.1"
FT                   /translation="MVILAHRGYSAKFFENTLTAFKKAFEFGADGVELDLRSTRDNQIV
FT                   VVHDDNLERFCGINVKISDLNLRELREYSREGEKIPSFEEVLSIIPPGKILNVELKERT
FT                   PAESALQAVRKLFSPQNTIVSSFDHDLISFLIKRHPDFKFGFLVGEELRNDPIGLIRSL
FT                   LEEKPYSIHLPVQLVDYPQYFESICTAIKSKKVDIYIYTVNDPDKCVRFANMVDGIITD
FT                   EVEKFVTL"
FT   gene            567376..568230
FT                   /locus_tag="Tlet_0539"
FT   CDS_pept        567376..568230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0539"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; KEGG: tma:TM1714
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33106"
FT                   /db_xref="GOA:A8F4M2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4M2"
FT                   /protein_id="ABV33106.1"
FT                   /translation="MERDFCEIKLDEPLKYHTSFKIGGPARLFVVPNSIEGLICALSHF
FT                   PDAKILGRGTNILAPDSGVDVVISTVNLNKCFVDDELIVCESGASLFSVCKKASHNSLS
FT                   GLEFAYGIPGSVGGAIYMNAGAYGGQICDVVAWVEVYDGEKVMTLDRSQLEFSYRKSIF
FT                   QRTRWMILKAAFKLKKADMNEINNAMEEIMTRRMESQPMDMPSAGSVFKKPGEDFYVAR
FT                   VIEEIGLKGLRVGDAQISTKHAGFIVNLGEARSSDVLKLIEIIRHRVKEHCGIQLQLEV
FT                   EIW"
FT   gene            568227..568811
FT                   /locus_tag="Tlet_0540"
FT   CDS_pept        568227..568811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0540"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   tma:TM1713 proline dipeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33107"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M3"
FT                   /protein_id="ABV33107.1"
FT                   /translation="MNGFYTVAKEGSFKLNVKRSLFYSHIFEVSNNESIREKIKYYKQK
FT                   YIDATHVCWAYRLYETDVIEFSSDGGEPSGTAGLPILNTLKKNNMMNTCCVVARYFGGV
FT                   KLGVRGLIDAYSEAAYQALKDAGTVALVLMYEHIFRCDYAKVSDLIRSIQSLSGRVKNI
FT                   EYSDDVVVSAIIPQRLDYPDIVSVIKKLVKI"
FT   gene            568808..569344
FT                   /locus_tag="Tlet_0541"
FT   CDS_pept        568808..569344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM1634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33108"
FT                   /db_xref="GOA:A8F4M4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M4"
FT                   /protein_id="ABV33108.1"
FT                   /translation="MNREKFFLVLMSIFAILFVIAFLNNRAMESSLAEYQKMIRAYELY
FT                   TNGYYEDFFHYIEQNNLQNLTYLKSLKRNYSEFYIEGLKKCVSGDYEVAIDYFKESLGN
FT                   VEISNPLYTEILYYLGLSMINAEKYQEAEITLERLLDFKDSIYAQKGLRLLIKLYTKTG
FT                   NLDRAKEIEKLMEVE"
FT   sig_peptide     568808..568891
FT                   /locus_tag="Tlet_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.471 at
FT                   residue 28"
FT   gene            569344..570660
FT                   /locus_tag="Tlet_0542"
FT   CDS_pept        569344..570660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0542"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: tma:TM0184
FT                   phosphoglucomutase/phosphomannomutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33109"
FT                   /db_xref="GOA:A8F4M5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M5"
FT                   /protein_id="ABV33109.1"
FT                   /translation="MRKLFGTDGIRGVYQVDLTESMAYKLGFILGKKYRGGKFLIVRDT
FT                   RESGMAIEEAICEGLLKNDVVVLRGGILPTPAAALVTRVEGCFGVVISASHNPYFYNGI
FT                   KLLKSGYKLSDEEEIEIERDFENEKELNKTRCGKVMNFAEALDIYVNAIYDMFKDIDFS
FT                   GLKVAVDAANGAAYRTTPIVLNKLGVKVSCFADQPDGRNINQGCGSLYPSFLKENINDF
FT                   DLGILHDGDADRCIFLTRNGKEIHGDKTMGVLADWMKQESRLKNDIVVATVMSNLGLEI
FT                   FLSQRGIKLIRTKVGDRYVLEQMISLEANLGGERSGHIIFLDRSTTGDGLITAIEFLRV
FT                   MVLSGKDPCYLESMVIDYPQHMINVDVTDKSVAEHPKLKEKIDQFQNDGYRIIVRPSGT
FT                   ERLIRVMVEGKDESSVKSVAEELAEFVKTMSFLGEGESV"
FT   gene            570657..574775
FT                   /locus_tag="Tlet_0543"
FT   CDS_pept        570657..574775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0543"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: putative CoA-substrate-specific enzyme
FT                   activase; PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   tma:TM0482 (R)-2-hydroxyglutaryl-CoA dehydratase
FT                   activator-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33110"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M6"
FT                   /protein_id="ABV33110.1"
FT                   /translation="MKIGLCLGSSSISLYCDEMLPIWVQHNGDPFSVLSNLLRDFPDSI
FT                   QIAFTGRKLRRKFKVPSLPESEACELAYSSLKRKYGEYQAIVTAGGENFVLYKLGSDGK
FT                   IAGIYTGSKCASGTGEFFLQQIKRMGIDLGSINSFTYDGLYKLSSRCTVFCKSDCTHAL
FT                   NKGIPKEMILNGLGKVMADKILQLARAAKVDKVLIVGGTTKNPLMLRHLENQIEFTVPE
FT                   EATYFEAYGAYIWVSMENPPRIGKSQLFDFKRSSEFPRHPPLSQFVELVEFKSMDMGIP
FT                   QIDDECVLGVDVGSTTTKAVVVRISDKKILASSYLRTLGDPVNASKNCYREILSQHLPV
FT                   KIVAVGVTGSGRKVVGLHVRTEAVYNEIMAHAKAAAYFDPEVDTIFEIGGQDAKYTYLN
FT                   EGVPYDYAMNEACSAGTGSFLEEAAREALGINYTDIADRALRGKNPPNFSDQCAAFINS
FT                   DIKTAIQDGISSEDICAGLVYSICMNYMNRVKGNRPVGNKLFAQGGTCYNKAVPIAFAA
FT                   LTGKRVVVPPYPGLMGAYGVALITIENLQKGILKKNLYDLKELADRQVKYLKPFVCKGG
FT                   KSGCDRKCNISVIEIDGKRVPFGGSCNLYENIRENRVTDDTLDFVKKRENLLYSIPRVE
FT                   NAQKRIGLSRSFAMNSLFPFFSAFFAHMGFEIVLPDEPDEHAKDIMGAEFCFPVEQSHG
FT                   FLISLLRKKPDYIFIPKIRAIKIDHSSSKGVFCPFVQSEYDWLKADISELENVNILSCR
FT                   IDFTEKPDSVIKSLYKMLEKAGFKLRDVERAYSAGMQAQKNFGEKLKEFGVEFLKKVRE
FT                   FGTGIVIFGRSYNAFLSYANLGIPKKIASYGYPVSSFDMLPFEDKSGYENMYWAWGEMI
FT                   LKAARYVKNMPDLYPVYITNFSCGPDSFVISYFKEIMKGKPALILELDSHTADAGIETR
FT                   LEAFFDVIKHRKTKVEKPAINSFMEVKVDKAGVFIKKDDMVIPWTDRRVRLVFPTMGAF
FT                   GASCLAASFEHFGVRTHVCPEMGEIEYKLGRGNSLSKECLPLHLTLGSLIRYISIRPEN
FT                   EITLYFMPQTSGPCRFGQYNVYMKLWLRQNKISDVALLSLNSENAYGGLGINFTIRAWI
FT                   SILISDLYSNIEKTILALHPDREFASKLVQTHKSEIVKSLRSQDISGIFKTLKNISTDL
FT                   IEMNLSEKYKNAPKVLLTGEIYVRWDEFSRKKLEDLFASYGVVMQVSPIHEWIYYTDYI
FT                   FMKKLTSKDAPFWQRIKKALEIAVKRYFEKRVKHIFEAAGLCDTRMLNINEIMANASLH
FT                   LDPALTGEAILTIGSALTEIGKHYEGVVAIGPFGCMPSRIAEAIIKNALEKREKRYPFI
FT                   ALEVDGNPFTPSVEAKIDAFISQVKSLRR"
FT   gene            574798..575739
FT                   /locus_tag="Tlet_0544"
FT   CDS_pept        574798..575739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0544"
FT                   /product="DNA polymerase III delta"
FT                   /note="PFAM: DNA polymerase III delta; KEGG: tma:TM0181
FT                   putative DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33111"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M7"
FT                   /protein_id="ABV33111.1"
FT                   /translation="MAVIFLSGDARVLKDEYVEALCRKKMLKKIKISLEESKRIPELVS
FT                   QMGLFSKDFLIDVVDFDEWKKVDQKELLQQLSSSNFLAVLRTFSTSRKTDVIDFSLPKP
FT                   WEKEKWIEYISKRFEKSSLEYNYEGVEKFFDFVGADDLLIERETEKLACIGEKVTPDIV
FT                   SLAVCNYSKIQMEEFCFAVSTLNRHAHYLLHDMSFYTEIVALVNVLSKHFVDLYRILSA
FT                   VEKRDSYSWMYIKNISQKLNIPVVKSAKFLGFSFKNQPSSINHVKIYSFEKLRIILRQL
FT                   QYLDREVKSSEYRLIAIHVFIDFVFRLMEGET"
FT   gene            575736..576887
FT                   /locus_tag="Tlet_0545"
FT   CDS_pept        575736..576887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0545"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: tma:TM0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33112"
FT                   /db_xref="GOA:A8F4M8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M8"
FT                   /protein_id="ABV33112.1"
FT                   /translation="MKIIFRFHKHNRYSLIPLIAAIHDKFPSIEMAFVGSLNEIMNISP
FT                   PAVVAYSFMSFDVDWVSQEVNILKKKGYALIAGGPHATAKPEDVIRMGFDHVFKGDGEE
FT                   NILLFLKGERSTVFDGLVKRINIDEYPPFCSDLDLFMPIEITRGCPFGCAYCEVSLIGG
FT                   KKPRHRSVESIVHHCKSGINKSRYIARFITPNAFGYGSDGMKVNVEAIDNLLYNLKKVG
FT                   MKEIYFGSFPSDVRPEFVTDEVLKTIKKYVNNRYIILGAQSGSDRVLRLIKRFHTVEHV
FT                   VRSAEIVLNNGFVPRVDIIFGFPFENEDDLAKTFDLIKKLVKMGCKIHAHTFMPLPGTE
FT                   LESSGHAVLPEWVRRELSRFAQEGNLDGYWEKQLFLSKYLSEL"
FT   gene            576970..578184
FT                   /locus_tag="Tlet_0546"
FT   CDS_pept        576970..578184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0546"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: AAA ATPase central domain protein; zinc
FT                   finger C4 domain protein; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: tma:TM0146 ATP-dependent Clp
FT                   protease, ATPase subunit clpX"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33113"
FT                   /db_xref="GOA:A8F4M9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4M9"
FT                   /protein_id="ABV33113.1"
FT                   /translation="MAEKFCSFCGRSANQVNKLIAGPNAYICDECVELFHDLLVTDKRV
FT                   KREKRRELPKPAEIKAELDKYVIGQEKAKRVISVAVYNHYKRVFYESDNDDVEIEKSNI
FT                   MLIGPTGSGKTLIARVLAKILDVPFAIADATPLTEAGYVGEDVENVILRLLEVAHFDVE
FT                   RTQYGIVYIDEIDKIARKSPNPSITRDVSGEGVQQALLKIVEGTVANVPPQGGRKHPYQ
FT                   EFIKVDTSNILFIVGGAFDGLEEIVKRRIQDSSMGFGADIKSKKRMRLGEILSHVVPDD
FT                   LVQYGMIPEFVGRFPVIATLDDLTEEDLVRILNEPKNAIVKQYKKLFQLDNIELEITKD
FT                   ALYAIARKALTKGTGARALKGVFEEVMIDVMFEIPSTKNVEKVVVTRESVEGKEKPRIV
FT                   MREIA"
FT   gene            578184..579176
FT                   /locus_tag="Tlet_0547"
FT   CDS_pept        578184..579176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0547"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22 glycoprotease;
FT                   KEGG: tma:TM0145 O-syaloglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33114"
FT                   /db_xref="GOA:A8F4N0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N0"
FT                   /protein_id="ABV33114.1"
FT                   /translation="MPSILAIETSCDETSVSILKDNQILSNIISSQIDIHAVFGGVVPE
FT                   VAARHHLKNLPLVFEKAIQQADISLSQIDAIAVTTGPGLAGSLLVGISFAKGVAIALEK
FT                   PLIGVNHLLAHVFAAKLAFSELEPPYLALLVSGGHTELLMFENSSINPVLLGRTLDDAA
FT                   GEAFDKVARLLEIGYPGGPAIEQLSLTGNPYKYRFPRAMLEEGNLNFSFSGVKTSVLYT
FT                   LKENEKICKPDIAASFQEAVVDVLIEKTAMAVRMTGMKKVVVVGGVAANSRLREKITFW
FT                   AKENDLQIYIPPKNLCTDNAAMVARAAIDLMKNESYASLNVTADPALSF"
FT   gene            complement(579142..579399)
FT                   /locus_tag="Tlet_0548"
FT   CDS_pept        complement(579142..579399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33115"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N1"
FT                   /protein_id="ABV33115.1"
FT                   /translation="MFIQITRGVFVNKDRVKAVIPLNSVMAKQMREAANFSNKTLNLTY
FT                   GAQARTVVITDSGHVFLLGEKVNKVRQKLLKKKEQDQQSH"
FT   gene            complement(579412..579870)
FT                   /locus_tag="Tlet_0549"
FT   CDS_pept        complement(579412..579870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0549"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: tma:TM0157 actinorhodin polyketide dimerase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33116"
FT                   /db_xref="GOA:A8F4N2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N2"
FT                   /protein_id="ABV33116.1"
FT                   /translation="MRKSAFDYLLQGVYLVSTCCENQLAGLTAAWVMQSSFKPAMIAVS
FT                   LGPDRRTAELIEKSGKFSVQVLDNSQKDIAKIFGYQSSRDIDKFSRVDWFESEKLKLPI
FT                   VNGILAYFECELSGKLSSGDHVIYNATVLNHKVLKNGEPMIFSMRDWF"
FT   gene            579911..580831
FT                   /locus_tag="Tlet_0550"
FT   CDS_pept        579911..580831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tma:TM0389 putative ABC-2 type transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33117"
FT                   /db_xref="GOA:A8F4N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N3"
FT                   /protein_id="ABV33117.1"
FT                   /translation="MKAIIVKNLKKYYGAVKAVDDISFDVNQGEVVALLGPNGAGKTTT
FT                   IEILEGLRKKDSGEIYYFDRKVDHIDKEIKKRIGVQLQKTAFFEYLTVQETVELFAGLY
FT                   DMKVDKKTLKNLVELVSLGEKAKSRVKNLSGGQLQRLALITALVNEPEIIFLDEPTTGL
FT                   DPQARRYVWQIIETLKKQGKTILLTTHYMEEAERLADRVLIMDHGKIIASGTVWQLVES
FT                   LNMDSYIEFTVDDAEKIAELRKEIDGMEILEEQRAALATNDVEETIQVLLNRVKQMGFQ
FT                   IDNITIRRPNLEDVFLHLTGRYLRD"
FT   gene            580843..582009
FT                   /locus_tag="Tlet_0551"
FT   CDS_pept        580843..582009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0551"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tma:TM0388
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33118"
FT                   /db_xref="GOA:A8F4N4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N4"
FT                   /protein_id="ABV33118.1"
FT                   /translation="MRILKLSKFLFFNEIREFNGFFWPIIFPGILFFILVSIFSGVSTE
FT                   SYSTTFSLAIVEEEQLAGFGKILERVLDQIRPDPFQVAYFQSFEEAEKALKSKKVDLIL
FT                   RIPEGFNVKLMRAVLFSDAPAKIDLYTLSNYYESSTAAQILSMIFQQVDLSISRQMKNQ
FT                   SAEYVSVEAKTVAVEKETENEFHYATYIFPGILLMSVLSIAVFNLPLTLIYNRYEGINK
FT                   KLHTTPVGVLDYFTSLSLSLVSMMIISCVVVYSMGIFIYGVSHNCLSGEFLVKLFYAMI
FT                   VCSGLGIMIASFCKKISTAMVISQISYQILMFLGSFYFPVLNYNMPEFLKVIARMLPTT
FT                   YLVEDLRVSLGYNFYSFSAFDLWVLPGIWFAISMLIFMVNFKKVMGYE"
FT   gene            582002..583057
FT                   /locus_tag="Tlet_0552"
FT   CDS_pept        582002..583057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0552"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tma:TM0387
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33119"
FT                   /db_xref="GOA:A8F4N5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N5"
FT                   /protein_id="ABV33119.1"
FT                   /translation="MSRQFSSFLKAYILESLRNSVELFFSVLFPIVFLVIFGFMFSDTS
FT                   PSNKTLGVFFDREIYYSELEKLENWELKSYSDTEQLLTDIKNGKIPLGVVVKDENVILY
FT                   YSRSEVSILGDMKILQSSLVPIVEKALNSAKQYLAVNVSQISQTGIDVSEFDYMMMGVI
FT                   ALSLFSNGMFSMVTVFGRYKKQNVLKRLMTTGADPMNILVSISFVRLVMSFISLAMILF
FT                   ISKLIFRSNIQFNWFFLVPSIVFVTLGMMAIGILIVVLLKNPNAASNAASVMNVIMVFF
FT                   SGIYFPVRFMPPYIRWIAHISPVKYAADLLRFAANAQQMSFAFYLIVNSVFFACGIIGL
FT                   IFSSKMFMKPE"
FT   gene            583069..583263
FT                   /locus_tag="Tlet_0553"
FT   CDS_pept        583069..583263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tma:TM0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33120"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N6"
FT                   /protein_id="ABV33120.1"
FT                   /translation="MNCVNKERNLKKCNCSYPGCPRKGICCECLSYHRSHGELPACYFS
FT                   DEDEKSWNRSIEYFVSKNK"
FT   gene            583637..583927
FT                   /pseudo
FT                   /locus_tag="Tlet_0554"
FT   gene            584238..584315
FT                   /locus_tag="Tlet_R0012"
FT                   /note="tRNA-Asp1"
FT   tRNA            584238..584315
FT                   /locus_tag="Tlet_R0012"
FT                   /product="tRNA-Asp"
FT   gene            584368..584910
FT                   /locus_tag="Tlet_0555"
FT   CDS_pept        584368..584910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tma:TM1091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33121"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N7"
FT                   /protein_id="ABV33121.1"
FT                   /translation="MKLLLGRQIVLKEFPLIDLVISWIEEPVAGALAYLIGSDRGYMYI
FT                   LANSEDIHYGSGLDYLDTIYGKIAVICSDKDLSWKVFKSAKTHEALLAVVFKYLESYDD
FT                   LFLTKTICWGSSREFNIPVVLIANYKGNLHHQLCVPSQGEDRSGIIFDSTTTCVVEANM
FT                   FETDDGVMFRIRSFAEG"
FT   gene            584917..585756
FT                   /locus_tag="Tlet_0556"
FT   CDS_pept        584917..585756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33122"
FT                   /db_xref="GOA:A8F4N8"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N8"
FT                   /protein_id="ABV33122.1"
FT                   /translation="MNLVRFFLRFLLNDTKLRYYSKFLEEPLQKMTSGNVVRVAVIQMN
FT                   YSPVSGIGNFVELINQYLEKMRNFSPQIIVFPNLLDTIIFGTFPAFFYLKGRRTVKLIK
FT                   SCSSITSYACEKIMAELSNKWQCTVVFGTTVGQFVYHCGVKQKNVFSTSNYKIAVLPKR
FT                   DIVNSEKLERYIKDGVRIIATTGCGVVDFNEWDDRFSMWVHSQMVGFYGLWSLMSGIVF
FT                   GKEIKGRACVTAPVPITRSQDGYIVKSDTLQGDVVLLAELDMQKIDFFLLSRAVSIY"
FT   gene            complement(585761..586759)
FT                   /locus_tag="Tlet_0557"
FT   CDS_pept        complement(585761..586759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0557"
FT                   /product="pyridoxal phosphate-dependent enzyme, D-cysteine
FT                   desulfhydrase family"
FT                   /note="TIGRFAM: pyridoxal phosphate-dependent enzymes,
FT                   D-cysteine desulfhydrase family; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: tma:TM0225 1-aminocyclopropane-1-carboxylate
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33123"
FT                   /db_xref="GOA:A8F4N9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005966"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4N9"
FT                   /protein_id="ABV33123.1"
FT                   /translation="MKLSFAKLPTPVEFLSRLSKQYGRNIYVKRDDMTEFISSGNKIRK
FT                   LEFLLADALRKNCDVVFTCGGIQSNHARATAHMAVKLGLKPVLFLRENPPDLLDNKMQS
FT                   VFKTDEAMHSNGNFLLCKLLGAEIVIVNSKDYARIEEVYEEYKKHYEKKSHRVYTIPVG
FT                   GSNSLGAMGYLLAASEMASQIDLNEVDAVYCAVGSGGTYAGLLSGFRYMGYKTKVIGIN
FT                   VTKTSREEFTNTVFEIIKGMKQYGIDTCVDREEIKIIDDFSGPAYAIPSESDIKCIKYV
FT                   ACKEGIILDPVYTAKAFRGMLEISKENQTVLFIHTGGIFGLFAQAAKFTEA"
FT   gene            complement(586760..587869)
FT                   /locus_tag="Tlet_0558"
FT   CDS_pept        complement(586760..587869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0558"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD; KEGG:
FT                   tma:TM1726 alanyl-tRNA synthetase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33124"
FT                   /db_xref="GOA:A8F4P0"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P0"
FT                   /protein_id="ABV33124.1"
FT                   /translation="MIKIKKVREENDKFLAFAEKSPFYPDGKGGQLGDRGKIDTALVLG
FT                   VEEREGLICHILDAPVEPGEHTFEIDYLRRKDIAIQHSAQHILSASFLRVADIQTLSFH
FT                   MGEEFSTIDLDVPQITEVVLQEVEEMANEIVRSCIKVEIVETNIESAKNLNLRKSLSEK
FT                   VGEIVRVVKIGDFDLSACAGFHVSNTGKIGIIKIVSWEKVKKTLTRVYFLAGNRALRDY
FT                   SIRVSVLRELSTLLTSSVSEMPARTRILLEKVKDQAALINRISEEYAKYLSKDLETHKI
FT                   KGINVSVYNGFDDVARFLPKYFQGDLLICKTSDGYQFSSEKIDCSKLIAFLREKTQGAG
FT                   GGGTKKGSLKTSAPINKIFSLIDNYLGVI"
FT   gene            587929..589086
FT                   /locus_tag="Tlet_0559"
FT   CDS_pept        587929..589086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0559"
FT                   /product="protein of unknown function DUF401"
FT                   /note="PFAM: protein of unknown function DUF401; KEGG:
FT                   tma:TM0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33125"
FT                   /db_xref="GOA:A8F4P1"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P1"
FT                   /protein_id="ABV33125.1"
FT                   /translation="MVTASVMISLFTIILLQRFTKILIISMISGFMVFALFNRQIFFHM
FT                   IKLLGASLSDGSFLTLIPSIFLIYFLGELMSVSRDSDGFSQSVQKLFEGSRGASVFIPA
FT                   IVGLMPMPAGAMFTAPMIDQIGSDMSKLEKTTVNYWFRHCLEFFWPVYPAMYLLASLIN
FT                   MPIGVVSLRLFPLFLVAFLSGWVFFNGFNFPKLKNLELSEWKKLWPIAVILSTGLMILL
FT                   FKLEGWVALTIATVFYASIRNKYILEAFKRAVRKLDIIFILIIVFLYKHSMIDLQIGQK
FT                   MSEELSKIGFNVLLIAILLPLITGMSTGLTHAALGISLPIVMSMGGYRLGLVTYVFSVT
FT                   GVLLSPVHLCLVLTANYFKVDFIKVLGKILIPILIISVITVVFYP"
FT   gene            589105..589782
FT                   /locus_tag="Tlet_0560"
FT   CDS_pept        589105..589782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0560"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   tma:TM0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33126"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P2"
FT                   /protein_id="ABV33126.1"
FT                   /translation="MTRFIDKMFPKQSPLRLLYEHALLTKKVSQFIVPALKNYFEDLPV
FT                   EKMSEEVDVLEDKADEIKILIRESYTKLKFVYFDRVDILTILHEEDGVIDAVDDFLKAL
FT                   MLNKVEKPVIAEIQNIMIELAESCSDAVEGMVKSVSDLLLLVESSFAPSVALEEDRTAT
FT                   RVESNESNTDKLSLIAGKKIFSLKNAIHPVDIYYLEKLIRLLTRIADHAENVAERVRMI
FT                   THI"
FT   gene            589801..591006
FT                   /locus_tag="Tlet_0561"
FT   CDS_pept        589801..591006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0561"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: tma:TM0261
FT                   phosphate permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33127"
FT                   /db_xref="GOA:A8F4P3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P3"
FT                   /protein_id="ABV33127.1"
FT                   /translation="MVTLIAFGTGVAMAFAIGANDVANSMATAVGAKAITPKQAVLIAS
FT                   VLEFLGAVLFGSHVTSTITKGIVKVDIVNDPNTLMIGALAALISSSVWVLAATFWGMPV
FT                   STTHSIVGGMAGFGIAAGGWNAIHWAKMVSIAMSWVISPLLGGLLAYGVFKLISLLVLR
FT                   RDNPVRAAKKTGPIIIWVTFFIIVYLFAVKTVKIGYGKSFVFSFSVSALAMIAGYFLLK
FT                   RNSQKHNADPYDFVENMFRRLQVMTSCYVSFSHGANDVANAVGPVVVVYSVIKTGMVSS
FT                   QIHTPIWILFLGGLGISMGVLFLGYRVMKTIGSDITPLTNTRGFCIDFSTASTVLMASV
FT                   LGFPVSTTHIVVGSVVGVGMARGIEVVNVGVLKNIVLSWLFTVPLAAVFSAILFKLFTL
FT                   II"
FT   sig_peptide     589801..589860
FT                   /locus_tag="Tlet_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.505 at
FT                   residue 20"
FT   gene            complement(590999..591316)
FT                   /locus_tag="Tlet_0562"
FT   CDS_pept        complement(590999..591316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33128"
FT                   /db_xref="GOA:A8F4P4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P4"
FT                   /protein_id="ABV33128.1"
FT                   /translation="MKKIILILEFIAALINFAFLIKIDPMFSICVLIFSSVLLFGVSEK
FT                   DSDKINAHLMVGGGLLFLLSIFSILYSISKLELPEPSYYLTIIMGLCGLLQAIFYRKRF
FT                   K"
FT   gene            complement(591313..593232)
FT                   /locus_tag="Tlet_0563"
FT   CDS_pept        complement(591313..593232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0563"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein;
FT                   nucleoside recognition domain protein; KEGG: tma:TM0051
FT                   iron(II) transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33129"
FT                   /db_xref="GOA:A8F4P5"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P5"
FT                   /protein_id="ABV33129.1"
FT                   /translation="MSLRVALCGNPNVGKTSLFNALTGLRQYTANWAGVTVDIKEGIRN
FT                   WKGMQITFTDLPGTYSLSSFSLDEKIARDYLLYNTPDILLVVADSLSLKQGLYLFLEAA
FT                   ELDVKIILVVNAIDEAKKSGIHIDRSELSKHLGVPVILTSAVTGEGINELLDSIVKVAA
FT                   DQKKTVRFALKKEIEDEIEEIESSIQSKPELRTFPVRWLSIKYLEGDPDTIKLIGEISS
FT                   KAGALREEIAREKYKHIDLILKEVMNFSQQKFSISEALDHVLTHKYTGIPVFLALMYIT
FT                   FTFSFEIVQPLSDLIENAFNLIADTLRHTIGNRLVASLLADGIISGIGSVLVFIPNIFG
FT                   LFLILGIMEDSGYLPRAAFVVDRIMYKLKLSGRSFMSFLLGFGCTVPAIMSTRGISDSR
FT                   ERTIAVLSVPFISCSARLPVYLLIASIFFDKNKGLIVFIVYLLSIAVTLISSVLLNKIL
FT                   FKGQPGFLILELPRYRMPKFKNLALYVWIRGKHFLIKAGTIIFVASVLLWILSYFPSMN
FT                   PSESFASYIGKFLETILRPLGFDWRISTSLIFGVAAKEVIVSAFGMFFGHEGSFRIALA
FT                   NSIDSVTAFSLLIFIMAYIPCFATLGSISSELGKKYALISVIYSFSIAYLLAYIVRLIG
FT                   GIFL"
FT   gene            complement(593229..593666)
FT                   /locus_tag="Tlet_0564"
FT   CDS_pept        complement(593229..593666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0564"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: tma:TM0050 iron(II)
FT                   transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33130"
FT                   /db_xref="GOA:A8F4P6"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P6"
FT                   /protein_id="ABV33130.1"
FT                   /translation="MSLSEVPVGFFATIKSVHNSPAGARLISLGFIPGASVKVVRAAPL
FT                   GDPRVYNIMDKLITLRNDDANLIEVLLQDNLINLSNAPRGIYSVVNVIGGRFFKDKMAQ
FT                   IGVENGSIVEVIKPFLIKTNKGTFQVGRGMSGRIILRRIEE"
FT   gene            593797..595473
FT                   /locus_tag="Tlet_0565"
FT   CDS_pept        593797..595473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0565"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC C subunit domain protein; excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   tma:TM0265 excinuclease ABC, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33131"
FT                   /db_xref="GOA:A8F4P7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4P7"
FT                   /protein_id="ABV33131.1"
FT                   /translation="MDLLHKAKLAPLLPGVYIFYGKNKEYIYVGKAKRLRNRLLSYFNR
FT                   SNGKYSKKIQAIVNEAEELDYIVVSNEREALLLEANLIFNHKPKYNVMLKDAEFYPYIE
FT                   ITKELFPAVQIVRIRSTGGEYFGPYTDVKFVKDLIDCLQQVYQFRTCRRDMSKSTKPCM
FT                   EFYMHRCAAPCTGDLEPDSYINSSIQPLRRVLNGDISETLDLIEEKMKKHAKMMDFENA
FT                   AKYRDLLVKFENVMQRQGVVLEQWRNLDVIGRFKNSYAVLRIRGGHVVGKLSYELDSTK
FT                   LEDFIFHYYMVGKNELPEAVILERNINFDAEIYFGRPRDKLEEELLHKARENAKNQAYT
FT                   SGLRKDLLNKMVKVLNLNRYPMKIEGFDVSHLHGKLTVASVVVFFDGLPRKNEYRHYRF
FT                   NSDRIDDFLTLKELVKRRYSKHELPDMIFVDGGTGQINAVVEALMEIGKECDVVGLAKQ
FT                   NEIVCTRFGELILPFDSPILRTLVRIRDEAHRFANSFHRKLRRKSALSSILDEIPGIGP
FT                   KRKKKLIEAFGSVKNIRSATLQEIAEVLGSRKLAAEILSRL"
FT   gene            595487..595939
FT                   /locus_tag="Tlet_0566"
FT   CDS_pept        595487..595939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33132"
FT                   /db_xref="GOA:A8F4P8"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P8"
FT                   /protein_id="ABV33132.1"
FT                   /translation="MKIANYLIMLLGIFCASIGFLMLSVYGVAVYLSPMLEEMLNLTIN
FT                   TSKWFLFVVLLTISSGICISYYSLAKANRDNYMIFLSFTVIANGFSFFVQLFRMVVHGI
FT                   AWVGVELLGEHGDVKTVQYLSIGFLLFTLVNFVLSLSILRGERVSH"
FT   sig_peptide     595487..595570
FT                   /locus_tag="Tlet_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.901 at
FT                   residue 28"
FT   gene            595936..597222
FT                   /locus_tag="Tlet_0567"
FT   CDS_pept        595936..597222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0567"
FT                   /product="protein of unknown function DUF795"
FT                   /note="PFAM: protein of unknown function DUF795; KEGG:
FT                   tma:TM1513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33133"
FT                   /db_xref="GOA:A8F4P9"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4P9"
FT                   /protein_id="ABV33133.1"
FT                   /translation="MRVLGIIVEYNPFHNGHLYHLRKAKELVKPDYTVAVMSGSFCQRG
FT                   EPAIIDKFSRAEIALQNGVDVVFELPFVYALQDAGGFAKGAVWLLEKMNVVTDLVFGSE
FT                   SGNLSFLNKIADVMINQPYPFPEIMKEELKKGYSFPNARKYALMKYFERTGEMNPREVL
FT                   KIEKSNDILGVEYVRSLKELGSKINVQLIKRVGADEKDKVFKGKFPSATSVRNMIFKGD
FT                   WSGVSRAVPDSSLQIISRELNEGRGPVTLSQLEEILLAKLRLSSKKELQMLYGFSEGID
FT                   VRFSNCALKTGDLEEFFNCVKAKRFTMSKIRRLSLYALFELKQDLIVQCNEKGPQYLRV
FT                   LGFTNNGRKLLSIVKRKASVPVVSVCSLYKKILSKALKNKEGRFEVDEKLFEHQLRLDI
FT                   KSTSIHSLLFPSKSERNGERDFRIPPIMV"
FT   gene            complement(597239..597688)
FT                   /locus_tag="Tlet_0568"
FT   CDS_pept        complement(597239..597688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0568"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   pfu:PF0752 thioredoxin peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33134"
FT                   /db_xref="GOA:A8F4Q0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4Q0"
FT                   /protein_id="ABV33134.1"
FT                   /translation="MEFLGKKIDNLSLKDHNGKIEKLYHLQKKVLLSFHPLAWTSICSK
FT                   QMLSIEEKYDVFAKLNVAPFGVSVDPLPSKKAWAESLNIKKLPLITDFWPHGEIAKSFG
FT                   LFREKDGFSERANVILDENKVVIFYKIYPIEELPDIEELIGFLKK"
FT   gene            complement(597693..598547)
FT                   /locus_tag="Tlet_0569"
FT   CDS_pept        complement(597693..598547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0569"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   beta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, beta subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; KEGG: pfu:PF0753
FT                   2-oxoglutarate ferredoxin oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33135"
FT                   /db_xref="GOA:A8F4Q1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011896"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032686"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4Q1"
FT                   /protein_id="ABV33135.1"
FT                   /translation="MNTEYNIPNIDIAWCPGCGNYAIHDILRKTLQELNIPPEKLVIVS
FT                   GIGQAAKAPQYIKCNYFNGLHGRSLPVATAIKACNPDLIVIAESGDGCMYGEGGNHLLH
FT                   TIRRNPDITVLIHNNMVYGLTKGQASPTSPKGFTTPVQIQGTISDPINPISLAISQRAS
FT                   FVARAYCADTEQTKEIIKQAITHKGLAIVDILQPCVTFNKINTYKWFKEHTYYFKNHNP
FT                   SDISAAFAKAIEVDPLPLGIFYKQEKPTFEEQLPIYSKNRDAIFKRKHDLAKIKEILDI
FT                   RRG"
FT   gene            complement(598544..600238)
FT                   /locus_tag="Tlet_0570"
FT   CDS_pept        complement(598544..600238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0570"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; KEGG: tma:TM1164 2-oxoglutarate ferredoxin
FT                   oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33136"
FT                   /db_xref="GOA:A8F4Q2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4Q2"
FT                   /protein_id="ABV33136.1"
FT                   /translation="MEYSFIIAGEAGQGIQTVEVLLPKIFKKAGLNVFSYKEYMSRVRG
FT                   GSNSTLIRVSDIPVRAFKQKADFALFLSNDVSHLKRISNRLSSDSILVVDEEFPGIDDT
FT                   LKVLRIPLLKTASALGNKIYANSVMIGFATALLGVDLENTLNIVKQYFSKKSKEVIFQN
FT                   LEAVKSGYENGLASKKKLSITKLKQNKQICDQFLLSGAEAVAFGALAGGCNFISSYPMS
FT                   PSTGVLVQLAKLSDNFDLIVEQTEDEISAINMALGAWYAGGRAMVTTSGGGFALMIEGL
FT                   SLAGMIESPIVVHLAQRPGPATGLPTRTEQADLMFALYAGHGEFPRVIYAPGNLEEAFL
FT                   CSWKAFQIADKYQIPALILTDQYLMDMIYNIENVPLPENIENYLIKTDSDYLRYKLTQK
FT                   GISPRGIPGWGEGLVCVDSDEHDESGRITEDFEMRKMMVEKRMKKMSNFKDYYTPELTG
FT                   NSGYEVLAVCFGSTKEIVKEAAQSFENIAVLHLVQLYPLPRDLKKYFDMAKKVVIIENN
FT                   FTSQFASLLKTFANLDHSKKVTKYDGMPFSVEEIKNVFEQFTEEGEV"
FT   gene            600349..601884
FT                   /locus_tag="Tlet_0571"
FT   CDS_pept        600349..601884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0571"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; 5TM Receptors of the
FT                   LytS-YhcK type transmembrane region; KEGG: chy:CHY_2219
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33137"
FT                   /db_xref="GOA:A8F4Q3"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4Q3"
FT                   /protein_id="ABV33137.1"
FT                   /translation="MFLAITLLSRVALLGLIVFVVIQSYSARISLAKIFNTKKPYILGL
FT                   LGGIFGVAGNFLGLPYKGAIINFRDMGIIVTALYGGFPAALIGSMIASIHRYLLGGPSA
FT                   FACALGTIGAGLFSSVFRKRFFHSKNKILAGSVVAIFAELIHLSIAYFFIYPPELAADI
FT                   VFNALIPMTVSNFLGVGLTLTLVKQSEQYVKNFSSQIFSITLRVFESAVRLLENPNMEN
FT                   LNLFSKDLAKILNVDKLTIKLEDEFKPEKKGECRLFIPLISRGKIIGRIIVENRDGFDE
FT                   DQIFMIKQISKFVEIVVIGATAVREAILAREAMMRDFMSKLGPHFIFNTLASIRYLTVN
FT                   NANDAVKMIDNLSELLRYYFKNQKTFVSLNEEIKIIECYLSIMKARYGDILSYHINVTG
FT                   DFRNHPVPPMILQPVIENAVEHGEKNGKIYVKIEAEKYGDYMILKVSDSGKGLSRGFKK
FT                   GVGMKLLETRLENIYSKKASVKYVNDNGLTVLIKIPLECESVNMYDKSGYSGR"
FT   sig_peptide     600349..600447
FT                   /locus_tag="Tlet_0571"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.610 at
FT                   residue 33"
FT   gene            601856..602527
FT                   /locus_tag="Tlet_0572"
FT   CDS_pept        601856..602527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0572"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: btl:BALH_4946 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33138"
FT                   /db_xref="GOA:A8F4Q4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4Q4"
FT                   /protein_id="ABV33138.1"
FT                   /translation="MIKVAILEDEQLARDNLEQLIRKYSEFELVGSFSTGRELLRHLKD
FT                   IDVVFLDVRLSGESGLDVSKKIKSTGIVFVTAYPEYAVEAFEVNAIDYLVKPVSEERFS
FT                   ECVEKISQICSRSLAKLPVKDFDGILLIDFKDILFIEAFGKKCMACTINGEYEVYHWNI
FT                   SHLERRLPREFVRVHKSYICNLEHVKKILCSPCFQIEMENSKLIPVSKKYQKFVKSVLL
FT                   R"
FT   gene            602633..604354
FT                   /locus_tag="Tlet_0573"
FT   CDS_pept        602633..604354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0573"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   aae:aq_1265 carbon starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33139"
FT                   /db_xref="GOA:A8F4Q5"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A8F4Q5"
FT                   /protein_id="ABV33139.1"
FT                   /translation="MNSLVLMLISFFGYIIAYNTYGKWLSRKLFQLKDDNPVPSKKFQD
FT                   GVDYVPTKRHILLGHHFTTIAGTGPIVGPAIGVIWGWLPAFLWVFLGPIFAGGVHDFAS
FT                   LVISSRHGGKTLGEMTKGIVSNRVGVIFLILIQFLLWLVVAVFAMIMGILFDMYPQSVL
FT                   SIWMEVPIAIWVGYMVYKKGKKDTFYSILGLILLYVFAVIGIYLPMKIPQMGPVSPIVT
FT                   WIVILLVYAYFASTFPVQTLLQPRDYINSHELLVLMAVLSIGVIISRPQVVAPVYQHAP
FT                   GAPNLWPVLFVTIACGAISGFHSLASSGTTVKQLERETDAQFVGYGGMLLEGALATLII
FT                   IAVTAGVGMFGAGSSGYFNYYSSWSTTAGAGLAAQLKAIVDGASNLMKTVGIPKELGAT
FT                   LMAIFVVSFAGTTLDSATRIQRFGLEELFRGKGKKPIGPFKNRYFTTFVVVIAAFGLCM
FT                   VSPDGKGALKLWPVFGALNQLLAGLALMIATVYLAKKRKPIWPTLLPMIFMLLMTVWAT
FT                   ISNLTGYIRSQNWLLVFITLVTLIIAVWMIIEAFISMAKAYKKKQVYQEEFAKSDE"
FT   gene            604658..605032
FT                   /locus_tag="Tlet_0574"
FT   CDS_pept        604658..605032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0574"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: tma:TM1505 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33140"
FT                   /db_xref="GOA:A8F4Q6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4Q6"
FT                   /protein_id="ABV33140.1"
FT                   /translation="MPTINQLIRLGRERKVEKPKAPALQGNPQKRGVCVRVTTMTPKKP
FT                   NSALRKIARVRLSNGIEVTAYIPGIGHNLQEHSVVLVRGGRVKDLPGIRYKIIRGTLDT
FT                   AGVENRKQSRSKYGAKRPKK"
FT   gene            605050..605517
FT                   /locus_tag="Tlet_0575"
FT   CDS_pept        605050..605517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0575"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: tma:TM1504 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33141"
FT                   /db_xref="GOA:A8F4Q7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4Q7"
FT                   /protein_id="ABV33141.1"
FT                   /translation="MRRRRAEVRKIAPDPVYSDILVAKLVNRIMWDGKKAVAQKIVYRS
FT                   FEYIQEKSGKDPLEVFQKAIENVRPVLEVRPRRVGGATYQVPVEVQEPRKTSLALRWIV
FT                   AAARAKKGKPMYVRLAEEILASYQGTGTAMKKKEDVHKMAEANRAFAHLRW"
FT   gene            605529..607613
FT                   /locus_tag="Tlet_0576"
FT   CDS_pept        605529..607613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0576"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: tma:TM1503 elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33142"
FT                   /db_xref="GOA:A8F4Q8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4Q8"
FT                   /protein_id="ABV33142.1"
FT                   /translation="MLEIEALYVPLSKLRNIGIMAHIDAGKTTTTERILYYTGRKHVLG
FT                   SVDEGTATMDWMEQEKERGITIKAAATTCFWKEHRINIIDTPGHVDFTVEVERALRVLD
FT                   GAVAVFDATAGVEPQSETVWRQAERYSVPRIAFMNKMDKTGADFFMSIKSMVEKLHAKP
FT                   VAIQVPIGAEKDFIGVVDLIEMKAITWTSEDGSEFIKHEIPENMLDLAEEMREEMISML
FT                   AEEDEELLELYLEEQELPVEKIKDILRKATINNKLVPVLCGAAARNKGIQPLLDAVVDY
FT                   LPSPIDIPAVKAITPSGEEIQIPPSVEGDFAGLAFKIQTDPYVGKLAYVRVYSGKLEKG
FT                   SYVYNSTKQIRERVARLIFMHADKREDAEYARAGDIVAIIGLKNTTTGDTLCSQERPVL
FT                   LEKMSFPEPVISIAIEPLTRDDEERMVKAVAALSEEDPTLRINVDRETGQVVLSGMGEL
FT                   HLEIVTDRLKREFGVNVRVGRPQVSYRETIRQTGTAEGKYVRQTGGRGQYGHVIMKFEP
FT                   LPLDGEKQFEFINKTVGGVIPREYIPAIEEGVKEAMEMGVLAGYPMIGVRAVLLDGSYH
FT                   EVDSSEIAFKVAASLAFKNAMKICQPVLLEPVMKLEVVVPEEYVGGIIADLNARRAQIE
FT                   SLESRINLRVIKAFVPLSELFGYATTLRSLSQGRAVHVAQFSHYKEAPDKVVEKVLKVV
FT                   "
FT   gene            607634..608833
FT                   /locus_tag="Tlet_0577"
FT   CDS_pept        607634..608833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0577"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: tma:TM1502
FT                   elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33143"
FT                   /db_xref="GOA:A8F4Q9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4Q9"
FT                   /protein_id="ABV33143.1"
FT                   /translation="MAKEKFVRTKPHVNVGTIGHIDHGKTTLTAAITKYLSYKGFASFV
FT                   PFEQIDKAPEEKARGITINITHVEYQSEKRHYAHIDCPGHADYIKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHVLLARQVNVPAMVVFLNKVDAVDDQELVDLVEMEVRDLLTKYEF
FT                   PGDEIPVIRGSALLALEANDPNDAAYKPIQELIDALDSYIPEPVREVDKPFLMAVEDVF
FT                   SITGRGTVATGRIERGKIRPGDEVEIVGLSYETRKTVVTSVEMFRKELDEGLAGDNVGC
FT                   LLRGIDKDEIERGQVLAAPGSITPHTTFKANVYVLKKEEGGRHTPFMKGYRPQFFIRTA
FT                   DVTGEITELGNNAEMVMPGDNAILTIKLIYPVAIEKGMRFAIREGGRTVGAGVVAEIVE
FT                   "
FT   gene            608899..609207
FT                   /locus_tag="Tlet_0578"
FT   CDS_pept        608899..609207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0578"
FT                   /product="ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10; KEGG: tma:TM1501 30S
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33144"
FT                   /db_xref="GOA:A8F4R0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R0"
FT                   /protein_id="ABV33144.1"
FT                   /translation="MPGQKIRIKLKAYDHEVLDESAKKIVEVAKSTNAKISGPIPLPTE
FT                   RALYVVLRSPHKHKDSREQFEKRVHKRLIDIIEPSPKTIDALMKINLPAGVDVEIKL"
FT   gene            609227..609859
FT                   /locus_tag="Tlet_0579"
FT   CDS_pept        609227..609859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0579"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: tma:TM1500 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33145"
FT                   /db_xref="GOA:A8F4R1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R1"
FT                   /protein_id="ABV33145.1"
FT                   /translation="MKMILGRKIGMTRLFINDVSIPVTVVRAGPCYVVQKKNPQIDGYC
FT                   AIQVGFEHLKRVNKPLEGHFKKAQVKPLRLLREIRLEDENELDSYEIGQEIKLDIFQPG
FT                   EKVDITGWTKGRGFSGGIKRWGFSGGPRAHGSKFHRELGSLGQHTEPAKIFKGKKMPGR
FT                   YGNERVTIHNLEVIKIDLENNLLVLKGSVPGARGSLVIIKSPRRTRK"
FT   gene            609883..610563
FT                   /locus_tag="Tlet_0580"
FT   CDS_pept        609883..610563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0580"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: tma:TM1499 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33146"
FT                   /db_xref="GOA:A8F4R2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R2"
FT                   /protein_id="ABV33146.1"
FT                   /translation="MAVVDLYNMKGEKVGTQELKDDIFNIEPNFDVMWRYVDYQLSLRR
FT                   AGTVSTKTRSEVSGGGRKPWIQKHTGRARHGSIRSPIWRHGGVAHGPKPRDWSKKLPKK
FT                   MKKLALKSALSQRFKEGNIIVVDDIGFDSSKTKNMRQLIKAFGFEGKKILFVLPWKRSE
FT                   YENVKLSCKNIPGLKAIIADNPGATRENESIMRIDGLNVFDILNHEKLVLTRDMVMKIE
FT                   EVLG"
FT   gene            610560..610862
FT                   /locus_tag="Tlet_0581"
FT   CDS_pept        610560..610862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0581"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: tma:TM1498
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33147"
FT                   /db_xref="GOA:A8F4R3"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R3"
FT                   /protein_id="ABV33147.1"
FT                   /translation="MNQQKLTHYDILIKPITTEKTMLDREKRKYVFEVNVLSNKALVKN
FT                   AVESLFNVKVEKVNISLVKPKPKRRGRFEGKTRRWKKAVVTLKEGYTIKELEGQQ"
FT   gene            610877..611704
FT                   /locus_tag="Tlet_0582"
FT   CDS_pept        610877..611704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0582"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: tma:TM1497 50S
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33148"
FT                   /db_xref="GOA:A8F4R4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R4"
FT                   /protein_id="ABV33148.1"
FT                   /translation="MGLRKYKPATPGVRFMIRNDFSGLTKKEPEKSLLVPLKKTGGRNH
FT                   YGRITVRFRGGGHKRQYRLIDFKRDKIGIPAKVSAIEYDPNRSARIALLVYADGEKRYI
FT                   LAPNGLQVGDTVLSGIDAEIRVGNALPLENIPLGTLLHNVEIRPGSGGKIARSAGVSCQ
FT                   LMAKEGNYALLRMPSGELRKVHIKCYATIGVVGNEDHKNEVFGKAGRTRWIGRKPHVRG
FT                   MVMNPVDHPMGGGEGRGKGQHPVTPWGMPTKGYKTRRGRRASDKFIVRRRNQV"
FT   gene            611721..612008
FT                   /locus_tag="Tlet_0583"
FT   CDS_pept        611721..612008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0583"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: tma:TM1496 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33149"
FT                   /db_xref="GOA:A8F4R5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R5"
FT                   /protein_id="ABV33149.1"
FT                   /translation="MARSRKKGPYVDPKLLKKIRMLNESGEKKIVKTWSRASTIVPEMV
FT                   GHTIAVHNGLKHIPVYITENMVGHRLGEFAPTRRFGGHADKKAATKGQVR"
FT   gene            612033..612452
FT                   /locus_tag="Tlet_0584"
FT   CDS_pept        612033..612452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0584"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: tma:TM1495 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33150"
FT                   /db_xref="GOA:A8F4R6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R6"
FT                   /protein_id="ABV33150.1"
FT                   /translation="MVSENEKTRRPKRSIQHRQNKDENNIEIKAVAKFLRASPRKVRSV
FT                   ANTIRGKSVSEAFQVLEMSPKKAARLIEKVLRSAVANAENNANLSSDSLYISRCFVDDG
FT                   PRYKRIWPRGRGRADIIQRRMCHVTVAVKSIEAKS"
FT   gene            612465..613094
FT                   /locus_tag="Tlet_0585"
FT   CDS_pept        612465..613094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0585"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; KH type 2 domain protein;
FT                   Ribosomal protein S3 domain; SMART: KH domain protein;
FT                   KEGG: tma:TM1494 30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33151"
FT                   /db_xref="GOA:A8F4R7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R7"
FT                   /protein_id="ABV33151.1"
FT                   /translation="MGQKVHPRGFRLGVSADWQTRWFNEKNYATWLKEDEEIRKVVKNA
FT                   YSQAGISEVFIERPDNESVTITIKTARPGVIIGKKGAEIGKLREDLEKELNRRVIVNVE
FT                   EIKTPETDAQLVAENIAGRIEKRASYKRAMKRALSDALRKGATGVKVMVSGRLAGAEIA
FT                   RREWYLRGRLPLQTVRAVVDYGTATAKTKYGTIGIKVWIYKGDAEV"
FT   gene            613113..613541
FT                   /locus_tag="Tlet_0586"
FT   CDS_pept        613113..613541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0586"
FT                   /product="ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16; KEGG: tma:TM1493 50S
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33152"
FT                   /db_xref="GOA:A8F4R8"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R8"
FT                   /protein_id="ABV33152.1"
FT                   /translation="MLMPKRVKYRKQQRGRMRGEAKGGTTVDFGEWGLKALAPAWITAQ
FT                   QIEAGRIAIMRVMKRSGKLWIRVFPDKPYTKKPAESRQGKGKGNVEGWVSVVKPGKIIF
FT                   EIAGVDENTAKEALKYAASKFPIPTKIVSRSNIGGEAV"
FT   gene            613538..613738
FT                   /locus_tag="Tlet_0587"
FT   CDS_pept        613538..613738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0587"
FT                   /product="ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29; KEGG: tma:TM1492 50S
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33153"
FT                   /db_xref="GOA:A8F4R9"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4R9"
FT                   /protein_id="ABV33153.1"
FT                   /translation="MKAAEIRNYSDEELKKLLLEKKKQLMDMRFQHAMGQLRNTAQIKE
FT                   VRRDIARIRTILRERELGIRR"
FT   gene            613744..614031
FT                   /locus_tag="Tlet_0588"
FT   CDS_pept        613744..614031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0588"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: tma:TM1491 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33154"
FT                   /db_xref="GOA:A8F4S0"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S0"
FT                   /protein_id="ABV33154.1"
FT                   /translation="MSKKRLTGVVVSNKMDKTVVVEVTRKLEHPVYKKYIQRSKKYYAH
FT                   DEKNECKAGDTVLIEETRPLSKMKRWRVVEVLKREVIAEETLNTKESEEV"
FT   gene            614028..614396
FT                   /locus_tag="Tlet_0589"
FT   CDS_pept        614028..614396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0589"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: tma:TM1490 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33155"
FT                   /db_xref="GOA:A8F4S1"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S1"
FT                   /protein_id="ABV33155.1"
FT                   /translation="MIQNESYLNVADNSGAKKLRVIRVMGGFHKKYGTVGDIVVCSVRD
FT                   VVPNTGIKKGEVVKAVIVRTKKPVRRPDGTYIRFDDNAAVLIDKFNEPRGTRVFGPVAR
FT                   EIREKGYMKIISLAPEVL"
FT   gene            614409..614726
FT                   /locus_tag="Tlet_0590"
FT   CDS_pept        614409..614726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0590"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW (Kyrpides Ouzounis Woese) domain
FT                   protein; KEGG: tma:TM1489 50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33156"
FT                   /db_xref="GOA:A8F4S2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S2"
FT                   /protein_id="ABV33156.1"
FT                   /translation="MRVKKDDLVEVISGKDKGKRGKVLKVLPRENKVVIQGVNIVKRHQ
FT                   RPIPQLREGGIIEREAPIYASKVMLVCPNCDKPTRVGMRFLDDGAKVRFCKKCGEIVDK
FT                   A"
FT   gene            614741..615292
FT                   /locus_tag="Tlet_0591"
FT   CDS_pept        614741..615292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0591"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: tma:TM1488 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33157"
FT                   /db_xref="GOA:A8F4S3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S3"
FT                   /protein_id="ABV33157.1"
FT                   /translation="MVTQYIPLKEKYEKEVVPKLMKEFNYRNINQVPRIEKIVINMGIG
FT                   EGSRNADLLNKHLKELAAITGQKPVITKAKKSISNFKIRKGMNVGLKVTLRGLRMWNFL
FT                   YKIANIVLPKVRDFRGLNPNSFDGHGNYSFGLTEQFVFPEITPDQSPKTQGMDIVIVTT
FT                   AKTDAEAFKLLEFLGFPFKR"
FT   gene            615306..615491
FT                   /locus_tag="Tlet_0592"
FT   CDS_pept        615306..615491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0592"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: tma:TM1487 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33158"
FT                   /db_xref="GOA:A8F4S4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S4"
FT                   /protein_id="ABV33158.1"
FT                   /translation="MPRKGIIERWKRPKKFKVREYTRCSVCGRPKAVYREFGLCRVCFR
FT                   KMALEGKLPGVKKASW"
FT   gene            615505..615909
FT                   /locus_tag="Tlet_0593"
FT   CDS_pept        615505..615909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0593"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: tma:TM1486 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33159"
FT                   /db_xref="GOA:A8F4S5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S5"
FT                   /protein_id="ABV33159.1"
FT                   /translation="MWSDPIADMLTRIRNANVVFKEYVDVPASNIKKAICEILKKEGFI
FT                   HDYKYIEDGKQGILRIHMKYKGQRRDRERVIKGIVRVSKPGRRLYVSKDEIPKVKNGIG
FT                   VAILTTSKGVVTDKEARVLGVGGEVIAYIW"
FT   gene            615922..616476
FT                   /locus_tag="Tlet_0594"
FT   CDS_pept        615922..616476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tlet_0594"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: tma:TM1485 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Tlet_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV33160"
FT                   /db_xref="GOA:A8F4S6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F4S6"
FT                   /protein_id="ABV33160.1"
FT                   /translation="MSKLGKKPILIPSGVQINIEGDMISVKGPKGTLSQRLSPYIKVAI
FT                   EENKLWVQQNEESIVRRSQRKMLRTFQGT