(data stored in ACNUC7421 zone)

EMBL: CP000813

ID   CP000813; SV 3; circular; genomic DNA; STD; PRO; 3704463 BP.
XX
AC   CP000813;
XX
PR   Project:PRJNA20391;
XX
DT   27-SEP-2007 (Rel. 93, Created)
DT   27-FEB-2016 (Rel. 127, Last updated, Version 14)
XX
DE   Bacillus pumilus SAFR-032, complete genome.
XX
KW   .
XX
OS   Bacillus pumilus SAFR-032
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3704463
RX   PUBMED; 17895969.
RA   Gioia J., Yerrapragada S., Qin X., Jiang H., Igboeli O.C., Muzny D.,
RA   Dugan-Rocha S., Ding Y., Hawes A., Liu W., Perez L., Kovar C., Dinh H.,
RA   Lee S., Nazareth L., Blyth P., Holder M., Buhay C., Tirumalai M.R., Liu Y.,
RA   Dasgupta I., Bokhetache L., Fujita M., Karouia F., Eswara Moorthy P.,
RA   Siefert J., Uzman A., Buzumbo P., Verma A., Zwiya H., McWilliams B.D.,
RA   Olowu A., Clinkenbeard K.D., Newcombe D., Golebiewski L., Petrosino J.F.,
RA   Nicholson W.L., Fox G.E., Venkateswaran K., Highlander S.K.,
RA   Weinstock G.M.;
RT   "Paradoxical DNA repair and peroxide resistance gene conservation in
RT   Bacillus pumilus SAFR-032";
RL   PLoS One 2(9):E928-E928(2007).
XX
RN   [2]
RC   Publication Status: Online-Only
RP   1-3704463
RX   PUBMED; 23799069.
RA   Tirumalai M.R., Rastogi R., Zamani N., O'Bryant Williams E., Allen S.,
RA   Diouf F., Kwende S., Weinstock G.M., Venkateswaran K.J., Fox G.E.;
RT   "Candidate genes that may be responsible for the unusual resistances
RT   exhibited by Bacillus pumilus SAFR-032 spores";
RL   PLoS One 8(6):E66012-E66012(2013).
XX
RN   [3]
RP   1-3704463
RX   DOI; 10.1007/s00792-013-0559-z.
RX   PUBMED; 23812891.
RA   Tirumalai M.R., Fox G.E.;
RT   "An ICEBs1-like element may be associated with the extreme radiation and
RT   desiccation resistance of Bacillus pumilus SAFR-032 spores";
RL   Extremophiles 17(5):767-774(2013).
XX
RN   [4]
RP   1-3704463
RA   Gioia J., Yerrapragada S., Qin X., Jiang H., Igboeli O.C., Muzny D.,
RA   Dugan-Rocha S., Ding Y., Hawes A., Liu W., Perez L., Kovar C., Dinh H.,
RA   Lee S., Nazareth L., Blyth P., Holder M., Buhay C., Tirumalai M.R., Liu Y.,
RA   Dasgupta I., Bokhetache L., Fujita M., Karouia F., Moorthy P.E.,
RA   Siefert J., Uzman A., Buzumbo P., Verma A., Zwiya H., McWilliams B.D.,
RA   Olowu A., Clinkenbeard K.D., Newcombe D., Golebiewski L., Petrosino J.F.,
RA   Nicholson W.L., Fox G.E., Venkateswaran K., Highlander S.K.,
RA   Weinstock G.M.;
RT   ;
RL   Submitted (15-AUG-2007) to the INSDC.
RL   Human Genome Sequencing Center, Baylor College of Medicine, One Baylor
RL   Plaza, Houston, TX 77030, USA
XX
RN   [5]
RC   Sequence update by submitter
RP   1-3704463
RA   Stepanov V., Tirumalai M.R., Montazari S., Venkateswaran K., Fox G.E.;
RT   ;
RL   Submitted (11-DEC-2015) to the INSDC.
RL   Department of Biology and Biochemistry, University of Houston, Houston, TX
RL   77030, USA
XX
DR   MD5; f7946d9e1e1db1fe7060ef725ffb2a11.
DR   BioSample; SAMN00253833.
DR   EnsemblGenomes-Gn; BPUM_03740.
DR   EnsemblGenomes-Gn; BPUM_03745.
DR   EnsemblGenomes-Gn; BPUM_03750.
DR   EnsemblGenomes-Gn; BPUM_03755.
DR   EnsemblGenomes-Gn; BPUM_03760.
DR   EnsemblGenomes-Gn; BPUM_03765.
DR   EnsemblGenomes-Gn; BPUM_03770.
DR   EnsemblGenomes-Gn; BPUM_03775.
DR   EnsemblGenomes-Gn; BPUM_03780.
DR   EnsemblGenomes-Gn; BPUM_03785.
DR   EnsemblGenomes-Gn; BPUM_03790.
DR   EnsemblGenomes-Gn; BPUM_03800.
DR   EnsemblGenomes-Gn; BPUM_03805.
DR   EnsemblGenomes-Gn; BPUM_03810.
DR   EnsemblGenomes-Gn; BPUM_03815.
DR   EnsemblGenomes-Gn; BPUM_03820.
DR   EnsemblGenomes-Gn; BPUM_03825.
DR   EnsemblGenomes-Gn; BPUM_03830.
DR   EnsemblGenomes-Gn; BPUM_03835.
DR   EnsemblGenomes-Gn; BPUM_03840.
DR   EnsemblGenomes-Gn; BPUM_03845.
DR   EnsemblGenomes-Gn; BPUM_03850.
DR   EnsemblGenomes-Gn; BPUM_03855.
DR   EnsemblGenomes-Gn; BPUM_03860.
DR   EnsemblGenomes-Gn; BPUM_03885.
DR   EnsemblGenomes-Gn; BPUM_03890.
DR   EnsemblGenomes-Gn; BPUM_03895.
DR   EnsemblGenomes-Gn; BPUM_03900.
DR   EnsemblGenomes-Gn; BPUM_03905.
DR   EnsemblGenomes-Gn; BPUM_03910.
DR   EnsemblGenomes-Gn; BPUM_03915.
DR   EnsemblGenomes-Gn; BPUM_03920.
DR   EnsemblGenomes-Gn; BPUM_03925.
DR   EnsemblGenomes-Gn; BPUM_03930.
DR   EnsemblGenomes-Gn; BPUM_03935.
DR   EnsemblGenomes-Gn; BPUM_03940.
DR   EnsemblGenomes-Gn; BPUM_03945.
DR   EnsemblGenomes-Gn; BPUM_03950.
DR   EnsemblGenomes-Gn; BPUM_03975.
DR   EnsemblGenomes-Gn; BPUM_03980.
DR   EnsemblGenomes-Gn; BPUM_03985.
DR   EnsemblGenomes-Gn; BPUM_03990.
DR   EnsemblGenomes-Gn; BPUM_03995.
DR   EnsemblGenomes-Gn; BPUM_04000.
DR   EnsemblGenomes-Gn; BPUM_04005.
DR   EnsemblGenomes-Gn; BPUM_04010.
DR   EnsemblGenomes-Gn; BPUM_04015.
DR   EnsemblGenomes-Gn; BPUM_04020.
DR   EnsemblGenomes-Gn; BPUM_04025.
DR   EnsemblGenomes-Gn; BPUM_04030.
DR   EnsemblGenomes-Gn; BPUM_04035.
DR   EnsemblGenomes-Gn; BPUM_04040.
DR   EnsemblGenomes-Gn; BPUM_04045.
DR   EnsemblGenomes-Gn; BPUM_04050.
DR   EnsemblGenomes-Gn; BPUM_04055.
DR   EnsemblGenomes-Gn; BPUM_04060.
DR   EnsemblGenomes-Gn; BPUM_04065.
DR   EnsemblGenomes-Gn; BPUM_04070.
DR   EnsemblGenomes-Gn; BPUM_04075.
DR   EnsemblGenomes-Gn; BPUM_04080.
DR   EnsemblGenomes-Gn; BPUM_04120.
DR   EnsemblGenomes-Gn; BPUM_04180.
DR   EnsemblGenomes-Gn; BPUM_04190.
DR   EnsemblGenomes-Gn; BPUM_04205.
DR   EnsemblGenomes-Gn; BPUM_04210.
DR   EnsemblGenomes-Gn; BPUM_04215.
DR   EnsemblGenomes-Gn; BPUM_04220.
DR   EnsemblGenomes-Gn; BPUM_04225.
DR   EnsemblGenomes-Gn; BPUM_04230.
DR   EnsemblGenomes-Gn; BPUM_04235.
DR   EnsemblGenomes-Gn; BPUM_04240.
DR   EnsemblGenomes-Gn; BPUM_04245.
DR   EnsemblGenomes-Gn; BPUM_04250.
DR   EnsemblGenomes-Gn; BPUM_04255.
DR   EnsemblGenomes-Gn; BPUM_04260.
DR   EnsemblGenomes-Gn; BPUM_04265.
DR   EnsemblGenomes-Gn; BPUM_04270.
DR   EnsemblGenomes-Gn; BPUM_04275.
DR   EnsemblGenomes-Gn; BPUM_04280.
DR   EnsemblGenomes-Gn; BPUM_04285.
DR   EnsemblGenomes-Gn; BPUM_04290.
DR   EnsemblGenomes-Gn; BPUM_04295.
DR   EnsemblGenomes-Gn; BPUM_04300.
DR   EnsemblGenomes-Gn; BPUM_04305.
DR   EnsemblGenomes-Gn; BPUM_04310.
DR   EnsemblGenomes-Gn; BPUM_04315.
DR   EnsemblGenomes-Gn; BPUM_04320.
DR   EnsemblGenomes-Gn; BPUM_04325.
DR   EnsemblGenomes-Gn; BPUM_04330.
DR   EnsemblGenomes-Gn; BPUM_04375.
DR   EnsemblGenomes-Gn; BPUM_04380.
DR   EnsemblGenomes-Gn; BPUM_04385.
DR   EnsemblGenomes-Gn; BPUM_04390.
DR   EnsemblGenomes-Gn; BPUM_1726.
DR   EnsemblGenomes-Gn; BPUM_1734.
DR   EnsemblGenomes-Gn; BPUM_2060.
DR   EnsemblGenomes-Gn; BPUM_2315.
DR   EnsemblGenomes-Gn; BPUM_nc0005.
DR   EnsemblGenomes-Gn; BPUM_nc0014.
DR   EnsemblGenomes-Gn; BPUM_nc0016.
DR   EnsemblGenomes-Gn; BPUM_nc0022.
DR   EnsemblGenomes-Gn; BPUM_nc0024.
DR   EnsemblGenomes-Tr; BPUM_03740-1.
DR   EnsemblGenomes-Tr; BPUM_03745-1.
DR   EnsemblGenomes-Tr; BPUM_03750-1.
DR   EnsemblGenomes-Tr; BPUM_03755-1.
DR   EnsemblGenomes-Tr; BPUM_03760-1.
DR   EnsemblGenomes-Tr; BPUM_03765-1.
DR   EnsemblGenomes-Tr; BPUM_03770-1.
DR   EnsemblGenomes-Tr; BPUM_03775-1.
DR   EnsemblGenomes-Tr; BPUM_03780-1.
DR   EnsemblGenomes-Tr; BPUM_03785-1.
DR   EnsemblGenomes-Tr; BPUM_03790-1.
DR   EnsemblGenomes-Tr; BPUM_03800-1.
DR   EnsemblGenomes-Tr; BPUM_03805-1.
DR   EnsemblGenomes-Tr; BPUM_03810-1.
DR   EnsemblGenomes-Tr; BPUM_03815-1.
DR   EnsemblGenomes-Tr; BPUM_03820-1.
DR   EnsemblGenomes-Tr; BPUM_03825-1.
DR   EnsemblGenomes-Tr; BPUM_03830-1.
DR   EnsemblGenomes-Tr; BPUM_03835-1.
DR   EnsemblGenomes-Tr; BPUM_03840-1.
DR   EnsemblGenomes-Tr; BPUM_03845-1.
DR   EnsemblGenomes-Tr; BPUM_03850-1.
DR   EnsemblGenomes-Tr; BPUM_03855-1.
DR   EnsemblGenomes-Tr; BPUM_03860-1.
DR   EnsemblGenomes-Tr; BPUM_03885-1.
DR   EnsemblGenomes-Tr; BPUM_03890-1.
DR   EnsemblGenomes-Tr; BPUM_03895-1.
DR   EnsemblGenomes-Tr; BPUM_03900-1.
DR   EnsemblGenomes-Tr; BPUM_03905-1.
DR   EnsemblGenomes-Tr; BPUM_03910-1.
DR   EnsemblGenomes-Tr; BPUM_03915-1.
DR   EnsemblGenomes-Tr; BPUM_03920-1.
DR   EnsemblGenomes-Tr; BPUM_03925-1.
DR   EnsemblGenomes-Tr; BPUM_03930-1.
DR   EnsemblGenomes-Tr; BPUM_03935-1.
DR   EnsemblGenomes-Tr; BPUM_03940-1.
DR   EnsemblGenomes-Tr; BPUM_03945-1.
DR   EnsemblGenomes-Tr; BPUM_03950-1.
DR   EnsemblGenomes-Tr; BPUM_03975.
DR   EnsemblGenomes-Tr; BPUM_03980.
DR   EnsemblGenomes-Tr; BPUM_03985-1.
DR   EnsemblGenomes-Tr; BPUM_03990-1.
DR   EnsemblGenomes-Tr; BPUM_03995-1.
DR   EnsemblGenomes-Tr; BPUM_04000-1.
DR   EnsemblGenomes-Tr; BPUM_04005-1.
DR   EnsemblGenomes-Tr; BPUM_04010-1.
DR   EnsemblGenomes-Tr; BPUM_04015-1.
DR   EnsemblGenomes-Tr; BPUM_04020-1.
DR   EnsemblGenomes-Tr; BPUM_04025-1.
DR   EnsemblGenomes-Tr; BPUM_04030-1.
DR   EnsemblGenomes-Tr; BPUM_04035-1.
DR   EnsemblGenomes-Tr; BPUM_04040-1.
DR   EnsemblGenomes-Tr; BPUM_04045-1.
DR   EnsemblGenomes-Tr; BPUM_04050-1.
DR   EnsemblGenomes-Tr; BPUM_04055-1.
DR   EnsemblGenomes-Tr; BPUM_04060-1.
DR   EnsemblGenomes-Tr; BPUM_04065-1.
DR   EnsemblGenomes-Tr; BPUM_04070-1.
DR   EnsemblGenomes-Tr; BPUM_04075-1.
DR   EnsemblGenomes-Tr; BPUM_04080-1.
DR   EnsemblGenomes-Tr; BPUM_04120-1.
DR   EnsemblGenomes-Tr; BPUM_04180-1.
DR   EnsemblGenomes-Tr; BPUM_04190-1.
DR   EnsemblGenomes-Tr; BPUM_04205-1.
DR   EnsemblGenomes-Tr; BPUM_04210-1.
DR   EnsemblGenomes-Tr; BPUM_04215-1.
DR   EnsemblGenomes-Tr; BPUM_04220-1.
DR   EnsemblGenomes-Tr; BPUM_04225-1.
DR   EnsemblGenomes-Tr; BPUM_04230-1.
DR   EnsemblGenomes-Tr; BPUM_04235-1.
DR   EnsemblGenomes-Tr; BPUM_04240-1.
DR   EnsemblGenomes-Tr; BPUM_04245-1.
DR   EnsemblGenomes-Tr; BPUM_04250-1.
DR   EnsemblGenomes-Tr; BPUM_04255-1.
DR   EnsemblGenomes-Tr; BPUM_04260-1.
DR   EnsemblGenomes-Tr; BPUM_04265-1.
DR   EnsemblGenomes-Tr; BPUM_04270-1.
DR   EnsemblGenomes-Tr; BPUM_04275-1.
DR   EnsemblGenomes-Tr; BPUM_04280-1.
DR   EnsemblGenomes-Tr; BPUM_04285-1.
DR   EnsemblGenomes-Tr; BPUM_04290-1.
DR   EnsemblGenomes-Tr; BPUM_04295-1.
DR   EnsemblGenomes-Tr; BPUM_04300-1.
DR   EnsemblGenomes-Tr; BPUM_04305-1.
DR   EnsemblGenomes-Tr; BPUM_04310-1.
DR   EnsemblGenomes-Tr; BPUM_04315-1.
DR   EnsemblGenomes-Tr; BPUM_04320-1.
DR   EnsemblGenomes-Tr; BPUM_04325-1.
DR   EnsemblGenomes-Tr; BPUM_04330-1.
DR   EnsemblGenomes-Tr; BPUM_04375-1.
DR   EnsemblGenomes-Tr; BPUM_04380-1.
DR   EnsemblGenomes-Tr; BPUM_04385-1.
DR   EnsemblGenomes-Tr; BPUM_04390-1.
DR   EnsemblGenomes-Tr; BPUM_1726.
DR   EnsemblGenomes-Tr; BPUM_1734.
DR   EnsemblGenomes-Tr; BPUM_2060.
DR   EnsemblGenomes-Tr; BPUM_2315.
DR   EnsemblGenomes-Tr; BPUM_nc0005-1.
DR   EnsemblGenomes-Tr; BPUM_nc0014-1.
DR   EnsemblGenomes-Tr; BPUM_nc0016-1.
DR   EnsemblGenomes-Tr; BPUM_nc0022-1.
DR   EuropePMC; PMC1976550; 17895969.
DR   EuropePMC; PMC2687303; 19376923.
DR   EuropePMC; PMC3902026; 24422886.
DR   EuropePMC; PMC4924849; 27351589.
DR   EuropePMC; PMC5994023; 29884123.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01412; BsrG.
DR   RFAM; RF01458; rli23.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01691; Bacillus-plasmid.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02273; FsrA.
DR   SILVA-LSU; CP000813.
DR   SILVA-SSU; CP000813.
XX
CC   On Feb 5, 2016 this sequence version replaced gi:961479874.
CC   Source DNA and bacteria are avaible from S.K. Highlander
CC   (sarahh@bcm.tmc.ed).
CC   Annotation was added by the NCBI Prokaryotic Genome Annotation
CC   Pipeline (released 2013). Information about the Pipeline can be
CC   found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
CC   Annotation modified by submitter.  Statistics are:
CC   Annotation Provider             :: submitter
CC   Annotation Date                 :: 12/06/2015
CC   Annotation Method               :: comparative seq./homolog align
CC   Genes                           :: 3,849
CC   CDS                             :: 3715
CC   Pseudo Genes                    :: 45
CC   rRNAs                           :: 7, 7, 7 (5S, 16S, 23S)
CC   complete rRNAs                  :: 7, 7, 7 (5S, 16S, 23S)
CC   tRNAs                           :: 70
CC   ncRNA                           :: 3
CC   tmRNA                           :: 1
CC   misc_binding (riboswitches)     :: 12
CC   misc_feature (leader sequences) :: 16
CC   misc_feature (riboswitch)       :: 4.
CC   ##Genome-Annotation-Data-START##
CC   Annotation Provider          :: NCBI
CC   Annotation Date              :: 09/25/2015 09:33:54
CC   Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
CC                                   Pipeline
CC   Annotation Method            :: Best-placed reference protein set;
CC                                   GeneMarkS+
CC   Annotation Software revision :: 3.0
CC   Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
CC                                   repeat_region
CC   Genes                        :: 3,698
CC   CDS                          :: 3,549
CC   Pseudo Genes                 :: 58
CC   rRNAs                        :: 7, 7, 7 (5S, 16S, 23S)
CC   complete rRNAs               :: 7, 7, 7 (5S, 16S, 23S)
CC   tRNAs                        :: 70
CC   ncRNA                        :: 0
CC   ##Genome-Annotation-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3704463
FT                   /organism="Bacillus pumilus SAFR-032"
FT                   /strain="SAFR-032"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:315750"
FT   gene            1..1341
FT                   /locus_tag="BPUM_0001"
FT   CDS_pept        1..1341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60701"
FT                   /db_xref="GOA:A8F8Y4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F8Y4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P05648.1"
FT                   /protein_id="ABV60701.1"
FT                   /translation="MENILDLWNKALQKIETKLSKPSFETWMKSTKAHSLQGDTLTITA
FT                   PNEFARDWLESRYLHLIADTIYELTGEELSIKFIIPQNQDEVEAMPKSPIKKMSKEDPV
FT                   DIPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPSSKPRVITIKDIQRIVGQQFNIRLEDFKAKKRTKSVAYPRQIAMYLSREMTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLMVEDEQLQQHVKEIKEQLK"
FT   gene            1538..2674
FT                   /locus_tag="BPUM_0002"
FT   CDS_pept        1538..2674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60702"
FT                   /db_xref="GOA:A8F8Y5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007497486.1"
FT                   /protein_id="ABV60702.2"
FT                   /translation="MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDEGVSLT
FT                   GSDSDISIESFIPQRDGDLEVITIDRPGSIVLQARFFSEIVKKLPMATVEIEVEQNHLT
FT                   IIRSGSAEFNLNGLDAEEYPHLPQIEEHHAFQIPTDLLKNLIRQTVFAVSTSETRPILT
FT                   GVNWKVEKGELICTATDSHRLALRKAKLDIDEESSYNVVIPGKSLTELSRILDDGQDLV
FT                   SIVITETQVLFKAQNVLFFSRLLDGNYPDTARLIPQESKTDVVVNTKEFLQAIDRASLL
FT                   AREGRNNVVKLSADPEQSLEISSNSPEIGKVVETVQADDIKGEDLKISFSPKYMLDALK
FT                   VLEGTEIHVSFTGAMRPFLLRTPNDDSILQLILPVRTY"
FT   gene            2825..3040
FT                   /locus_tag="BPUM_0003"
FT   CDS_pept        2825..3040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60703"
FT                   /db_xref="GOA:A8F8Y6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008360916.1"
FT                   /protein_id="ABV60703.2"
FT                   /translation="MPNPITIEKEMITLGQFLKLAEVIQSGGMAKWFLSEHEVFINQEP
FT                   DNRRGRKLYPGDVVEIEGYGTFQVVN"
FT   gene            3057..4169
FT                   /locus_tag="BPUM_0004"
FT   CDS_pept        3057..4169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0004"
FT                   /product="recombinase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60704"
FT                   /db_xref="GOA:A8F8Y7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F8Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017368464.1"
FT                   /protein_id="ABV60704.1"
FT                   /translation="MYIQSLALTSYRNYEHTELQFDNKVNVMIGENAQGKTNLMEAIYV
FT                   LSMAKSHRTSNDKELIRWDQDYAKIEGRVIKKNGPLPMQLVISKKGKKGKVNHIEQQKL
FT                   SHYVGALNTIMFAPEDLSLVKGSPQIRRRFLDMEIGQVSAVYLHDLSLYQKILSQRNHY
FT                   LKQLQTRKQTDQAMLEVLTEQLIDAAAKVVKRRLTFTKQLEKWAQPLHFGISRELETLT
FT                   LQYHTAIEVSEASDLSKIKNSYEESFQKLRDREIDRGVTLWGPHRDDLLFFVNGRDVQT
FT                   YGSQGQQRTTALSLKLAEIDLIHEEIGEYPILLLDDVLSELDDYRQSHLLHTIQGRVQT
FT                   FVTTTSVEGIDHATLKEAEIFRVASGKVID"
FT   gene            4187..4432
FT                   /locus_tag="BPUM_0005"
FT   CDS_pept        4187..4432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60705"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008347601.1"
FT                   /protein_id="ABV60705.2"
FT                   /translation="MYIHLGDDCVVSTREIVAIVDYKMRSSSVVEEFLQKQEGQIISLS
FT                   QGTPKSIVVTTKSVYYSPLSSSTLKKRASFVIEIEV"
FT   gene            4490..6406
FT                   /gene="gyrB"
FT                   /locus_tag="BPUM_0006"
FT   CDS_pept        4490..6406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BPUM_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /note="negatively supercoils closed circular
FT                   double-stranded DNA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60706"
FT                   /db_xref="GOA:A8F8Y9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Y9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359865.1"
FT                   /protein_id="ABV60706.2"
FT                   /translation="MEQQHNSYDENQIQVLEGLEAVRKRPGMYIGSTSAKGLHHLVWEI
FT                   VDNSIDEALAGYCTDITVQIEKDNSITVKDNGRGIPVGIHEKMGRPAVEVIMTVLHAGG
FT                   KFDGSGYKVSGGLHGVGASVVNALSTTLDVTVYRDGKIHYQQFKRGVPVGDLEIIGETD
FT                   VTGTTTHFVPDPEIFTETIEFDYDTLANRVRELAFLTKGVNIIIEDLREGKERRNEYCY
FT                   EGGIKSYVEHLNRSKEVVHEEPVYIEGERDGITVEVALQYNDSYTSNIYSFANNINTYE
FT                   GGTHEAGFKTGLTRVINDYARKNGVFKDGDSNLSGEDVREGLTAIISIKHPDPQFEGQT
FT                   KTKLGNSEARTITDSLFSEALEKFLLENPDAAKKIVEKGVMAARARMAAKKARELTRRK
FT                   SALEVSSLPGKLADCSSKDPSISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVE
FT                   KARLDKILSNNEVRSMITALGTGIGEDFNLEKARYHKVVIMTDADVDGAHIRTLLLTFF
FT                   YRYMREIIENGYVYIAQPPLYKVQQGKRVEYVYNDKQLDELLKSLSQTPKPGLQRYKGL
FT                   GEMNAAQLWETTMDPDARTLLQVTLEDAIDADETFEMLMGDKVEPRRNFIEENAQYVKN
FT                   LDI"
FT   gene            6639..9158
FT                   /locus_tag="BPUM_0007"
FT   CDS_pept        6639..9158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60707"
FT                   /db_xref="GOA:A8F8Z0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008634.1"
FT                   /protein_id="ABV60707.1"
FT                   /translation="MSEQHTPNVREVNISQEMRTSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKPFKKSARIVGEVIGKYHPHGDSAVYEAMVRMAQDFNYRYMLV
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKISMEILRDITKDTIDYQDNYDGSEREPMVMPAR
FT                   FPNLLVNGATGIAVGMATNIPPHQLGEVIDGVLAISQNPEMTTQELMDIIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKSNIEETSSGKQRIVINEIPYQVNKARLIEKIADLV
FT                   RDKKIDGITDLRDESDRNGMRIVIELRRDANVHVLLNNLYKQTTLQTSFGINLLALVDG
FT                   QPKVLSLKQCLEYYLEHQKVIIRRRTAYELRKAEARAHILEGLRIALDHLDEVIALIRG
FT                   SQTAEIARNGLMENYSLSEKQAQAILDMRLQRLTGLEREKIEDEYKGLVDLIAELKAIL
FT                   ADNEKVLEIIREELTEIKERFNDTRRTEIVTAGIETIEDEDLIPVENIVITLTHNGYIK
FT                   RLPASTYRSQKRGGKGVQGMGTNEDDFVEQLISTSTHDTILFFSNKGKVYRAKGYEIPE
FT                   FGRTAKGIPIINLLEVEKGEWINAIIPVSEFDENSYLFFTTRHGVSKRTTLSQFANIRN
FT                   NGLIALSLRDEDELMAVRLTNGEKQIIIGTKKGMLIRFDETDVREMGRTAAGVKGITLS
FT                   EDDIVVGMEILEPDANVLIVTEKGYGKLTPEKEYRVQSRGGKGLKTCKITDNNGPLVAV
FT                   KATNAEAEEDLMIITGSGVIIRMAVSDISTTGRVTQGVRLIRLGDEEHVATVALVEQSP
FT                   EDDEDNEENVENIENIENIESDQEQSE"
FT   gene            9572..11121
FT                   /locus_tag="BPUM_03740"
FT                   /old_locus_tag="BPUM_r0001"
FT   rRNA            9572..11121
FT                   /locus_tag="BPUM_03740"
FT                   /old_locus_tag="BPUM_r0001"
FT                   /product="16S ribosomal RNA"
FT   gene            11213..11289
FT                   /locus_tag="BPUM_03745"
FT                   /old_locus_tag="BPUM_t0018"
FT   tRNA            11213..11289
FT                   /locus_tag="BPUM_03745"
FT                   /old_locus_tag="BPUM_t0018"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:11247..11249,aa:Ile,seq:gat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            11304..11379
FT                   /locus_tag="BPUM_03750"
FT                   /old_locus_tag="BPUM_t0019"
FT   tRNA            11304..11379
FT                   /locus_tag="BPUM_03750"
FT                   /old_locus_tag="BPUM_t0019"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:11337..11339,aa:Ala,seq:tgc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            11476..14410
FT                   /locus_tag="BPUM_03755"
FT                   /old_locus_tag="BPUM_r0011"
FT   rRNA            11476..14410
FT                   /locus_tag="BPUM_03755"
FT                   /old_locus_tag="BPUM_r0011"
FT                   /product="23S ribosomal RNA"
FT   gene            14470..14585
FT                   /locus_tag="BPUM_03760"
FT                   /old_locus_tag="BPUM_r0012"
FT   rRNA            14470..14585
FT                   /locus_tag="BPUM_03760"
FT                   /old_locus_tag="BPUM_r0012"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14597..15565)
FT                   /locus_tag="BPUM_0503"
FT   CDS_pept        complement(14597..15565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61198"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009054.1"
FT                   /protein_id="ABV61198.1"
FT                   /translation="MKSSGWKDLKRFYSLETSQKFLYQQYEKRSIQDANQQAYKNCERF
FT                   IYFLKHGHTFYEQAAIAPLELKPILLFYGMAQLLKACLLTVDPYYPSQTSVLAHGVTSR
FT                   KRKKQHYRFSKDEVKIQRNGLCMHVLKHLFHLNGLEDERFTMIHLLSKIPEMSHILEFQ
FT                   KQPSTLVKVEKDNGMMIQDHIPLLYNMSAERFIEYFEFHTSWKLKQREAKKLAFDVSLE
FT                   ENPAFATHLHYDLEANQWYIPSTRDSFLGIPEIISHYLLMYNLSMIARYETEWWYELLS
FT                   QYISDDYVMIERYMEIAEEKFPAYIMMLLEEKTKKTSSKWN"
FT   gene            15687..17153
FT                   /locus_tag="BPUM_0504"
FT   CDS_pept        15687..17153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0504"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="catalyzes the synthesis of xanthosine monophosphate
FT                   by the NAD+ dependent oxidation of inosine monophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61199"
FT                   /db_xref="GOA:A8FAD2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010788758.1"
FT                   /protein_id="ABV61199.1"
FT                   /translation="MWESKFSKEGLTFDDVLLVPAKSEVLPRDVDLSVELTSTLKLNIP
FT                   VISAGMDTVTESQMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITNPFFLTP
FT                   EHQVFDAEHLMGKYRISGVPIVNNIEDQKLVGIITNRDLRFISDYSMKISDVMTKEELV
FT                   TASVGTTLEEAEKILQQYKIEKLPLLDDEGTLKGLITIKDIEKVIEFPNSSKDAHGRLI
FT                   VGAAVGVTGDTMTRVRKLVEANVDVVVIDTAHGHSQGVLNTVSKIRETYPSLNIIAGNV
FT                   ATAEATKALFEAGADIVKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGKAIIA
FT                   DGGIKYSGDIVKALASGGHAVMLGSLLAGTSESPGDTEIFQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEDNKKFVPEGIEGRTPYKGPVVDTVYQLVGGIRSGMGYCGTQDLRSLREEA
FT                   QFIRMTGAGLRESHPHDVQITKESPNYTIS"
FT   gene            17314..18639
FT                   /locus_tag="BPUM_0505"
FT   CDS_pept        17314..18639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0505"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61200"
FT                   /db_xref="GOA:A8FAD3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003218098.1"
FT                   /protein_id="ABV61200.1"
FT                   /translation="MNSKILKQLMVSILALALIVTAFTPMSKAKAAEDPFNVNAKAAIL
FT                   IEASTGKILYSKNAEQRLPIASMAKMMTEYLLLEAIAEGKVKWDQTYTPDDYVYEISQD
FT                   RSLSNVPLRKDGSYTVKELYQATAIYSANAAAIGLAEVIAGSESKFVEKMNAKAKELGL
FT                   TNYKFVNATGLENKDLHGKQPKGTGTDEESEVSAKDMALLAQHLIKDHPEILETSSIAK
FT                   TKFREGTDDEMDMPNWNFMLKGLVKEYEGVDGLKTGSTDSAGSSFTGTAKQGDMRVIAV
FT                   ILNAKGNLHTARFDVAKKLFDYAFKNFTMKEMYKKGQQIKGHENIEVDKGKDKEVPVVT
FT                   KEAFSVPVKNGDEKSFKAKVNIEKTKLEAPIKKGTKVGMLTTSYSGDEKDYGYLNKDQS
FT                   GVELITKTGDEKANWFILAMRGIGGFFAGIWGGIVDTVKGWF"
FT   gene            complement(18680..20158)
FT                   /locus_tag="BPUM_0506"
FT   CDS_pept        complement(18680..20158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0506"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61201"
FT                   /db_xref="GOA:A8FAD4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008342034.1"
FT                   /protein_id="ABV61201.1"
FT                   /translation="MHIDIHRHSDTSLSNQIYFSIIDHIQSGLLQQGDKLPTVRDLAKQ
FT                   LNVSLVTAAKAYTRLKDDGYLTTVQGKGTFVDELQKQSEIPVPSSTSFDWQLSIPDYLP
FT                   RSQFAQYHYVEEAINLSSSMIDPGLLPNRYLEKEMQHVLARHPQIMSKYGEIQGDLQLR
FT                   QVIQSFLEKLDVPSTPENILVTSGSQQGLDLVARAFIGPDDVVVMEAPTYPGAIDVFMG
FT                   RGARIITVPVDHEGMNMKQLQSICDKYKPKLIYTIPTFHSPTGASMSMKRRKQLLSLAQ
FT                   SIDCLIVEDDPYRELYFEKKPPAPIKSLDHDGHVIYLRGLSKTLAPGCRIGIITASGSI
FT                   FNRLLAAKANNDLGSPLLTQKAILPFLTSKKMIDHTKKLRTALMVRRDLMIDVLSKHAP
FT                   KDVTWQIPQGGLNLWLSFPSWVDTRALLHEARKQQITFLPGSVCYPGEPKQNYIRLSFS
FT                   YVNEKALIEGVEKLCGIFQQALSTPQNHKQSLFF"
FT   gene            20404..21288
FT                   /locus_tag="BPUM_0507"
FT   CDS_pept        20404..21288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0507"
FT                   /product="pyridoxal biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61202"
FT                   /db_xref="GOA:A8FAD5"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAD5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003218112.1"
FT                   /protein_id="ABV61202.1"
FT                   /translation="MSNKGTERVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPRIVEEVQNAVTIPVMAKARIGHIVEARVLEALGVDYIDES
FT                   EVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQIRKVAAMSEDELMTEAKNLGAPYELLLQIKKDGKLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYGLIAELSKELGTAMKGIEIS
FT                   NLLPEERMQERGW"
FT   gene            21309..21899
FT                   /locus_tag="BPUM_0508"
FT   CDS_pept        21309..21899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0508"
FT                   /product="glutamine amidotransferase"
FT                   /note="with PdxST is involved in the biosynthesis of
FT                   pyridoxal 5'-phosphate; PdxT catalyzes the hydrolysis of
FT                   glutamine to glutamate and ammonia; PdxS utilizes the
FT                   ammonia to synthesize pyridoxal 5'-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61203"
FT                   /db_xref="GOA:A8FAD6"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAD6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003218086.1"
FT                   /protein_id="ABV61203.1"
FT                   /translation="MLTIGVLGLQGAVREHIQSIEACGAEGKIIKRAEELVSVDGLIIP
FT                   GGESTTMRRLMDTYQFIEPIKAFAAKGKPIFGTCAGLIMLAKHIEDRDNAHLGLLNVSV
FT                   ARNSFGRQVDSFEADLEVKGLDAPFTGVFIRAPHIISADESVEVMAEYDGRIVMAKENN
FT                   ILGCSFHPELTDDHRLTQLFVEMVKTYKTKLAV"
FT   misc_feature    21953..22169
FT                   /note="T-box leader"
FT   gene            22219..23493
FT                   /locus_tag="BPUM_0509"
FT   CDS_pept        22219..23493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0509"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61204"
FT                   /db_xref="GOA:A8FAD7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAD7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8FAD7.1"
FT                   /protein_id="ABV61204.1"
FT                   /translation="MLDIKQLRTDFDQIKEKLAHRGEDLADFDKFGELDQKRRELIGKT
FT                   EVLKSRRNEVSQQVAVLKREKKDADHIIQEMREVGDEIKKLDDELRTVEESLQHILFSI
FT                   PNIPHDTVPVGETEDDNVEVRKWGEQPAFSFEPKPHWDVADELNILDFERAGKVTGSRF
FT                   VFYKGLGARLERALYNFMLDLHVDEFGFTEVLPPYMVNRASMTGTGQLPKFEEDAFKIR
FT                   EEDYFLIPTAEVPITNMHRDEIIEGEQLPINYAAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVRPEDSYEELEKLTNQAEKVLQLLNLPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSQDTYREISSCSNFEAFQARRANIRFRPEPKAKPEHVHTLNGSGLAVGRTVAAILEN
FT                   YQQEDGTVIIPEVLRPYMGNKEVMK"
FT   gene            23596..24426
FT                   /locus_tag="BPUM_0510"
FT   CDS_pept        23596..24426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0510"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61205"
FT                   /db_xref="GOA:A8FAD8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003218096.1"
FT                   /protein_id="ABV61205.1"
FT                   /translation="MNRLDYYVEMAQLVRKVLDESILFGITDTEKVLCYYPSNTIDFGM
FT                   KVGDPLNPEDQNVATTLRGQEYDGHLPESLYGYEIAVKGYPIFDENRKVIGSFLVAFSH
FT                   HREKKLSGYMEHINGVAKELQSGIEQIAAHSQELAATSLEISEQAGRAEEKSANIEEVV
FT                   KTIGGIARQTNLLGLNAAIEAARAGENGKGFAVVADEVRKLSDGSKEAAETINTFLKEI
FT                   QDSIGTLSENISQISSSTNEQAKQVTDFTKIIESLNEFKEEMNHFIEEIRQDTK"
FT   gene            24555..24647
FT                   /locus_tag="BPUM_03765"
FT                   /old_locus_tag="BPUM_t0020"
FT   tRNA            24555..24647
FT                   /locus_tag="BPUM_03765"
FT                   /old_locus_tag="BPUM_t0020"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:24591..24593,aa:Ser,seq:tga)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            complement(24736..25395)
FT                   /locus_tag="BPUM_0511"
FT   CDS_pept        complement(24736..25395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0511"
FT                   /product="deoxycytidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61206"
FT                   /db_xref="GOA:A8FAD9"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003218104.1"
FT                   /protein_id="ABV61206.1"
FT                   /translation="MNNIEIPKDAVITIAGTVGVGKSTMTKTIADKLGFQTSLEKVDDN
FT                   PYLEPFYSDFQRWSFHLQVYFLAERFKEQKRIFESGGGYVQDRSIYEDTGIFAKMHADK
FT                   GTMSEVDYETYTSLFEAMVMTPYFPHPDVLIYLHGDLNHILHRIEERGREMETQTDRAY
FT                   WEEMYTRYTEWIEQFDLCPVIKINIEDYDLLHDESSLDPILHEIASVIQKNRSKTK"
FT   gene            complement(25392..26015)
FT                   /locus_tag="BPUM_0512"
FT   CDS_pept        complement(25392..26015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0512"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61207"
FT                   /db_xref="GOA:A8FAE0"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359014.1"
FT                   /protein_id="ABV61207.1"
FT                   /translation="MYPAPFIAVEGPIGAGKTTLATMLAKEFQFPLVKEIVEENPFLDK
FT                   FYEDMEQWSFQLEMFFLCNRFKQLESIQENYVNHQQPIVTDYHVYKNMIFAERTLSKKH
FT                   MDKYRKIYHLLTDDLPKPNAIIYIKASLPTLLERIQMRGRSFEEDIDPAYLKTLIEDYE
FT                   LAIEHLKQTDPGLPIITIEGDHTDFVSSQQDYQQIVQNIKEQVL"
FT   gene            complement(26095..27396)
FT                   /locus_tag="BPUM_0513"
FT   CDS_pept        complement(26095..27396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0513"
FT                   /product="spore gernimation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61208"
FT                   /db_xref="GOA:A8FAE1"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR041704"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359013.1"
FT                   /protein_id="ABV61208.1"
FT                   /translation="MTIQIYVVKRGDTLNEIAMRFKTTVNEIIRTNDIETPNQLVIGQT
FT                   IVIPIRGQFYEVKQNDTLYQIGRRFRISVEELARVNRIRPEAILPIRFLLYIPQRPKRN
FT                   INSNAYIEPRGNQVSENLKQAAREASPYLTHLGAFSFQAQRDGTLKEPPLDQLPQIAAQ
FT                   SRTVLSMVVTNLENDKFSDELGRILLNNQSVKATFLNEIVRIAKKYQFKEIHFDFEYLR
FT                   PADKEAYIQFLREATTRFHQEGWTISVALAPKTSSQQKGKWYEAHDYGAIGNIVDHVVL
FT                   MTYEWGYSGGPAQAVSPIGPVREVIEYALTVMPANKIVMGQNLYGYDWTLPYVQGGPIA
FT                   KAVSPQQAIAIARNNNASILYDETAQAPYFRYTDANNKEHEVWFEDARSIQAKFNLIKE
FT                   LSLNGIAYWKLGLSFPQNWLLLSDQFNIEKRTTS"
FT   gene            complement(27442..27960)
FT                   /locus_tag="BPUM_0514"
FT   CDS_pept        complement(27442..27960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0514"
FT                   /product="isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61209"
FT                   /db_xref="GOA:A8FAE2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009065.1"
FT                   /protein_id="ABV61209.2"
FT                   /translation="MINNFDFEMGHVLADKTEQMTNKILALKDHAFKENWPIIYINDHY
FT                   GLWKADIQAVMETCKNERSSAILEKMAPSKDDYFLIKPKHSAFYGTALETLLNELGVQD
FT                   IILTGIAGNICVLFTANDAYMREYNLIVPKDCIASNDDRDNEYALTMMENVLLAKITTA
FT                   KEITNENQT"
FT   gene            28076..28552
FT                   /locus_tag="BPUM_0515"
FT   CDS_pept        28076..28552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0515"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61210"
FT                   /db_xref="GOA:A8FAE3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009066.1"
FT                   /protein_id="ABV61210.1"
FT                   /translation="MTRDEQFMQEAISEALKAEQIGEVPIGAIIVVDDQIVSRAHNLRE
FT                   TEQRSIAHAELLAIDEACKTTESWRLEDAVLYVTLEPCPMCAGAIVLSRVKKVVFGAYD
FT                   PKGGCAGTLMNLLDDERFNHQSEVIGGVLENECGELLSQFFRNLRQRKKQAKSK"
FT   gene            28611..28902
FT                   /gene="scr"
FT                   /locus_tag="BPUM_nc0005"
FT   ncRNA           28611..28902
FT                   /gene="scr"
FT                   /locus_tag="BPUM_nc0005"
FT                   /product="signal recognition particle-like (SRP) RNA
FT                   component"
FT                   /note="scRNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            29223..30935
FT                   /locus_tag="BPUM_0516"
FT   CDS_pept        29223..30935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0516"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61211"
FT                   /db_xref="GOA:A8FAE4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359011.1"
FT                   /protein_id="ABV61211.1"
FT                   /translation="MSYQALYRVFRPQVFEDVVGQEHITKTLQNALLQKKFSHAYLFSG
FT                   PRGTGKTSAAKIFAKAVNCEKSPVSEPCNECDACKGITNGSISDVIEIDAASNNGVDEI
FT                   RDIRDKVKFAPSAVTYKVYIIDEVHMLSIGAFNALLKTLEEPPAHCIFILATTEPHKIP
FT                   LTIISRCQRFDFKRITTKDIVGRMQKIVDAESLNVQEGSLEIIASAADGGMRDALSLLD
FT                   QAISFSGEQLTIDDALLITGAVSQQFISQLAEAIFDQNIAVALDTLNELLQQGKDAAKL
FT                   IEDMIFYFRDMLLYKTAPDLEGVLEKVKVDENFVTLSDRVTPQFLYETIEVLNKSHQEM
FT                   KWTNHPRIFFEVAVVKLCQATAGIPQAHANADLTTLTDKIDRLEQELSRIKAEGVPMSH
FT                   SQHPQEKKEAPRPQTSNKNGYRAPVGRIHEILKEAKRPELEKIKGKWGELLAHLKQQNK
FT                   VSHAALLTDSEPVAAATHAFVLKFKFEIHCKMVAEDKSGVRTNLEQLLESMLGKRVELV
FT                   GVPDAQWGKIREEFLRDHQPDEQADGQGTPAEEDPLIAEAKKLVGTDLIEIKD"
FT   gene            30962..31285
FT                   /locus_tag="BPUM_0517"
FT   CDS_pept        30962..31285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0517"
FT                   /product="nucleoid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61212"
FT                   /db_xref="GOA:A8FAE5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007615145.1"
FT                   /protein_id="ABV61212.2"
FT                   /translation="MRGGMGNMQKMMKQMQKMQKDMAKAQEELAEKVLEGTAGGGMVTV
FT                   KVNGQKEVVDVAINEEVVDPEDIDMLQDLVLAATNDALKKVDELTNETMGQFTKGMNMP
FT                   GLF"
FT   gene            31301..31897
FT                   /locus_tag="BPUM_0518"
FT   CDS_pept        31301..31897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0518"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61213"
FT                   /db_xref="GOA:A8FAE6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAE6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496047.1"
FT                   /protein_id="ABV61213.1"
FT                   /translation="MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLSMQEDVVLDFAK
FT                   ALVNAKRNLTYCSVCGHITDQDPCYICEDTRRDQSVICVVQDPKDVIAMEKMKEYNGLY
FT                   HVLHGAISPMDGIGPEDIKIPDLLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPS
FT                   GIKLSRIAHGLPVGGDLEYADEVTLSKALEGRREM"
FT   gene            31916..32140
FT                   /locus_tag="BPUM_0519"
FT   CDS_pept        31916..32140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61214"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008342008.1"
FT                   /protein_id="ABV61214.1"
FT                   /translation="MGFLRRKSIRKEFDEKLIQQLFKQKEEWNRQKKLVANSVEPSPDI
FT                   LFELKLAQAKYFFYLREAKKRNLRLNNWR"
FT   gene            32207..32470
FT                   /locus_tag="BPUM_0520"
FT   CDS_pept        32207..32470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0520"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61215"
FT                   /db_xref="GOA:A8FAE8"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009068.1"
FT                   /protein_id="ABV61215.1"
FT                   /translation="MEPVIVIGSILLAVLLLFMSGVQANPFKWLGLIGIKFVAGALFLF
FT                   CLNLFGESLGLHVSINPVTSGISGLLGIPGVAALVVIEKFII"
FT   gene            32795..34344
FT                   /locus_tag="BPUM_03770"
FT   rRNA            32795..34344
FT                   /locus_tag="BPUM_03770"
FT                   /product="16S ribosomal RNA"
FT   gene            34521..37455
FT                   /locus_tag="BPUM_03775"
FT                   /old_locus_tag="BPUM_r0002"
FT   rRNA            34521..37455
FT                   /locus_tag="BPUM_03775"
FT                   /old_locus_tag="BPUM_r0002"
FT                   /product="23S ribosomal RNA"
FT   gene            37515..37630
FT                   /locus_tag="BPUM_03780"
FT                   /old_locus_tag="BPUM_r0003"
FT   rRNA            37515..37630
FT                   /locus_tag="BPUM_03780"
FT                   /old_locus_tag="BPUM_r0003"
FT                   /product="5S ribosomal RNA"
FT   gene            37802..37993
FT                   /locus_tag="BPUM_0008"
FT   CDS_pept        37802..37993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0008"
FT                   /product="CsfB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60708"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008635.1"
FT                   /protein_id="ABV60708.1"
FT                   /translation="MDKKEREAICLICEEKKTKGIYLYHQFLCRDCERKLISTSTSDPS
FT                   YSDYVRKLKNLHTPPLYS"
FT   gene            38123..38737
FT                   /locus_tag="BPUM_0009"
FT   CDS_pept        38123..38737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0009"
FT                   /product="protein xpaC"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60709"
FT                   /db_xref="GOA:A8F8Z2"
FT                   /db_xref="InterPro:IPR018770"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008636.1"
FT                   /protein_id="ABV60709.1"
FT                   /translation="MKSIFYTFIWSILSTFFSLVILTVSIGVFHHHAGLSILYAMIGWG
FT                   VLFVGSRWTAFQLFLKKHGLSRSDYVYIKQHLKEAGQKLVRLKKALFAVKNVQTIKHNY
FT                   EVFRLARRIYTITKKEPNRFYDAQRFYFESLDSVVELTEKYALLYNQPNRSHELEMTLS
FT                   QTRVTLTELQKQLTNDLQQVLGRDIEALHIELEVADKMMKK"
FT   gene            38757..39815
FT                   /locus_tag="BPUM_0010"
FT   CDS_pept        38757..39815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0010"
FT                   /product="toxic anion resistance protein TelA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60710"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217976.1"
FT                   /protein_id="ABV60710.2"
FT                   /translation="MKSEDRATTSPASTTDLQFRLFDTLSDEEKREAVQRAKQIPDNPQ
FT                   KLLFYGTRVQERLLEQSQQMMKYVEKKDIDQIGDVLEAFLQQLHVVEPEDLVPKKQGFF
FT                   LKWFQRDKRSTQETISRFRHAKSQIERLSARLQYARGVLISDHMLLERLFEENQTYFQE
FT                   MTLQVAAVEEKITMLEQQPLSETQISVERTLEEQLMSQEVNVEEYMERLKERKYDLLLS
FT                   RQIALQCNAQIRMIQHTNHTLANHIQSTVSASIPLWINQMSIALTHIQQRANSALESRI
FT                   QKTYENVSKQQGQILEEASLSPVDTLKQVQRQLAETLQETLQVKEHGSQERAQLKNSMY
FT                   EAEQQLANPIKE"
FT   gene            39893..41302
FT                   /locus_tag="BPUM_0011"
FT   CDS_pept        39893..41302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60711"
FT                   /db_xref="GOA:A8F8Z4"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008638.1"
FT                   /protein_id="ABV60711.1"
FT                   /translation="MKTPLYTALAQHAEKKPYSFHVPGHHNGDVFFDEARSHYASILQL
FT                   DVTELEGLDDLHHPTGVIQEAEHLLTKLYDSDQSFFLVNGTTVGNLAMVMTACRTGDEI
FT                   FVQRNCHKSVFHAIELAGATPILIDAEIDPHLHVPTHVAEDTVRKAIAKHPHCRAIILT
FT                   YPNYYGHAADLLKLIHMCHEAGMIVLVDEAHGAHFVLGGGFPPSALSYGADVVVQSAHK
FT                   TLPAMTMGSYLHLQGDRIDAKRLKILLTMLQSSSPSYPIMASLDVARAYVEEIKEKGTL
FT                   DVIMKELTELKDQFNRLTHLEVVEPESLHSDPLKCVIRSTKGLTGYELKQVLESVDVHP
FT                   ELADEHQVLLVLSLEQRKDVPFKQIDQALKQSDSLLKGKKYIRNETVSLETDILNQDIE
FT                   AVPFEQATGRVSAESIIPYPPGIPLMIKGERIEKEQIEALSRLLGHEVHIQASQVIHQR
FT                   KLYVYIEEETL"
FT   gene            41299..41937
FT                   /locus_tag="BPUM_0012"
FT   CDS_pept        41299..41937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0012"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60712"
FT                   /db_xref="GOA:A8F8Z5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F8Z5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F8Z5.1"
FT                   /protein_id="ABV60712.1"
FT                   /translation="MSGMFITFEGPEGAGKTTVIRKVHEEMERQGYAVMATREPGGIDI
FT                   AEQIREVILNEKNTKMDAKTEALLYAAARRQHLAEKVEPALQRGETVLCDRFVDSSLAY
FT                   QGYARGLGIDQVRSINDFAIDGTMPQMTIYFSITPEEGLKRIHANQGREKNRLDMETLN
FT                   FHQLVREGYELLIAQSPERFHVVDASKPMQDVYEEVLRVIQDTLKKNQI"
FT   gene            42017..42346
FT                   /locus_tag="BPUM_0013"
FT   CDS_pept        42017..42346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60713"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008640.1"
FT                   /protein_id="ABV60713.1"
FT                   /translation="MKLIVAVVQDQDSSKLLKILTEHQFGVTKLASTGGFLKSGNTTFI
FT                   IGCDDVRVDKALQLIKENCRKRDQMIAPVSPMGGNADSYVPYPVEVEVGGATVFILPVE
FT                   QFHQF"
FT   gene            42359..42799
FT                   /locus_tag="BPUM_0014"
FT   CDS_pept        42359..42799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60714"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357474.1"
FT                   /protein_id="ABV60714.1"
FT                   /translation="MKINQDMRLLLEKRELQGIKGSQTSASFKASMETQSGKMRLEQLT
FT                   VMLSDIEVFGKKLAKSRNLKDLARFKGLVKRFVKETVDNGLNLETSRSFDIYGNTRTLA
FT                   LVKALDEKLIELTEDMMDQEKPSIDLLERIGEIKGLLINLYT"
FT   gene            42811..43800
FT                   /locus_tag="BPUM_0015"
FT   CDS_pept        42811..43800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0015"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="catalyzes the DNA-template-directed extension of the
FT                   3'-end of a DNA strand; the delta' subunit seems to
FT                   interact with the gamma subunit to transfer the beta
FT                   subunit on the DNA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60715"
FT                   /db_xref="GOA:A8F8Z8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359329.1"
FT                   /protein_id="ABV60715.1"
FT                   /translation="MAISWDDMNDLQPRVMRLIFNSIDKDRLAHAYLFEGKKGTGKQDA
FT                   AMLLAKSFFCLESGVKPCESCQNCKRIESGNHPDLHLMQPDGQSIKKAQVQALQEEFTK
FT                   AGVESHRKMYIILHADKMTVNAANSLLKFLEEPNRETMAILITEQSHKMLDTIISRCQM
FT                   LSFQPLQPQSLEQQLLQEGVSQHLARLLSNLTNNLAEALELSRNDQFAESRAKVIKLYE
FT                   VLHQRKEHAFFYIQDQWMPFFKEKDLQETGLDMLLFIYRDVLSIQIGNEDKVIYQDLFQ
FT                   TMKQHALHSTQQMVTNQILAVLEAKKRLQSNVNAQGLMEQLVLMLQEG"
FT   gene            43803..44630
FT                   /locus_tag="BPUM_0016"
FT   CDS_pept        43803..44630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0016"
FT                   /product="stage 0 sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60716"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A8F8Z9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357469.1"
FT                   /protein_id="ABV60716.1"
FT                   /translation="MYNVIGVRFKKAGKIYYFDPNGFHIENDSCVIVETVRGVEYGQVV
FT                   IANKKVDEHDVVLPLRKVIRVADERDRLIVEENKEAAMTAFDTCLQKVSEHGLEMKLVD
FT                   VEFTFDRNKVIFYFTADGRVDFRELVKDLASIFKTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYENDEYETAKEQLPDI
FT                   GETIQTSSGSAKVVGLNILERILQVELTGQEKVIEYTWEELLQEGVVSAQTTE"
FT   gene            44645..44998
FT                   /locus_tag="BPUM_0017"
FT   CDS_pept        44645..44998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0017"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /note="in Bacillus subtilis this protein is involved in the
FT                   negative regulation of DNA replication initiation;
FT                   interacts with DnaN and DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60717"
FT                   /db_xref="GOA:A8F900"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F900"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F900.1"
FT                   /protein_id="ABV60717.1"
FT                   /translation="MDKKELFDTVINLEEQIGSLYRQLGDLKNHIGEVIEENHQLQMEN
FT                   QHLRERLDQSDRDKSSETENDSAQKPGHSDIGEGHDNLARLYQEGFHICNVHYGSIRKE
FT                   GDCLFCLSFLNKK"
FT   gene            45054..45797
FT                   /locus_tag="BPUM_0018"
FT   CDS_pept        45054..45797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60718"
FT                   /db_xref="GOA:A8F901"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F901"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217966.1"
FT                   /protein_id="ABV60718.1"
FT                   /translation="MVSLREDERLDYLLAEDMKIIQSKTVFAFSLDAVLLAKFAYVPIQ
FT                   KGEIIDLCTGNGIVPLLLSTRSKASITGVEIQDRLFDMAKRSVAYNQLEKQIELIHGDL
FT                   NDMPARYGNHKVDVITCNPPYFKTPSKEEINENEYLAIARHEIHCTLEDVIRVSSTLLK
FT                   QGGKLAMVHRPGRLLEIVELMKKYRIEPKRIQFVYPKQGKEANTILVEGIKDGKPDLKI
FT                   LPPLFVYGDDQEYTEEIRTILYGEA"
FT   gene            45784..46080
FT                   /locus_tag="BPUM_0019"
FT   CDS_pept        45784..46080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60719"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F902"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F902.1"
FT                   /protein_id="ABV60719.1"
FT                   /translation="MEKHNHYFYVLKCADGSLYAGYTNDLQKRLMTHNSGKGAKYTRAR
FT                   RPVELYYHECFATKREAMQQEYRFKTWTRKKKDLYIEEMRIEKEATHEHTKKL"
FT   gene            46058..46936
FT                   /locus_tag="BPUM_0020"
FT   CDS_pept        46058..46936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0020"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60720"
FT                   /db_xref="GOA:A8F903"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8F903"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008646.1"
FT                   /protein_id="ABV60720.1"
FT                   /translation="MNTQKSFDGQSDMGILYLVPTPIGNLEDMTFRAIQTLKDVDYIAA
FT                   EDTRQTKKLCHVYEIDTPLTSYHEHNKDSSGHKLIEWLKEGKNIALVSDAGLPTISDPG
FT                   AEVVRDFTNIGGYVVPLPGANAALTALIASGITPQPFFFYGFLDRQKKEKKKQLEALKK
FT                   RQETIIFYEAPHRLKETLTLMKEVWGNRNIAITRELTKKFEEFIRGDLESVLTWATENQ
FT                   IRGEFCLVVQGNDQDEEELNEEVWWKSLSEKEHVIHYIEEGLTSKEAIKRTAVERGVPK
FT                   RTIYDAYHIEQ"
FT   gene            complement(46982..47266)
FT                   /locus_tag="BPUM_0021"
FT   CDS_pept        complement(46982..47266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0021"
FT                   /product="transition state regulator Abh"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60721"
FT                   /db_xref="GOA:A8F904"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A8F904"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003328596.1"
FT                   /protein_id="ABV60721.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDDNLKLANGKLVLSREGAEQIINEIQNQLQSQK"
FT   gene            47793..49793
FT                   /locus_tag="BPUM_0022"
FT   CDS_pept        47793..49793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0022"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60722"
FT                   /db_xref="GOA:A8F905"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A8F905"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359326.1"
FT                   /protein_id="ABV60722.1"
FT                   /translation="MPEKKKTFYLTTPIYYPSGKLHIGHAYTTVAGDAMARYKRLQGYD
FT                   VMYLTGTDEHGQKIQQKAEEQNITPIEYLDPVVADIQSLWKKLDISNDDFIRTTEKRHT
FT                   IIIGQVFQKLLDQGDIYLDQYEGWYSIPDETFYTETQLVDVEHNEKGEVTGGKSPDSGH
FT                   PVELIKEESYFFRMSKYADRLLDYYEKNPTFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGIKVPNNPKHVIYVWIDALFNYLTAIGYGTDQDEKYKKYWPANVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKQIFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLR
FT                   EVPFGADGVFTPEGFVERVNYDLANDLGNLLNRTVAMVQKYFDGTLSSYKGPVNEFDEE
FT                   LKAVAEQTVKAYEEAMENLEFSVALSNVWTLISRTNKYIDQTAPWVLAKDESKRKELHS
FT                   VMYHLAESLRITAVLLTPFLTKTPEKIFFQLGIEEEKLKSWDSILSFGAIQQATVQKGE
FT                   PLFPRLEVEEEVAYIKEKMQGSAPKVEEEKIEIEETELPELGEEIAFDDFSKVDLRVAQ
FT                   VLEAAPVKKADRLLKLQLDFGFEKRQIVSGIAKHYQPEELVGKKLVCVANLTPVKLRGE
FT                   ISQGMILTGETGGKLKVLEVDQSLANGTKIL"
FT   gene            49876..50643
FT                   /locus_tag="BPUM_0023"
FT   CDS_pept        49876..50643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0023"
FT                   /product="hydrolase TatD"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60723"
FT                   /db_xref="GOA:A8F906"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8F906"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008648.1"
FT                   /protein_id="ABV60723.1"
FT                   /translation="MLFDTHAHLNAEQYNEDLEQVIERAKSEKVEKIVVVGFDRPTITR
FT                   AMELIEAYDFIYAAIGWHPVDAIDMTDEDLLWIKELSQHEKVVAIGEMGLDYYWDKSPK
FT                   DVQKEVFRRQIALAKEVNLPIVIHNRDATEDVVTILKEEGAAEVGGIMHCFTGSLEIAK
FT                   VCMDMNFYISFGGPVTFKNAKKPKEVVKDIPSDRLLIETDCPYLTPTPFRGKRNEPSYV
FT                   KYIAEQIAELREISFEELAELTTKNAKKVFGIN"
FT   gene            50888..52090
FT                   /locus_tag="BPUM_0024"
FT   CDS_pept        50888..52090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60724"
FT                   /db_xref="GOA:A8F907"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A8F907"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359324.1"
FT                   /protein_id="ABV60724.1"
FT                   /translation="MKNLFSVKLGKGKVLLLVVCLLLAGTGTAYGAHELTKQSITISIN
FT                   GKEKTIRTHEETVAQLLSDLGIKTKAEDHISPSLNTKIEDNMNIVYDAAIPVHLTLDGK
FT                   EKTIWTTDQTVGALLKNEKIDIGKHDQVTPGKNDKIKKDMDLVVEQAFEVSVNDGGKEK
FT                   KVWTTSTTVADFLKQQELKLKKHDKIKPALHSHITKKSADIQITRVEKVTDVVEEKIAF
FT                   DTKHKKDRSLEKGKEKVLKKGEEGKLKKHYAIVKENGKVVSKELIKEVTEKDSKDRLVA
FT                   VGTQESQEEPKATPAVSRSNESSGKEFYVTSTAYTASCAGCTGRTSTGYNLKSNPGAKV
FT                   IAVDPSVIPLGSKVYVEGYGYAVASDTGSAIKGNKIDVFVPNKSAAYQWGNKRVKIRVL
FT                   K"
FT   gene            52251..52811
FT                   /locus_tag="BPUM_0025"
FT   CDS_pept        52251..52811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0025"
FT                   /product="ribonuclease M5"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60725"
FT                   /db_xref="GOA:A8F908"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A8F908"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359323.1"
FT                   /protein_id="ABV60725.1"
FT                   /translation="MKIKEIIVVEGRDDTARVKMAVDADTIETNGSAIGDTVIQQVRLA
FT                   QETRGVIILTDPDFPGEKIRKTIAEAVPGCKHAFLPKHLAKAKRDKGIGVEHASLDSIR
FT                   ECLAHVHEEMEVTESDITLDDLFDAGLIGGESSKRRRERLGVLLNIGYTNAKQLHKRLH
FT                   MFQITKHDFIAALKTVMQEEADE"
FT   gene            52804..53682
FT                   /locus_tag="BPUM_0026"
FT   CDS_pept        52804..53682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0026"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60726"
FT                   /db_xref="GOA:A8F909"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F909"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F909.1"
FT                   /protein_id="ABV60726.1"
FT                   /translation="MNKDIATPIRTKEILKKYGFSFKKSLGQNFLIDTNILDRIVDHAE
FT                   VTDETGVIEIGPGIGALTEQLAKRAKKVTAFEIDQRLLPILNDTLSPYDNVTIIHQDVL
FT                   KADVGKVIEENFADCKEVMVVANLPYYVTTPIIMKLLEENLPLKGIVVMLQKEVADRMA
FT                   AIPSSKEYNSLSIAVQYYTEAKTVMVVPKTVFVPQPNVDSAVIKLTVRETPAVSVENDE
FT                   FFFQLIRASFGQRRKTLMNNLMNNLPDGKQHKAIIEEALQTADIDGKRRGESLSIEEFA
FT                   RLSNVLQKALF"
FT   gene            53813..54697
FT                   /locus_tag="BPUM_0027"
FT   CDS_pept        53813..54697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0027"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60727"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A8F910"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357449.1"
FT                   /protein_id="ABV60727.1"
FT                   /translation="MQFQIGDMVTRASYQMDILFRIIRIDETDQHEATAILHGNEVRLI
FT                   ADAKLSDLVKVQKEEQLTREKNDERKINESLDLLRQDYQLLREKQEYYTSGQYQHQEQY
FT                   FHMPGKVLHLDGDASYLKKCLDVYERIGVPVYGVHCHEKKMPSMIDSLIDQYRPDILVI
FT                   TGHDAYSKQKGGVHDIGAYRHSRHFVETVQKARRKIPHLDQLVIFAGACQSHFESLIQA
FT                   GANFASSPSRVNIHALDPVYIVAKISFTPFVDRINVWDVLRNTLTREKGLGGIETKGVL
FT                   RVGMPYKRDHEST"
FT   gene            54911..55168
FT                   /locus_tag="BPUM_0028"
FT   CDS_pept        54911..55168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0028"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60728"
FT                   /db_xref="GOA:A8F911"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A8F911"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217979.1"
FT                   /protein_id="ABV60728.1"
FT                   /translation="MAKTLSDIKRSLDGNLGKRLTLKANGGRRKTIERSGILAETYPSV
FT                   FVIQLDQDENSFERVSYSYADILTETVELTFDDTASSVAY"
FT   gene            55332..55517
FT                   /locus_tag="BPUM_0029"
FT   CDS_pept        55332..55517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0029"
FT                   /product="protein sspF"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60729"
FT                   /db_xref="GOA:A8F912"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:A8F912"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366434.1"
FT                   /protein_id="ABV60729.1"
FT                   /translation="MGRRRGIMSDEFKYELAKDLGFYDTVKNGGWGEIRARDAGNMVKR
FT                   AIELAQQHMAQDENQR"
FT   gene            55664..56533
FT                   /gene="ipk"
FT                   /locus_tag="BPUM_0030"
FT   CDS_pept        55664..56533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="BPUM_0030"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="An essential enzyme in the nonmevalonate pathway of
FT                   isopentenyl diphosphate and dimethylallyl diphosphate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60730"
FT                   /db_xref="GOA:A8F913"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F913"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F913.1"
FT                   /protein_id="ABV60730.1"
FT                   /translation="MRILEKAPAKINLSLDVHGKRPDGYHEVEMVMTTIDLADRLELTE
FT                   LDKDEIRVSSHNRFVPDDQRNLAYQAAKLLKTRFGIQKGVSIVITKTIPVAAGLAGGSS
FT                   DAAAALRGLNRLWKLNLTLDELAELGAEIGSDVSFCVHGGTALATGRGEKLKHIATPPH
FT                   CWVILAKPVIGVSTAEVYRQYDASKVEHPNVERMIEAIEAKDYKEMCGSLGNVLESVTL
FT                   KMYPEVDMIKRQMKRFGADAVLMSGSGPTVFGLIQYESKVQRIYNGLRGFCDQVYAVRM
FT                   IGEQNALD"
FT   gene            56589..57422
FT                   /locus_tag="BPUM_0031"
FT   CDS_pept        56589..57422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0031"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60731"
FT                   /db_xref="GOA:A8F914"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F914"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217919.1"
FT                   /protein_id="ABV60731.1"
FT                   /translation="MKFRRSGRLVDLTNYLLAHPHVLVPLTFFAERYQSAKSSISEDLT
FT                   IIKQTFEQQGIGTLLTVPGAAGGVKYIPKIHLKEADDVVNDIGEALSTPERVLPGGYLY
FT                   LTDVLGNPSILAKIGKLFATIFADRAIDVVMTVATKGIPIAYSVAGYLNVPVVIVRKDN
FT                   KVTEGSTVSINYASGSSNRIQTMSLAKRSLDKGSNVLIIDDFMKAGGTINGMVNLLEEF
FT                   NANVAGIGVLLEDEGVDERLVDEYVSLLKLSTIDMKQKIIEINEGNFHEFFHSKA"
FT   gene            57459..57836
FT                   /locus_tag="BPUM_0032"
FT   CDS_pept        57459..57836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0032"
FT                   /product="reactive intermediate/imine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60732"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8F915"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008655.1"
FT                   /protein_id="ABV60732.1"
FT                   /translation="MTKVVQTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTAAGDFVNGD
FT                   IKEQTHQVFRNLNAVLEAAGASFETVVKATVFIKDMEQFGEVNEVYGEYFHTHKPARSC
FT                   VEVARLPKDALVEIEVIALVK"
FT   gene            58062..58358
FT                   /locus_tag="BPUM_0033"
FT   CDS_pept        58062..58358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0033"
FT                   /product="septation protein spoVG"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60733"
FT                   /db_xref="GOA:A8F916"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F916"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F916.1"
FT                   /protein_id="ABV60733.1"
FT                   /translation="MEVTDVRLRRVNTDGRMRAIASITLDHEFVVHDIRVIDGNNGLFV
FT                   AMPSKRTPDGEFRDIAHPINSSTRGKIQDAVLNEYHRLGEEEETIEYEEAGAS"
FT   gene            58558..59928
FT                   /gene="glmU"
FT                   /locus_tag="BPUM_0034"
FT   CDS_pept        58558..59928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BPUM_0034"
FT                   /product="bifunctional N-acetylglucosamine-1-phosphate
FT                   uridyltransferase/glucosamine-1-phosphate
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /note="forms a homotrimer; catalyzes the acetylation of
FT                   glucosamine-1-phosphate and uridylation of
FT                   N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
FT                   function in cell wall synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60734"
FT                   /db_xref="GOA:A8F917"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:A8F917"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359320.1"
FT                   /protein_id="ABV60734.2"
FT                   /translation="MDKRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVEHVADEALKLS
FT                   LAKLVTIVGHGAEDVKEQLGDRSEYALQEEQLGTAHAVKQAKSFLAQEKGTTIVICGDT
FT                   PLLTAETMEAMLSEHQKHQAKVTILTARAEDPTGYGRIIRDETGAVVKIVEHKDANDAE
FT                   RQVNEINTGTYCFSNEDLFRVIEQVSNENAQGEYYLPDVIEILKNEGQTVAAYQTPQFE
FT                   ETLGVNDRIALSQAEQFMKRRINHQHMKNGVTLIDPENTYISPDAVIGEDTMIYPGTVI
FT                   KGNVKIGADAIIGPNTEIVDSIIGDRTVIKQSVVCDSEVGVDVTIGPFAHIRPLSKIGD
FT                   EVKIGNFVEIKKTVFGDRSKVSHLSYIGDAEVGTDVNLGCGSITVNYDGKNKFLTKIED
FT                   GAFIGCNSNLVAPVTVGKGAYVAAGSTVTEDVPQDALSIARARQVNKEDYVKNIHKK"
FT   gene            59951..60904
FT                   /locus_tag="BPUM_0035"
FT   CDS_pept        59951..60904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0035"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60735"
FT                   /db_xref="GOA:A8F918"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A8F918"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003328581.1"
FT                   /protein_id="ABV60735.1"
FT                   /translation="MSNRYADANLKIFSLNSNPELAKEIADRIGVDVGKSSVKRFSDGE
FT                   VQINIEESIRGCDCYVIQSTSAPVNEHIMELLIMVDALKRASAKTVNIVIPYYGYARQD
FT                   RKAKPREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDNLMAVPILTNYFEQ
FT                   KNLNDIVVVSPDHGGVTRARKMADRLKAPIAIIDKRRPKPNVAEVMNIIGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGAAEVYACCTHPVLSGPAVERITNSKIKELVVTNSIHL
FT                   TDDKKVGKFIPLSVGPLLAEAIIRVHEEESVSYLFS"
FT   gene            61042..61668
FT                   /locus_tag="BPUM_0036"
FT   CDS_pept        61042..61668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0036"
FT                   /product="50S ribosomal protein L25"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60736"
FT                   /db_xref="GOA:A8F919"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F919"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217956.1"
FT                   /protein_id="ABV60736.1"
FT                   /translation="MATLKANKRTDFKRSTLQKIRHSGHVPGVIYGKNTDNLAVSLDSI
FT                   DLLKTLRDEGKNTIITLDVNGETKSVMVTELQTDPLKNELVHADFQVVDLQREIEADVP
FT                   VQLIGESKGVKDGGVLQQPLFELSITAKPKDIPQHIEADITNLEVNDVLTVADLPVQSS
FT                   YQVNNDPEEVVASILPPQQSEVPEPDSEEEPKEPEAIKEKDNDGE"
FT   gene            61808..62374
FT                   /locus_tag="BPUM_0037"
FT   CDS_pept        61808..62374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0037"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60737"
FT                   /db_xref="GOA:A8F920"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F920"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F920.1"
FT                   /protein_id="ABV60737.1"
FT                   /translation="MIAFVGLGNPGKEYEKTRHNVGFMTIDELSKKWDIPLNQSKFHGQ
FT                   FGTGFVSGQKVLLVKPLTYMNLSGECVRPLMDYYDIPLEHLKVIYDDLDLPTGRIRLRT
FT                   KGSAGGHNGIKSLIQHLGSPEFDRFRIGIGRPQNGMKVVDYVLGRFSEEEQPDIASAIQ
FT                   ASVEACEAALTKPFLEVMNDFNKKV"
FT   gene            62430..62660
FT                   /locus_tag="BPUM_0038"
FT   CDS_pept        62430..62660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0038"
FT                   /product="peptide ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60738"
FT                   /db_xref="GOA:A8F921"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A8F921"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217967.1"
FT                   /protein_id="ABV60738.1"
FT                   /translation="MALHYYCRHCGVKVGSLDESAVQSEALGFHHLTNEERNDMISYRE
FT                   NGDLHVQTICEDCQEALERNPDYHQYHTFIQ"
FT   gene            62728..66261
FT                   /locus_tag="BPUM_0039"
FT   CDS_pept        62728..66261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0039"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60739"
FT                   /db_xref="GOA:A8F922"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A8F922"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217985.1"
FT                   /protein_id="ABV60739.1"
FT                   /translation="MKNIQSFIKQSDDFQSIFNGLKEGLKEQLLAGLSGSVRSLFTAAI
FT                   SDELKRPMFIVTHNLYQAQKVTDDLASVMSDRSVLLYPVNELIASEIAVASPELRAQRL
FT                   DVLNRLANGENPIIVTPAAAVRRMLPPVELWKESQIHLKLGEEIDLEAFSKQLVQIGYD
FT                   RTSMVAAPGDFSVRGGIIDIYSLTEDHPIRIELFDTEVDSIRTFHSDTQRSLETLQEIK
FT                   IGPAKELIVRGPERVRAIEQLDQGLANSLKKFNSDQQKELLHQHITADREKLLEGIVTQ
FT                   EMTKYLSYFYEKPASLLDYTSQDTIIILDEISRIQEMEEQLEQEEADWTISLLEEGNIL
FT                   HDLTLSFPFQQLINQQSRSILYYSLFLRHVQQTNPQNIVNVSSKQMQNFHGQMNVLASE
FT                   IERYKKQQYTVVFLGADEERTDKLSSVLHDYDIEAALAKPDAELVSGQVYILQGELQTG
FT                   FELPLSKIAVITEGELFKKRVKKQARKQKLTNAERIKSYSELQVGDYVVHINHGIGKYL
FT                   GIETLEIGGIHKDYLNIHYQGSDKLYVPVEQIDQVQKYVGSEGKEPKLYKLGGSDWKRV
FT                   KKKVESSVQDIADDLIKLYAEREASKGYAFSPDHEMQRQFESAFPYQETDDQIRSIHEI
FT                   KQDMERERPMDRLLCGDVGYGKTEVAIRAAFKAIADGKQVALLVPTTILAQQHFDTIMD
FT                   RFQDYPVKIAQLSRFRTRKETTETLKGLKNGTIDMVIGTHRLLSKDIVYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQMKANIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNGALVREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDAKVSYAHGKMSEN
FT                   ELESVMINFLEGESDVLVSTTIIETGVDIPNVNTLIVHDADKMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLTIRGAGNLLGAQQHGF
FT                   IDSVGFDLYSQMLKEAIEERRGDTTAQDKFEPEIDLQIDAYIPDTYISDGKQKIEMYKQ
FT                   FRAIGSIEERKELQDEMIDRFGEYPQEVADLFTIATMKVYAVQERVELIKMEKGIVRLT
FT                   LEEQASGEIDGQKLFALGSKYGRDIGLGMEGSKLIISVQTKGKKTEEWLEIVLNMLRGL
FT                   QDVKKETIPSS"
FT   gene            66401..66937
FT                   /locus_tag="BPUM_0040"
FT   CDS_pept        66401..66937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0040"
FT                   /product="stage VI sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60740"
FT                   /db_xref="GOA:A8F923"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A8F923"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217990.1"
FT                   /protein_id="ABV60740.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALFDSLGHSILICDRDTYIAVSGSSKKEYLNKSISDLLER
FT                   TMDQRNSVLEESKKEIQLVDGIDDDVSAYTIAPIVANGDPIGAVVLFSKERSMGEVEHK
FT                   AAETAAGFLARQMEH"
FT   gene            67132..68736
FT                   /locus_tag="BPUM_0041"
FT   CDS_pept        67132..68736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60741"
FT                   /db_xref="GOA:A8F924"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A8F924"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217981.1"
FT                   /protein_id="ABV60741.1"
FT                   /translation="MKNAVNQPHWLFQGAVILTIAGLLSKVLSAVYRVPFQNIVGDTGF
FT                   YIYQQVYPFLGIAIMLGTTGFPVMVSKLLSEHGEENRRIITRVSLVYITLLSLVLFLCL
FT                   YIGAGRIASLMADSQLILLIQMSAFVFLFLPLTVMLRGVFQSDGMMLPTAVSQLVEQLI
FT                   RVGVLLVLSFYFVRHGYSLYETGAGAVFSSIAGSAASLILLLFLWLTYRKQSSAPMTVK
FT                   QTTLRKKDVLKSLVLYTFTICVSGLLILWMQMIDAFHLYALLRSEGLSEAAAKAAKGVY
FT                   DRGQPFLQLGTVFAISIGTSLVPFLSAAMRNGEHEAIRQKVRTSIKTTSVLGIGSAVGL
FT                   ICILSSVNIMLFRNDLGTDALQIFCISIAFTSIAITQAALLQGLGHTVYPAVVVLLSVL
FT                   VKWILTLALVPLLGIYGAAWSTVCGFLAAALLNAFYLRHKGWISLRELFPVRILLSAAF
FT                   MAIVLIGYQALFSWVIPFEKRPFSVLESLTSVFIGGFAFLYSILKLEVFTDEEWRLIPL
FT                   GEKILYFKQMRGNQNGR"
FT   gene            68726..70210
FT                   /locus_tag="BPUM_0042"
FT   CDS_pept        68726..70210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60742"
FT                   /db_xref="GOA:A8F925"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8F925"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366438.1"
FT                   /protein_id="ABV60742.1"
FT                   /translation="MAGKITVVGLGAGDMDQLTLGVYKQLKQAKEVFMRTQDHPLTAEL
FT                   MQEVPSLTFFDEIYEKHDQFDSVYQEITEILFKEAAEKEIVYAVPGHPFVAEKTVQLLV
FT                   SQQQERGIEVSVAGGQSFLDATFNSLQIDPIEGLQFVDAGDMRADDLKLTQHVLICQVY
FT                   DQITASNVKLTLMEKLPDDYEVYIVTAAGSSLEQITAVPLFELDRDVSINNLTSVYVPP
FT                   IQDEKLLYKQFDIFRDVIRTLRGPGGCPWDQKQTNESLKPYLIEECYELLEAIDEDDPD
FT                   HMVEELGDVMLQVLLHAQIGEDDGFFSIDDVIQHVTEKMIRRHPHVFGDTNVSEAEEVV
FT                   VNWEKIKQLEKPERAASMLQSIPATLPALTKAYKLQKKAAKVGFDWTDVNDIWNKYEEE
FT                   KQEFLVEVAEKPDESATKQMKDEFGDLLFVLVNIGRFYQLEPETALASANTKFMRRFQH
FT                   IEQKAKDMGRSLEELTLEEMDDLWNDAKRIERGEHT"
FT   gene            70207..70467
FT                   /locus_tag="BPUM_0043"
FT   CDS_pept        70207..70467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60743"
FT                   /db_xref="GOA:A8F926"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A8F926"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217975.1"
FT                   /protein_id="ABV60743.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGTQAKASSDVKEGD
FT                   ELKIRFGQKLVTVQVNELKDTTKKEEAAGMYTVLKEEKTAE"
FT   gene            70542..70850
FT                   /locus_tag="BPUM_0044"
FT   CDS_pept        70542..70850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0044"
FT                   /product="spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60744"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:A8F927"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357415.1"
FT                   /protein_id="ABV60744.1"
FT                   /translation="MNQYYNQPQGTKLSSEAEHNITMRNRKHLDITGVKQVESFDNEEF
FT                   LLETVMGILAIRGENLQMKNLDVEKGVVSIKGRVFDLIYVDEQHGEKAKGFFSKLFK"
FT   gene            70847..71485
FT                   /locus_tag="BPUM_0045"
FT   CDS_pept        70847..71485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0045"
FT                   /product="spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60745"
FT                   /db_xref="GOA:A8F928"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A8F928"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359315.1"
FT                   /protein_id="ABV60745.1"
FT                   /translation="MTLTVQFYTMLSMVAMGIWLGASLDTYKLFVNREKTAKWLLIIHD
FT                   LLFWLVQGLLFFYVLLLTNEGEFRVYIFLAVALGFSMYQALMKQLYMNILKFLVMCVYQ
FT                   AALILKRLVMSIVFQPIRWLITFIISAIMFLLHLLLRLVHFTFRLVWKVLSIVCYPLIW
FT                   LLNVTIIHRIPEKWRTSMRLFFSKGAGILQGTKKLSGTIKTKWKQFWTK"
FT   gene            71504..71878
FT                   /locus_tag="BPUM_0046"
FT   CDS_pept        71504..71878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0046"
FT                   /product="cell division protein DIVIC"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60746"
FT                   /db_xref="GOA:A8F929"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A8F929"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217952.1"
FT                   /protein_id="ABV60746.1"
FT                   /translation="MNKRKRNIAQIQNDYQKQMEQQAQRLKRKRRGLLRRLTVFGVIAL
FT                   MFVVLVISALWSQSSSLKEKEEKKVALEKELKQLQTKQEDISDEIKKLKSKEYVLELAR
FT                   RDYYMSKKGEKIFDVGNKSD"
FT   gene            71961..72359
FT                   /locus_tag="BPUM_0047"
FT   CDS_pept        71961..72359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60747"
FT                   /db_xref="GOA:A8F930"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8F930"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217901.1"
FT                   /protein_id="ABV60747.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPGGSTGLVHISEVADNYVKD
FT                   INEHLKVGEQVEVKVINVEKDGKIGLSIKKAKDRPQQQQSRPSRNDFRPKESFEQKMNK
FT                   FLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            72536..72609
FT                   /locus_tag="BPUM_03785"
FT                   /old_locus_tag="BPUM_t0001"
FT   tRNA            72536..72609
FT                   /locus_tag="BPUM_03785"
FT                   /old_locus_tag="BPUM_t0001"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:72570..72572,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            72636..72707
FT                   /locus_tag="BPUM_03790"
FT                   /old_locus_tag="BPUM_t0002"
FT   tRNA            72636..72707
FT                   /locus_tag="BPUM_03790"
FT                   /old_locus_tag="BPUM_t0002"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:72669..72671,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            72913..75396
FT                   /locus_tag="BPUM_0048"
FT   CDS_pept        72913..75396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0048"
FT                   /product="stage II sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60748"
FT                   /db_xref="GOA:A8F931"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8F931"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359314.1"
FT                   /protein_id="ABV60748.1"
FT                   /translation="MEKLERRTDLTGAGFERISAGLKKMKNLFLHHTHSLFFYKGFIYV
FT                   VLGFLLGRAFILSEIMPFALPFFGSMLLIKRDKSMLACLALLAGAMTISPQNALFVFAS
FT                   LIVFLLMSKVVSFIIKDPVKTLPVVIVLSMLITRGAFVYLEQGAVQSYDYVMAGVEAGL
FT                   AFILTLIFLQSLPIFTVRKIKHSLKVEEIICFMILIASVLTGLAGITFQGMQAEHILSR
FT                   YVVLSFAFIGGASIGCTVGVVTGLILGLANIGNLYQMSLLAFSGLLGGLLKEGKKAGAA
FT                   IGLIVGSLLISLYGEGSAGLMNTLYESLIAVVLFLLTPQSVTSKVAKYIPGTVEHVQEQ
FT                   QQYARKVRDVTAKKVDQFSNVFHALSESFATFYESIPEEKKQEEDVDLFLSTITERSCQ
FT                   TCYKKNKCWVQNFDTTYELMKQVMQESDEKTYEHNRKLKKKFSQHCSKSKHVEELIEEE
FT                   IAYYKANQTLKKKVQDSRRLVAEQLMGVSQVMEDFSREIKREREQHFIQEEQMIEALQH
FT                   FGIEIQQVEIYSLEQGNVDIEMRIPYCQGHGECEKIIAPMLSDILEEQILVKAEQCAEH
FT                   PTGYCHVVFGSAKSYRVATGVAHAAKGGGLVSGDSYSMMELGAGKYAAAISDGMGNGAR
FT                   AHFESNETIKLLEKILASGINEKVAIKTINSILSLRTTDEIYSTLDLSIIDLQDASCKF
FT                   LKIGSTPSFIKRGDQVMKVQASNLPIGIIDEFEVEVVSEQMKAGDLLIMMSDGIFEGPK
FT                   HIENHDLWVKRKMKSFKTEDPQEIADLLMEEVIRTRSGQIDDDMTVVVIRLDHNTPKWA
FT                   SIPTGTFYLEKQEIS"
FT   gene            75473..76207
FT                   /locus_tag="BPUM_0049"
FT   CDS_pept        75473..76207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60749"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A8F932"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008341829.1"
FT                   /protein_id="ABV60749.1"
FT                   /translation="MRKGHVNQILLITDGCSNHGEDPLAIASLAKEQGITVNVIGIMEE
FT                   NRHDHEAMKEVEGIALAGGGIHQVVYVQQLSQTVQMVTKKAMTQTLQGVVNKELQQILG
FT                   KDTEIEELPPDKRGEVMEVVDELGETVHLQVLVLVDTSASMKPKLPTVKEALIDLSISL
FT                   NSRIGENQFGMCIFPGKNSDAEIVLNWTPRFDSLSSIFQKLTTGGITPTGPALREALQH
FT                   FKSVRSRKGLLEAKEEHDEFGF"
FT   gene            76188..77198
FT                   /locus_tag="BPUM_0050"
FT   CDS_pept        76188..77198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0050"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60750"
FT                   /db_xref="GOA:A8F933"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8F933"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357404.1"
FT                   /protein_id="ABV60750.2"
FT                   /translation="MMNSVSNIPLGTVIQGKWHHHHYRIVKELGKGANGIVYLAESPNG
FT                   QVALKVSDDSMLIASEVNVLKSFSKAPVKTMGPSFYDMDDAIYPGMLQKRSFYVMEYVR
FT                   GPLLLDFVKQKGDEWIVVLMVQLLSNLAHLHQEGWIFGDLKPDNLIVSGPPATIRCIDV
FT                   GGTTKAGRAIKEYTEFFDRGYWGFGTRKAEPSYDLFALSMVMVNCAYKKEFKKGVEPEK
FT                   QLYRAIEGHPLLKRYERVLKAALQGKYQSAAAMKSAMLKEGQLIASRKASQKKQQQKNG
FT                   QRPAGQQNQQVTSRSRVAAAKRTQVRKKSGGLFETILIVCSVLALYCAYVVLFLL"
FT   gene            77253..78698
FT                   /locus_tag="BPUM_0051"
FT   CDS_pept        77253..78698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0051"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60751"
FT                   /db_xref="GOA:A8F934"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8F934"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496176.1"
FT                   /protein_id="ABV60751.2"
FT                   /translation="MYIFKLPALCEEEVVNRIESFLKKHDVYLENTTVIVGVSGGPDSM
FT                   LLLHELNKRRKGSFQLIAAHVDHMFRGEESFVDLAFVEAYCKEQGIPFESARIQVTQYA
FT                   KENHLNKQAAARECRYAFFRQLMERYKAQFIALAHHGDDQVETMMMRLARGTVGIGLAG
FT                   IQAKRPYQDGWLIRPLIGYSKDDVLTACEQAHIPYVIDQSNHTDDYLRNRIRRHILPVL
FT                   KEEAPHVHESFQFVSDMLTEDEQYLQALTKEQMNQVITNQSPKQIKIKTKPLLDLPLPL
FT                   QRRGIQLILNYLYENTQSAFSNQHILGTLDWLSHTEQPSGSLDLPKGLQAVKSYDYCMF
FT                   TFERSLVLDQSYALHLKGEVGEELFLPNGQSIVVSNHVPKDARNGNHFFLLQKDRVRFP
FT                   LIIRSRKNGDRIKLKGMNGSKKVKDIFIDKKVPLAERDSWPIVTDSDHQIIWIPGLKKS
FT                   VFEEIDMTNSDLIVLQYRQHENL"
FT   gene            78714..79253
FT                   /locus_tag="BPUM_0052"
FT   CDS_pept        78714..79253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0052"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60752"
FT                   /db_xref="GOA:A8F935"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8F935"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217950.1"
FT                   /protein_id="ABV60752.1"
FT                   /translation="MKQDIEKVLISEEEIQQKVKELGATLTSDYDGEFPLAIGVLKGAL
FT                   PFMADLIKHIDTYLELDFMDVSSYGKSTVSSGEVKIIKDLDTSVEGRDILIMEDIIDSG
FT                   LTLSYLVELFRYRKANSIKIVTLLDKPSGRKADIKADYVGFEVPDAFVVGYGLDFAERY
FT                   RNLPYIGVLKPSVYEG"
FT   gene            79349..81253
FT                   /locus_tag="BPUM_0053"
FT   CDS_pept        79349..81253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0053"
FT                   /product="cell division protein FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60753"
FT                   /db_xref="GOA:A8F936"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8F936"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008669.1"
FT                   /protein_id="ABV60753.1"
FT                   /translation="MNRVFRNTIFYILILLLVIGVVSWLGSPNQKPENMSYSKFSQNLS
FT                   AGKVESISIQPVRGVYEIRGQLDGAKKDEYFITHVPDGQGVDQIYSALKNTDVKVEPAP
FT                   ETNGWLQVLTTIIPFIIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDV
FT                   AGADEEKQELVEVVEFLKDPRKFAELGARIPKGVLLVGPPGTGKTLLARASAGEAGVPF
FT                   FSISGSDFVEMFVGVGASRVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDERE
FT                   QTLNQLLVEMDGFSANEGIIIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREEVL
FT                   KVHAKNKPLDDTVNLKAIASRTPGFSGADLENLLNEAALVAARHNKKKIDMRDIDEATD
FT                   RVIAGPAKKSRVISKKERNIVAYHEAGHTVIGLILDEADMVHKVTIVPRGQAGGYAVML
FT                   PREDRYFQTKPELLDKIVGLLGGRVAEEITFGEVSTGAHNDFQRATGIARRMVTEFGMS
FT                   DKLGPLQFGQAQGGQVFLGRDFNNEPNYSEAIAYEIDQEVQRFIKESYERAKQILTENK
FT                   DKLEIIAQALLEVETLDAEQIKSLYETGKLPERVYADDEEKNDDVKVNIKKKEEDEEI"
FT   gene            81417..82193
FT                   /locus_tag="BPUM_0054"
FT   CDS_pept        81417..82193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0054"
FT                   /product="type III pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60754"
FT                   /db_xref="GOA:A8F937"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A8F937"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008341820.1"
FT                   /protein_id="ABV60754.2"
FT                   /translation="MLLVIDVGNTNTVLGVYHNGDLNYHWRIETSRHKTEDEFGMAIRS
FT                   LFDYVGLMFDQIEGIIISSVVPPMMFALERMCEKYFHITPQIVGPGMKTGLNIMCDNPK
FT                   EVGADRIVNAVAAIHLYGAPLIVVDFGTATTYCYINEQKQYMGGAIAPGITISTEALYT
FT                   RAAKLPRIEIVRPDHIVGKNTISAMQSGILYGYVGQVEGIVKRMKQQAKQTPKVIATGG
FT                   LSTLIGNESDCIDIVDPFLTLKGLQLIYERNRVGVL"
FT   gene            82209..83084
FT                   /locus_tag="BPUM_0055"
FT   CDS_pept        82209..83084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0055"
FT                   /product="heat-shock protein Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60755"
FT                   /db_xref="GOA:A8F938"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F938"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217983.1"
FT                   /protein_id="ABV60755.1"
FT                   /translation="MDYLVKALAYDGKVRAYAANTTDTINEAQRRHHTWPTASAAIGRT
FT                   MTATVMMGAMLKGENKLTVKIEGGGPIGAIIADGNAKGQVRGYVSNPQVHFDLNEHGKL
FT                   DVRRAVGTSGTLSVVKDIGLKDHFTGQTEIVSGEIGDDFTYYLVSSEQVPSSVGVGVLV
FT                   NPDNSILAAGGFIIQLLPGTEDAVIERLEKRLSTIEPISKLIEKGMTPEEILEEVLGEK
FT                   PQILETVPVEFSCNCSKERFANGIISLGKAEIDDMIEQDGQAEAQCHFCNETYVFTKEE
FT                   LEELREEITR"
FT   gene            83131..84039
FT                   /locus_tag="BPUM_0056"
FT   CDS_pept        83131..84039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0056"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60756"
FT                   /db_xref="GOA:A8F939"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8F939"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366443.1"
FT                   /protein_id="ABV60756.1"
FT                   /translation="MRLKARVVWTFILVLLMINAVVIAYVLTKSQMSQASSNGKSGEEI
FT                   ASIGKEKVTRQEWLKKMEDRYGKATLEQMINQKVVNQLAKENKLEVSSKEINRELLMLK
FT                   AVSNNFYEDGHTSEKDWTEQIRYQILLEQLLTRDAVVSEKEAKSFYEKNKDLYQYDDSY
FT                   RIRHIVVKTKGEAENVLKDLKGGSSFEAVAAERSIDRYTSPYGGDLGFVTEEQESIPAL
FT                   YIQEAQKLQPDEWTKEPIETKNGYAIIQLKEKLDGRSFSYEEVKNQIKRQIAMEDLGEK
FT                   ANVKTLWKEAKVTWFYDGEQD"
FT   gene            84117..85040
FT                   /locus_tag="BPUM_0057"
FT   CDS_pept        84117..85040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0057"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60757"
FT                   /db_xref="GOA:A8F940"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8F940"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359310.1"
FT                   /protein_id="ABV60757.1"
FT                   /translation="MARIANSVFELIGNTPVVKLNRLVDEDSADVYLKLEYMNPGSSVK
FT                   DRIALAMIEDAEAKGTLKAGDTLIEPTSGNTGIGLAMVAAAKGINAILVMPDTMSQERR
FT                   NLLRAYGAELVLTPGAEGMKGAIKKAEELAEEHGYFMPQQFSNEANAEIHRRTTGKEIL
FT                   EQFDGELDAFIAGVGTGGTITGAGEVLKEAIPSIQLYAVEPTDSPVLSGGKPGPHKIQG
FT                   IGAGFIPSILNTEVYDGIIQVKNEDAFELARKAAKEEGILGGISSGAAIYAALQTAKKL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFD"
FT   gene            85165..86583
FT                   /locus_tag="BPUM_0058"
FT   CDS_pept        85165..86583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0058"
FT                   /product="aminobenzoate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60758"
FT                   /db_xref="GOA:A8F941"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A8F941"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357387.1"
FT                   /protein_id="ABV60758.1"
FT                   /translation="MTQRRPMGIKIPFTKDAFLKRYEQLTAGVTHHVLLESARGGSYSI
FT                   AGIHPIAKAKGKDGMTTIHYQDEVLFKEGDPFRAFTDWFQTLQTETNEEYPDFQGGAIG
FT                   FLSYDYARYIEHFKMLSIDDLKTPDLYFLVFNDVAVFDHEENMLWLITHTEGAEPVSDT
FT                   HQRLEDLKQKWTSSANESVQSPVHEPSVEFVPAAPFTEETFGEAVEKIKQYIASGDVFQ
FT                   VNLSIRQDEQLHTHPYELYKTLRQVNPSPYMSYLHTPDFQIVCGSPELLIKKKGTQLET
FT                   RPIAGTRSRGKDEAEDHALAKELIENEKERAEHVMLVDLERNDLGRVSTYGSVRVNEFM
FT                   AIEKYSHVMHIVSNVQGELRDDCDAVDVMRAVFPGGTITGAPKVRTMEIIEELEPTRRG
FT                   LYTGSIGWFGFNQDMHFNIVIRTAYCTEGKAFMQSGAGIVIDSVPKHEYKESIKKAYAV
FT                   KKALQLSKEETILS"
FT   gene            86597..87190
FT                   /locus_tag="BPUM_0059"
FT   CDS_pept        86597..87190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0059"
FT                   /product="anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="TrpG; with TrpE catalyzes the formation of
FT                   anthranilate and glutamate from chorismate and glutamine;
FT                   TrpG provides the glutamine amidotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60759"
FT                   /db_xref="GOA:A8F942"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8F942"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496162.1"
FT                   /protein_id="ABV60759.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELIVKRNDQVTIQEIEELKPD
FT                   FLMISPGPCSPDEAGISMEAIKHFAGSIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SEIEHDGKGVFTGLQNPLVATRYHSLIVKNETLPECFDATASTKEGELMAIRHKELPIE
FT                   SVQFHPESIMTSFGKEMLKNFIETYRKKGHEVNA"
FT   gene            87187..88035
FT                   /locus_tag="BPUM_0060"
FT   CDS_pept        87187..88035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0060"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60760"
FT                   /db_xref="GOA:A8F943"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8F943"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008676.1"
FT                   /protein_id="ABV60760.1"
FT                   /translation="MIIYLNGQYIEEKDATLSPFDHGFLYGIGVFETFTSLAGQVFLLD
FT                   WHLERLNQSLRDLCIESTIEKPFVLDIIHTLLNKNDIAGGHARIRFNVSAGRGNGFSAD
FT                   PYEEPVVFVMISPFRPESVLDEKQGVILQTRRNTPEGSRRLKSHHYMNNLLAKREVGND
FT                   PKVEGIFLTKENDVAEGITSNVFWRKGDVMYTPSLDTGILNGVTRRYCIETLQTMEASL
FT                   KVGRYPVSHLLSADEAWMTNSVQGIVPFRSIGDISFSHNSRIFSTKLRTQYTKERLDYK
FT                   E"
FT   gene            88046..88903
FT                   /locus_tag="BPUM_0061"
FT   CDS_pept        88046..88903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0061"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60761"
FT                   /db_xref="GOA:A8F944"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A8F944"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008341807.1"
FT                   /protein_id="ABV60761.1"
FT                   /translation="MTQQVIKQPKVIQAKHHTLSYEEKTLVMGILNVTPDSFSDGGKFN
FT                   QVDKALAHAAQLIEDGAHIIDIGGESTRPGAAFVSEQEELSRVIPVIEKITKELDVPIS
FT                   IDTYKAHVADEAVKAGASIINDVWGAKADPQMAHVAAKHNVPIILMHNRPERNYTHLIS
FT                   DMIADLNESVQIAKQAGVRDDMIILDPGIGFAKNKEDNLMVMNELEHFCQLGYPLLLAT
FT                   SRKRFIGAVLDLPPEERTEGTGATVCLGIQKGSAMVRVHDVKEIARMAKMMDAMLNKGG
FT                   AYHR"
FT   gene            88920..89258
FT                   /locus_tag="BPUM_0062"
FT   CDS_pept        88920..89258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0062"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60762"
FT                   /db_xref="GOA:A8F945"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A8F945"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217925.1"
FT                   /protein_id="ABV60762.1"
FT                   /translation="MEFYGYHGVFAEENKLGQRFRVDLTASLDLSKAGQTDDLNETINY
FT                   AELYQICKSIVEGESVNLVETLTERIASQVLKDFLTVQECTVKVIKPDPPIPGHYQSVA
FT                   IEMTRSRA"
FT   gene            89255..89758
FT                   /locus_tag="BPUM_0063"
FT   CDS_pept        89255..89758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0063"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60763"
FT                   /db_xref="GOA:A8F946"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A8F946"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357376.1"
FT                   /protein_id="ABV60763.1"
FT                   /translation="MNNTAYIALGSNIGKKETYLKEAVKKLHEHPEVQVESISSIYETT
FT                   PVGYENQDDFLNMAVKISTSLRPNELLALTQKIEQELGRTREVRWGPRTADLDILLYNR
FT                   ENIETEQLVVPHPRMYERLFVLVPMSEICPEIGEVQINAVTDQEGVSIWKKTCGVEEFV
FT                   HTES"
FT   gene            89710..89943
FT                   /locus_tag="BPUM_0064"
FT   CDS_pept        89710..89943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0064"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60764"
FT                   /db_xref="GOA:A8F947"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8F947"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008341798.1"
FT                   /protein_id="ABV60764.1"
FT                   /translation="MEKDVWGRRIRAYRKLKGYTQEGFAKRLGISVSVLGEIERGNRLP
FT                   TNQLVGQIADALNITVEELSPNLEEERRGNDV"
FT   gene            89936..90937
FT                   /locus_tag="BPUM_0065"
FT   CDS_pept        89936..90937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0065"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60765"
FT                   /db_xref="GOA:A8F948"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A8F948"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008681.1"
FT                   /protein_id="ABV60765.1"
FT                   /translation="MFKIGDIDIKNKVVLAPMAGVCNSAFRLTVKEFGAGLVCAEMVSD
FT                   KAILINNARTMGMLYIDEREKPLSLQIFGGEKDTLVEAAKFVDQNTTADIIDINMGCPV
FT                   PKITKCDAGAKWLLDPNKIYEMVSAVVDAVDKPVTVKMRMGWDEDHIFAIDNARAVERA
FT                   GGQAVALHGRTRVQMYEGTANWDIIKEVKQSVSIPVIGNGDVKTPQDAKRMLDETGADA
FT                   VMIGRAALGNPWMIYRTVHYLETGELKEEPNVREKMSVCKLHLDRLIDLKGEHVAVREM
FT                   RKHAAWYLKGVRGNADVRNQINQSETRAELVQVLDDFTIEAEAKELQSIKVG"
FT   gene            91028..92527
FT                   /locus_tag="BPUM_0066"
FT   CDS_pept        91028..92527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0066"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60766"
FT                   /db_xref="GOA:A8F949"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A8F949"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496154.1"
FT                   /protein_id="ABV60766.1"
FT                   /translation="MSNEGLNNEELNDQFQVRRDKMNKMREEGIDPFGERYDRSHQSAQ
FT                   IIAEYDEFSKEDLEEKSAQVTIAGRMMTKRGKGKAGFAHIQDLEGQIQIYVRKDSVGEE
FT                   AYELFKSSDLGDIIGVTGTVFKTNVGELSIKATSFEVLTKALRPLPDKYHGLKDVEQRY
FT                   RQRYLDLIVNPESKQTFIMRSKIIQSMRRYLDSKGYLEVETPTMHSIPGGASARPFITH
FT                   HNALDMPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYA
FT                   DYKDIMNLTENLIAHIAEEVLGTTTIQYGEDEIDLKPEWKRLHMVEAVKEATGVDFWQE
FT                   MSVEEAQQHAADHGIEITKNMTVGHIINEFFEQKVEETLVQPTFIYGHPVEISPLAKKN
FT                   PEDPRFTDRFELFIVRREHANAFTELNDPIDQRERFEAQLKEREEGNDEAHLMDDDFVE
FT                   ALEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPQMRNR"
FT   gene            92636..93991
FT                   /locus_tag="BPUM_03795"
FT   CDS_pept        92636..93991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_03795"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_03795"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35530"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012011763.1"
FT                   /protein_id="ALS35530.1"
FT                   /translation="MLSKREEERRNQLEVVALDELVPEDHLVRKIEQAIDFDFIYDLVK
FT                   DHYSSDNGRPSVDPVVLIKMVLIQYLFGIRSMRQTIKEIETNVAYRWFIGYGFSEKIPH
FT                   FSTFGKNYVRRFHDTDLFEQIFYRILREAMKKGLVDPSIAFIDSTHVKANANKKKLEKK
FT                   IVRVETRSYQNQLHEEINIDREEHGKKPLPLQNKEETKEIKVSTTDPESGYYVKDEREK
FT                   SFAYSFHTACDSKGFILGSLVTGGNVHDSRMLDSLVSKVTEKVGKPNVVAVDAGYKTPY
FT                   IAKFLMDQEIRPVMPYTRPRTKAGYLKKNEYVYDAYFDCYICPNGQILSYRTTTREGYK
FT                   QYVSDSEVCESCSFLDNCTQSQNHTKQIHRHIWQDYLDEADNLRLTEINKSIYAKRKET
FT                   IERVFADAKEKHGMRWTKLRGLKKVSMQAMLTFAAMNLKKLANWTWKVPCPA"
FT   gene            94086..94196
FT                   /locus_tag="BPUM_0067"
FT   CDS_pept        94086..94196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60767"
FT                   /db_xref="UniProtKB/TrEMBL:A8F950"
FT                   /protein_id="ABV60767.1"
FT                   /translation="MALFIFHEMKLFLKKLLQGKNQDGILLFVAAKQQRG"
FT   gene            94401..95954
FT                   /locus_tag="BPUM_03800"
FT                   /old_locus_tag="BPUM_r0004"
FT   rRNA            94401..95954
FT                   /locus_tag="BPUM_03800"
FT                   /old_locus_tag="BPUM_r0004"
FT                   /product="16S ribosomal RNA"
FT   gene            96131..99065
FT                   /locus_tag="BPUM_03805"
FT                   /old_locus_tag="BPUM_r0005"
FT   rRNA            96131..99065
FT                   /locus_tag="BPUM_03805"
FT                   /old_locus_tag="BPUM_r0005"
FT                   /product="23S ribosomal RNA"
FT   gene            99125..99240
FT                   /locus_tag="BPUM_03810"
FT                   /old_locus_tag="BPUM_r0006"
FT   rRNA            99125..99240
FT                   /locus_tag="BPUM_03810"
FT                   /old_locus_tag="BPUM_r0006"
FT                   /product="5S ribosomal RNA"
FT   gene            99417..99881
FT                   /locus_tag="BPUM_0068"
FT   CDS_pept        99417..99881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0068"
FT                   /product="CtsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60768"
FT                   /db_xref="GOA:A8F951"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A8F951"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356472.1"
FT                   /protein_id="ABV60768.1"
FT                   /translation="MAQNISDIIEQYLKEVLDQNGREILEIKRNEIADKFQCVPSQINY
FT                   VINTRFTSERGYIVESKRGGGGYIRIIKVKMNDEVDLLNNIISQIYHRLSQAASDHIIM
FT                   RLVENNILSEREAKMMISVMDRSVLHIDLPERDELRARMMKAMLNALKLK"
FT   gene            99896..100453
FT                   /locus_tag="BPUM_0069"
FT   CDS_pept        99896..100453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60769"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A8F952"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496258.1"
FT                   /protein_id="ABV60769.2"
FT                   /translation="MICQECNERPATFHFTKVINGEKQEMHICEQCAKENSDSYAMSGN
FT                   QGFSIHNLLSGLLNIDPSFTTSANKGSSIFQEAREVDQCPKCGLTFQQFRKTGRFGCAE
FT                   CYRSFDQYLNPVLRKVHSGNTVHNGKVPKRIAGSLHVRRKLELMQQELKQLIEQEEFEK
FT                   AAEVRDQIRALEHEQSKQREGD"
FT   gene            100458..101549
FT                   /locus_tag="BPUM_0070"
FT   CDS_pept        100458..101549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0070"
FT                   /product="ATP--guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60770"
FT                   /db_xref="GOA:A8F953"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F953"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366451.1"
FT                   /protein_id="ABV60770.1"
FT                   /translation="MSLQHFIQDALSQWMKQKGPESDIVLSSRIRLARNLEHVRFPTQF
FT                   SQEEAQAVLQQFEQKFASQEVKDIGNFVLIRMNETQPLAKRVLVEKHLISPNLAESRFG
FT                   GCLLSENEEISVMLNEEDHIRIQCLFPGFQLANALKAANQIDDWIEEQVDYAFSEKRGY
FT                   LTSCPTNVGTGIRASVMMHLPALALTRQMNRIIPAINQLGLVVRGIYGEGSEAIGNIFQ
FT                   ISNQMTLGQSEEDIVDDLNSVTAQLIEQERSARKALYQTSKIELEDRVYRSLGILSNCR
FT                   MIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALEPNERDIK
FT                   RAAIIRERLRLEMHRNGQEDETI"
FT   gene            101546..103981
FT                   /locus_tag="BPUM_0071"
FT   CDS_pept        101546..103981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0071"
FT                   /product="Clp protease ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60771"
FT                   /db_xref="GOA:A8F954"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8F954"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496263.1"
FT                   /protein_id="ABV60771.1"
FT                   /translation="MMFGRFTERAQKVLALAQEEAIRLGHKNIGTEHILLGLVREGEGI
FT                   AAKALEALGLVSDKIQKEVESLIGRGQEVSQAIPHYTPRAKKVTELSMDEARKLGHSYV
FT                   GTEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNETGASAAGSNSNANTPT
FT                   LDSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIIHNEVPEILRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIQV
FT                   DQPSVDESIQILRGLRDRYEAHHRVSITDEAIEAAVKLSDRYISDRFLPDKAIDLIDEA
FT                   GSKVRLRSFTTPPNLKELEQKLDEVRKEKDAAVQSQEFEKAASLRDTEQRLREKVEVTK
FT                   KSWKEKQGQENSEVSVDDIAMVVSSWTGVPVSKIAQTETDKLLNMEQLLHSRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESIFGDEEAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEIEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTILIMTSNVGASELKRNKYVGFNVQDEGQNYKDMKGKVMGEL
FT                   KRAFRPEFINRIDEIIVFHSLEKKHLKEIVSLMSDQLTKRLKEQDLSIELTEAAKAKIA
FT                   DEGVDLEYGARPLRRAIQKHVEDRLSEELLKGNIEKGQQIVLDVEDGEIVVKTTAATN"
FT   gene            104075..105454
FT                   /locus_tag="BPUM_0072"
FT   CDS_pept        104075..105454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0072"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60772"
FT                   /db_xref="GOA:A8F955"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8F955"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359160.1"
FT                   /protein_id="ABV60772.2"
FT                   /translation="MAKTKSKFICQSCGYESAKWMGKCPGCGTWNSMTEEVVRKEPANR
FT                   RSAFNHSVQTIQKPSPISAIETSDEPRIKTNLEEFNRVLGSGIVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLSDKNQNVLYISGEESIKQTKLRADRLGIKSTSLHVLAETDMEYITSAI
FT                   QEMKPAFVVVDSIQTVYQSDITSAPGSVSQVRECTAQLMKIAKTNGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNELGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGVSGSCVVASMEGTRPVLVEIQALISPTSFGNPRRMATGLDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAIAVSIASSFKDAAPHQADCFIGEVGL
FT                   TGEVRRVSRIEQRVQEAAKLGFKRMFIPQANIDGWKKPRGIELVGVENVAEALRISLGG
FT                   S"
FT   gene            105457..106536
FT                   /locus_tag="BPUM_0073"
FT   CDS_pept        105457..106536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0073"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /note="non-specific DNA-binding; scans chromosomes during
FT                   sporulation for DNA-damage; delays initiation of
FT                   sporulation; participates in a checkpoint signaling cascade
FT                   for cell-cycle progression and DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60773"
FT                   /db_xref="GOA:A8F956"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F956"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216931.1"
FT                   /protein_id="ABV60773.1"
FT                   /translation="MEKEKKGARELDLLDIVQFVAPGTPLRAGIENVLRANTGGLIVVG
FT                   YNDKVKSVVDGGFHINSAFSPAHLYELAKMDGAIILSDSGQKILYANTQLMPDATIHSS
FT                   ETGMRHRTAERVAKQTGCLIIAISERRNVITLYQGNRRYTLKDIGFILTKANQAIQTLE
FT                   KYKTILDHAISALSALEFEELVTFGDVLSVLHRYEMVLRIKNEINMYIKELGTEGHLIR
FT                   LQVNELITDMEQEAALFIKDYVKEKIKDPYVLLKQLQDMSSFELLDDSILYKLLGYPAS
FT                   TNIDEYVYTRGYRLLHKIPRLPMPIVENVVEAFGVLDRIMEADVQDLDEVEGIGEVRAK
FT                   KIKKGLKRLQEKHYIDRQL"
FT   gene            106690..107790
FT                   /locus_tag="BPUM_0074"
FT   CDS_pept        106690..107790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60774"
FT                   /db_xref="GOA:A8F957"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8F957"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356484.1"
FT                   /protein_id="ABV60774.1"
FT                   /translation="MLKRIVQAFFIIFGAVVGIFIIPELFLLLNVKDIPFITNAYSSAL
FT                   IGAAVFLIIGKWCTGYVVNWVKWIEDSLLKAPLPDLISGSFGLVFGLILAYLIVNVIPL
FT                   NNIPYHIFGTIIPIFLAFFLGYLGFQVGFKKKDEMMGLFSRSAKVTKKKGAADDEPEIE
FT                   DKKLKILDTSVIIDGRIADICQTGFLEGVMVIPQFVLEELQHIADSSDVLKRNRGRRGL
FT                   DILNRIQKELDIKVEIYEGDFEDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQKVA
FT                   VLNINDLANAVKPVVLPGEEMKVQVIKDGKEHNQGVAYLDDGTMIVVEEGRNYIGKDID
FT                   VLVTSVLQTAAGRMIFAKPKLLEKAL"
FT   gene            107804..108493
FT                   /locus_tag="BPUM_0075"
FT   CDS_pept        107804..108493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0075"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60775"
FT                   /db_xref="GOA:A8F958"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F958"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217158.1"
FT                   /protein_id="ABV60775.1"
FT                   /translation="MYYEVVIPAAGQGKRMKAGRNKLFIELKRMPVIIHTLKVFDAHAQ
FT                   CKRMILAINEEERQDFERLLKVHAFQTPVSLVNGGEERQQSVYEGLKAVKDADIVLVHD
FT                   GARPFIKHTQIDLLVKAAIEKGSAVVAVPVKDTIKRVQEGKVEQTIERQSLWAVQTPQA
FT                   FRHSILKEAHEYAERTGFLGTDDASLVEQLHGENVYIVQGDYTNIKLTTPDDLLVAKAI
FT                   MDAERGY"
FT   gene            108497..108973
FT                   /locus_tag="BPUM_0076"
FT   CDS_pept        108497..108973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0076"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60776"
FT                   /db_xref="GOA:A8F959"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F959"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216928.1"
FT                   /protein_id="ABV60776.1"
FT                   /translation="MLRIGQGFDVHQLTEGRPLIIGGVTIPYEKGLLGHSDADVLLHTV
FT                   ADACLGAIAEGDIGRHFPDTDPEFKDADSFQLLQHVWALVKEKGYTLVNIDCTIMAQKP
FT                   KMAPYIQPMCEKIAEALEADVTQVNVKATTTEKLGFTGRGEGIASQATVLLQKK"
FT   gene            109068..110519
FT                   /locus_tag="BPUM_0077"
FT   CDS_pept        109068..110519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0077"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60777"
FT                   /db_xref="GOA:A8F960"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F960"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356490.1"
FT                   /protein_id="ABV60777.1"
FT                   /translation="MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIED
FT                   TDQKRNVEGGEESQLRHLQWLGIDWDESIDKDGGYGPYRQSERNDIYKKYYDELLEKDL
FT                   AYKCYCTAEELEEEREAQIARSEMPRYSGKCSHLSKEEEDKLIAEGREPSIRFRVPKGE
FT                   IIKFDDMVKGEISFETDGIGDFVIVKKDGTPTYNFAVAVDDHLMKMTHILRGEDHISNT
FT                   PKQIMIFNAFGWDVPLFGHMTLIVNENRKKLSKRDESIIQFIEQYKNLGYLPEALFNFI
FT                   ALLGWSPVGEEELFTKEQFIDIFDVNRLSKSPALFDMHKLKWVNNQYVKALDLDQVVAL
FT                   TLPHLQKAGKVSEQLSDEKNTWVRKLIALYHEQLSYGAEIVELTELFFKEQIEYNQEAK
FT                   EVLAEEQVPEVMASFAGQLERLESFTPDEIKAAIKAVQKETGHKGKKLFMPIRVAVTGQ
FT                   THGPELPQSIELLGKETVLNRIKQI"
FT   gene            110831..111484
FT                   /locus_tag="BPUM_0078"
FT   CDS_pept        110831..111484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0078"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60778"
FT                   /db_xref="GOA:A8F961"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F961"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F961.1"
FT                   /protein_id="ABV60778.1"
FT                   /translation="MFFKMLKEDIDTVFDQDPAARSYIEVVLTYSGLHAIWAHRIAHAF
FT                   YKRKLYFLARIISQVSRFFTGVEIHPAATIGRRFFIDHGMGVVIGETCEIGDNVTVFQG
FT                   VTLGGTGKEKGKRHPTILDDALIATGAKVLGSITVGKGAKIGAGSVVLKDVPDHSTVVG
FT                   IPGRVVVQNGKKINRDLNHQDLPDPISDRFKELEREMEKLKGELASLSRKEEQS"
FT   gene            111481..112881
FT                   /locus_tag="BPUM_0079"
FT   CDS_pept        111481..112881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0079"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60779"
FT                   /db_xref="GOA:A8F962"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F962"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496278.1"
FT                   /protein_id="ABV60779.1"
FT                   /translation="MTINIYNTLTRKKEEFVPLEPGKVKMYVCGPTVYNYIHIGNARPA
FT                   IVYDTVRKYLEYSGYDVNFVSNFTDVDDKLIKAANELGEDVPTIADRFIQAYFEDVSAL
FT                   GCKKADLHPRVTENMDDIIAFIETLIEKGYAYEADGDVYYSTRSFEGYGKLSHQSIDEL
FT                   KTGARIRVGEKKRDALDFALWKAAKNQEISWDSPWGEGRPGWHIECSAMVKKYLGDTID
FT                   IHAGGQDLTFPHHENEIAQSEALTGKPFAKYWMHNGYINIENEKMSKSLGNFVLVHDIV
FT                   KEQDPDVLRFFMLSVHYRHPINYSMDLLESTKSAFNRLKTSYANLHHRLESSTNITEDN
FT                   AKWLAKVEEQRATFISEMNDDFNTANAISVLFELAKQANYYMENDHTSEEVIKAFIGLF
FT                   QEITSVLGFSLEEKHTLEKEVEALIEQRNEARRNRDFALSDQIRDQLKSMNIVLEDTPQ
FT                   GTRWKRGE"
FT   gene            112885..113316
FT                   /locus_tag="BPUM_0080"
FT   CDS_pept        112885..113316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0080"
FT                   /product="ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60780"
FT                   /db_xref="GOA:A8F963"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A8F963"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496281.1"
FT                   /protein_id="ABV60780.1"
FT                   /translation="MLNFEKLKDGKQLNGLALAYMGDAIFEVYVRHHLLQTGATKPNEL
FT                   HKRASKIVSAKSQAAILFTLQQQGFFTEAEEAVLKRGRNAKSGTVPKNTDVQTYRYSTA
FT                   FEALMGYLFIDKQDERLEELISQAIEIGTSGRKTNESAT"
FT   gene            113300..114049
FT                   /locus_tag="BPUM_0081"
FT   CDS_pept        113300..114049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0081"
FT                   /product="RNA methyltransferase TrmH"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60781"
FT                   /db_xref="GOA:A8F964"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8F964"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359163.1"
FT                   /protein_id="ABV60781.1"
FT                   /translation="MSQQHDYVIGKNAVIETLKSDRELYKLWMAENTVKGQAQQVIELA
FT                   KKQNITIQYVPRKKLDQMVTGQHQGIVAQVAAYEYAELDDLYQIAEQRNEQPFFLILDE
FT                   IEDPHNLGSIMRTADAVGAHGIVIPKRRAVGLTTTVAKASTGAIEHIPVAKVTNLSRAL
FT                   DEMKERGIWVAGTDASAKQDYRQFDGTMPLALVIGSEGKGIGRLIKEKCDFLIKLPMAG
FT                   KVTSLNASVAASLLMYEVYRKRYPLGE"
FT   gene            114052..114564
FT                   /locus_tag="BPUM_0082"
FT   CDS_pept        114052..114564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60782"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A8F965"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216949.1"
FT                   /protein_id="ABV60782.1"
FT                   /translation="MDILLVDGYNMIGAWPRLQHLKENSFEEARDILIQNLAEYQAYTG
FT                   YRVIVVFDAHMVKGIEKKRINHRVEVIFTRENETADERIEKLAQDLNNIRTQIHVATSD
FT                   FTEQWAIFGQGALRKSARELLREIEVIERKIETRVKKITSDKPASKIELSEDVLKTFEK
FT                   WRRGNLE"
FT   gene            114628..115284
FT                   /locus_tag="BPUM_0083"
FT   CDS_pept        114628..115284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0083"
FT                   /product="RNA polymerase sigma-H factor"
FT                   /EC_number="2.7.7.6"
FT                   /note="DNA-dependent RNA polymerase catalyzes the
FT                   transcription of DNA into RNA using the four ribonucleoside
FT                   triphosphates as substrates"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60783"
FT                   /db_xref="GOA:A8F966"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A8F966"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014469614.1"
FT                   /protein_id="ABV60783.1"
FT                   /translation="MNLNNSKDKSIREQFCQLEDEQVIERVHVGDSDALDYLITKYRNF
FT                   VRAKARSYFLIGADREDIVQEGMIGLYKSIRDFREDKLTSFKAFAELCITRQIITAIKT
FT                   ATRQKHIPLNSYVSLDKPIYDEESDRTLLDVISGAKALNPEDLIISKEEFDDIEMKMGE
FT                   LLSELERKVLVLYLDGRSYQEISEDLNRHVKSIDNALQRVKRKLEKYLELREISL"
FT   gene            115361..115510
FT                   /gene="rpmGB"
FT                   /locus_tag="BPUM_0084"
FT   CDS_pept        115361..115510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmGB"
FT                   /locus_tag="BPUM_0084"
FT                   /product="ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60784"
FT                   /db_xref="GOA:A8F967"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F967"
FT                   /protein_id="ABV60784.1"
FT                   /translation="MRKKITLACKDCGSRNYTTMKSDASAAERLEVKKYCKTCNSHKTH
FT                   LETK"
FT   gene            115546..115722
FT                   /locus_tag="BPUM_0085"
FT   CDS_pept        115546..115722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0085"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60785"
FT                   /db_xref="GOA:A8F968"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A8F968"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216942.1"
FT                   /protein_id="ABV60785.1"
FT                   /translation="MRIISFLKSVGKEMKKVSWPKKNEMIRYTITVILTVVFFAIFFSF
FT                   LDIGISQLIELIH"
FT   gene            115893..116426
FT                   /locus_tag="BPUM_0086"
FT   CDS_pept        115893..116426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0086"
FT                   /product="antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60786"
FT                   /db_xref="GOA:A8F969"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8F969"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014469615.1"
FT                   /protein_id="ABV60786.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMQDKIFRVVVPEEEE
FT                   TDIKNGKKKVVKKKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTALLPG
FT                   EAETILKRMGLEERKTEIDFELKETVKVIDGPFANFTGSIEEIDYDKSKVKVFVNMFGR
FT                   ETPVELEFTQIDKL"
FT   gene            116589..117023
FT                   /locus_tag="BPUM_0087"
FT   CDS_pept        116589..117023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0087"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60787"
FT                   /db_xref="GOA:A8F970"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A8F970"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014462031.1"
FT                   /protein_id="ABV60787.2"
FT                   /translation="MCLVAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEF
FT                   NARTADQAGLIIPVEISVFEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATVK
FT                   RDKVREIAETKMPDLNAASVESAMRMVEGTARSMGIVIED"
FT   gene            117123..117821
FT                   /locus_tag="BPUM_0088"
FT   CDS_pept        117123..117821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0088"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60788"
FT                   /db_xref="GOA:A8F971"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F971"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217271.1"
FT                   /protein_id="ABV60788.1"
FT                   /translation="MAKKGKKYVEAAKLIERTKAYDVAEAVSLTKKANTAKFDATVEVA
FT                   FRLGVDPRKNDQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADYVGDSDYITKI
FT                   QQGWFEFDVIVATPDMMGEVGKIGRVLGPKGLMPNPKTGTVTFEVEKAINEIKAGKVEY
FT                   RVDKAGNIHAPIGKVSFEDEKLVENFATIYDTILKAKPAAAKGVYVKNVSVTSTMGPGV
FT                   KVDPSSFSAK"
FT   misc_feature    117880..118007
FT                   /note="BPUM_nc0001; ribosomal protein L10 leader"
FT   gene            118080..118580
FT                   /locus_tag="BPUM_0089"
FT   CDS_pept        118080..118580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0089"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60789"
FT                   /db_xref="GOA:A8F972"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F972"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F972.1"
FT                   /protein_id="ABV60789.1"
FT                   /translation="MSNAIDTKKVVVDEITSKFKDSMSTVIVDYRGLSVSEVTELRKQL
FT                   RDAGVEFKVYKNTLTRRAVEQVELTGLNDFLTGPNAIAFSNEDVIAPAKIINEFAKSHE
FT                   ALEIKAGVIEGNVATVEEVKALAELPSREGLLSMLLSVLQAPVRNLALATKAVADQKEE
FT                   QGA"
FT   gene            118622..118987
FT                   /gene="rplL"
FT                   /locus_tag="BPUM_0090"
FT   CDS_pept        118622..118987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BPUM_0090"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="present in two forms; L12 is normal, while L7 is
FT                   aminoacylated at the N-terminal serine; the only multicopy
FT                   ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
FT                   L12 dimers bind L10; critically important for translation
FT                   efficiency and fidelity; stimulates GTPase activity of
FT                   translation factors"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60790"
FT                   /db_xref="GOA:A8F973"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F973"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F973.1"
FT                   /protein_id="ABV60790.1"
FT                   /translation="MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAAAG
FT                   GAAAEEKTDFDLVLAGAGDQKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEA
FT                   EELKAKLEEVGASVEVK"
FT   gene            119085..119690
FT                   /locus_tag="BPUM_0091"
FT   CDS_pept        119085..119690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0091"
FT                   /product="16S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60791"
FT                   /db_xref="GOA:A8F974"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8F974"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008696.1"
FT                   /protein_id="ABV60791.1"
FT                   /translation="MSDHYYTEKPSVKSNKQTWDFTLRNRTFTFTSDSGVFSKKEVDFG
FT                   SRLLIEAFEEPDVDGDVLDVGCGYGPIGLSLANEMTSRTIHMIDVNERAVELSKENAKH
FT                   NRIDNVRIYQSDLFSNVHSSAAFASILTNPPIRAGKKVVHAIFDKSADHLLPEGELWVV
FT                   IQKKQGGPSAIEKLEQLFGEVEVVLKKKGYYIIKAKKV"
FT   gene            complement(119777..119926)
FT                   /locus_tag="BPUM_0092"
FT   CDS_pept        complement(119777..119926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60792"
FT                   /db_xref="UniProtKB/TrEMBL:A8F975"
FT                   /protein_id="ABV60792.1"
FT                   /translation="MRIICVKSISAFQMSVKKYFYKTKEKRVSKIRKPHPKTNTDFISF
FT                   PKYA"
FT   gene            119946..123527
FT                   /locus_tag="BPUM_0093"
FT   CDS_pept        119946..123527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0093"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60793"
FT                   /db_xref="GOA:A8F976"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F976"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F976.1"
FT                   /protein_id="ABV60793.2"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGDPKYPVAESKERDVTYSAPLRVKVRLINKETG
FT                   EVKDQDVFMGDFPIMTDTGTFIINGAERVIVSQLVRSPSVYFSGKVDKNGKKGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFSSDQEILDLIGENEYLRNTLE
FT                   KDNTENADKALLEIYERLRPGEPPTVENAKSLLDSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQKLAETLVDPETGEILAEKGQILDRRVLDKVLPYLENGIGFRKLYPNGGVVED
FT                   EVELQSIKIYAPSDQEGEQVINVIGNAYVEEAVKNITPSDIIASISYFFNLLHGVGDTD
FT                   DIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNTITPQQLINIRPVIASI
FT                   KEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGMEVRDVHYSHYGRMCPI
FT                   ETPEGPNIGLINSLSSFAKVNRFGFIETPYRRVDPETGKVTPRIDYLTADEEDNYVVAQ
FT                   ANALLADDGSFIDDNIIARFRGENTVVPRNRVDYMDVSPKQVVSAATACIPFLENDDSN
FT                   RALMGANMQRQAVPLMQPESPIVGTGMEYVSGKDSGAAVICRYPGVVERVEAKNIWVRR
FT                   YEDVDGQQVKGNLDKYSLLKFVRSNQGTCYNQRPIVSVGDEVVKGEILADGPSMEKGEL
FT                   ALGRNVMVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRD
FT                   IPNVGEDALRNLDERGIIRIGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKARE
FT                   VRDTSLRVPHGGGGIIHDVKVFNREDGDELPPGVNQLVRVYIVQKRKISEGDKMAGRHG
FT                   NKGVISKILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHMGMAARYLGIHIAS
FT                   PVFDGAREEDVWETLEEAGMSRDAKTVLYDGRTGEPFDNRVSVGIMYMIKLAHMVDDKL
FT                   HARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRV
FT                   KTYEAIVKGDNVPEPGVPESFKVLIKELQSLGMDVKILSGDEEEIEMRDLEDDEETKKA
FT                   DGLALSNDEDAADLAPVDLERDAVTKE"
FT   gene            123589..127188
FT                   /locus_tag="BPUM_0094"
FT   CDS_pept        123589..127188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0094"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60794"
FT                   /db_xref="GOA:A8F977"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F977"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003156441.1"
FT                   /protein_id="ABV60794.1"
FT                   /translation="MLDVNNFEYMNIGLASPDKIRSWSFGEVKKPETINYRTLKPEKDG
FT                   LFCERIFGPQKDWECHCGKYKRVRYKGVVCDRCGVEVTRAKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLVLDMSPRALEEVIYFASYVVTDPGNTPLEKKQLLSEKEFRAYLDKYG
FT                   NTFSAAMGAEAINKLLQDIDLVKEVDTLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNK
FT                   PSWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIV
FT                   QNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPHLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWD
FT                   VLESVIREHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVH
FT                   VPLSAEAQAEARILMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLERKGAIGEGMVFK
FT                   DTNEALLAYQNGYVHLHTRVAVAANSLKNVTFTDEQRSKLLITTVGKLIFNEILPESFP
FT                   YMNEPTKSNIEEKTPDRFFLEKGEDVKATIEKQEINAPFKKGILGKIIAEIFKRFHITE
FT                   TSKMLDRMKNLGFKYSTKAGITVGVSDIVVLDDKQKILEEAQAKVDNVMKQFRRGLITE
FT                   EERYERVISIWSSSKDVIQGKLMKSLDEVNPIYMMSDSGARGNASNFTQLAGMRGLMAN
FT                   PAGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVI
FT                   IRETDCGTDRGILAKSIREGNEIIEKLEERLIGRFARKPIVHPETGEVIVGENELIDED
FT                   KALEVVEAGIEEVWIRSAFTCNTPHGVCKRCYGRNLATGTDVEVGEAVGIIAAQSIGEP
FT                   GTQLTMRTFHTGGVAGDDITQGLPRIQELFEARNPKGQATISEIDGVVAEINDVRDKQQ
FT                   EIVVQGDVETRSYTAPYNARLKVVEGDKVTRGQVLTEGSIDPKELLKVTDMTAVQEYLL
FT                   HEVQKVYRMQGVEIGDKHVEVMVRQMLRKVRVADAGDTDVLPGTLLDVHQFTEANKKVL
FT                   FEGKRPATGRPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVI
FT                   IGKLVPAGTGMPNYRKVKPVSQVQPSDDMVPVE"
FT   gene            127334..127582
FT                   /locus_tag="BPUM_0095"
FT   CDS_pept        127334..127582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0095"
FT                   /product="50S ribosomal protein L7"
FT                   /note="in Bacillus subtilis this non-essential protein
FT                   associates with the ribosome"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60795"
FT                   /db_xref="GOA:A8F978"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F978"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356515.1"
FT                   /protein_id="ABV60795.1"
FT                   /translation="MSYDKVSQAQSIIIGTKQTVKALKRDSVKEIVVAKDADPALTASV
FT                   TKLAQEKGVDILVVDSMKKLGKACGIEVGAAAVAIML"
FT   gene            127695..128114
FT                   /locus_tag="BPUM_0096"
FT   CDS_pept        127695..128114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0096"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60796"
FT                   /db_xref="GOA:A8F979"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F979"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F979.1"
FT                   /protein_id="ABV60796.1"
FT                   /translation="MPTINQLIRKGRVSKVENSKSPALNKGYNSFKKEHTNVTSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVDGRMQGRSKYGTKRPKQSK"
FT   gene            128235..128705
FT                   /locus_tag="BPUM_0097"
FT   CDS_pept        128235..128705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0097"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60797"
FT                   /db_xref="GOA:A8F980"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F980"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_013054923.1"
FT                   /protein_id="ABV60797.1"
FT                   /translation="MPRKGPVAKRDVLPDPIYNSKLVSRLINKMMIDGKRGKSQTILYK
FT                   SFDIIKERTGNEAMEVFEQALKNIMPVLEVKARRVGGANYQVPVEVRPDRRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
FT   gene            128760..130838
FT                   /gene="fusA"
FT                   /locus_tag="BPUM_0098"
FT   CDS_pept        128760..130838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BPUM_0098"
FT                   /product="elongation factor G"
FT                   /note="EF-G; promotes GTP-dependent translocation of the
FT                   ribosome during translation; many organisms have multiple
FT                   copies of this gene"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60798"
FT                   /db_xref="GOA:A8F981"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F981"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A7Z0N4.1"
FT                   /protein_id="ABV60798.1"
FT                   /translation="MAREFSLDKTRNIGIMAHIDAGKTTTTERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGYRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKTGADFLYSVSTLRDRLQANAHAIQ
FT                   LPIGAEDQFEGIIDLVDNVAYFYEDDLGTRSDAQEIPAEYKDKAEELRNSLIEAVAELD
FT                   EELMEKYLEGEEITIPELKAAIRKGTLNVEFYPVLVGSAFKNKGVQLVLDAVLDYLPAP
FT                   TDVAAIKGILPDSNEEVVRESTDDAPFSALAFKVMTDPYVGKLTFFRVYSGTLASGSYV
FT                   KNSSKNKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTSTGDTLCDEKDTVILES
FT                   MEFPEPVIDVAIEPKSKADQDKMGIALAKLAEEDPTFRTQTNPETGQTIISGMGELHLD
FT                   IIVDRMKREFKVEANVGAPQVAYRETFRSGAKVEGKFVRQSGGRGQFGHVWIEFEPNEE
FT                   GAGFEFENAIVGGVVPREYIPAIQAGLEDSLENGVLAGFPLIDIKAKLFDGSYHDVDSN
FT                   EMAFKIAASMALKNAVSKCNPVLLEPMMKVEVVIPEEYMGDIMGDITSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFTMHMDHYEEVPKSISEEIIKKNKGE"
FT   gene            130957..132147
FT                   /gene="tuf"
FT                   /locus_tag="BPUM_0099"
FT   CDS_pept        130957..132147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BPUM_0099"
FT                   /product="elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /note="EF-Tu; promotes GTP-dependent binding of
FT                   aminoacyl-tRNA to the A-site of ribosomes during protein
FT                   biosynthesis; when the tRNA anticodon matches the mRNA
FT                   codon, GTP hydrolysis results; the inactive EF-Tu-GDP
FT                   leaves the ribosome and release of GDP is promoted by
FT                   elongation factor Ts; many prokaryotes have two copies of
FT                   the gene encoding EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60799"
FT                   /db_xref="GOA:A8F982"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F982"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F982.1"
FT                   /protein_id="ABV60799.1"
FT                   /translation="MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGTA
FT                   MAYDQIDGAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAI
FT                   LVVSAADGPMPQTREHILLSRNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSDYD
FT                   FPGDDVPVIKGSALKALEGDADYEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSI
FT                   TGRGTVATGRVERGQVKVGDEVEIIGLQEENGKTTVTGVEMFRKLLDYAEAGDNIGALL
FT                   RGVSREDIQRGQVLAKPGTITPHSRFKAEVYVLSKEEGGRHTPFFANYRPQFYFRTTDV
FT                   TGIVHLPEGTEMVMPGDNTEMEVELISTIAIEEGTRFSIREGGRTVGSGVVSSIIK"
FT   gene            132258..133217
FT                   /locus_tag="BPUM_0100"
FT   CDS_pept        132258..133217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0100"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60800"
FT                   /db_xref="GOA:A8F983"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F983"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217236.1"
FT                   /protein_id="ABV60800.1"
FT                   /translation="MAKTYLKKWLIGGVDQWIMIQEDHTSEAKPVLLFVHGGPGSAQIS
FT                   YINSFHEELNRDFTVVHWDQRGAGLSYQNNLPNTSMTIQQFIEDTIELTEKILSYLGQS
FT                   KLYIAGYSWGSLIAIQAVHKRPDLYHAYYGISQVVDVLKEDIVSYDLLLKKYHRNRLFA
FT                   WCLRLLTPPPWKRLSAHALFSLYKELGSVGLTHKWKPLLQMLHSFIFSKEYQLKDKWKF
FT                   LKGQKFSQDMLWDELMNESIEYRVSTILIPCYFIIGEYDMITPAAVSKPYVEQLKAPIK
FT                   EWFTFKESAHSPHLEEPEEFIRTIKKTAVHHLQGKLDL"
FT   gene            133436..133744
FT                   /locus_tag="BPUM_0101"
FT   CDS_pept        133436..133744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0101"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60801"
FT                   /db_xref="GOA:A8F984"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F984"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015253287.1"
FT                   /protein_id="ABV60801.1"
FT                   /translation="MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTE
FT                   KSVYTILRAVHKYKDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGVDIEIKL"
FT   gene            133782..134411
FT                   /locus_tag="BPUM_0102"
FT   CDS_pept        133782..134411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0102"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60802"
FT                   /db_xref="GOA:A8F985"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F985"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F985.1"
FT                   /protein_id="ABV60802.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGDLIPVTVVEAAANVVLQKKTTDTDG
FT                   YEAIQIGFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGAELDAYEVGQEVKVDIFAN
FT                   GDIVDVTGTSKGKGFQGAIKRHGQSRGPMTHGSRYHRRPGSMGPVDPNRVFKGKLLPGR
FT                   MGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLVTVKSAVKSK"
FT   gene            134439..135062
FT                   /locus_tag="BPUM_0103"
FT   CDS_pept        134439..135062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0103"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60803"
FT                   /db_xref="GOA:A8F986"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F986"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496312.1"
FT                   /protein_id="ABV60803.1"
FT                   /translation="MPKVALFNQNGSTNGEIELNASVFGIEPNESVVFDAILMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGIVFGPTPRSYSYKLPKK
FT                   VRRLAIKSVLSSKVIDNNIIVLEDLTLDAVKTKEFAGILKGLSVEKKALIVTADANETV
FT                   ALSARNIPGVTVVEANGINVLDVVNHEKLLITKAAVEKVEEGLA"
FT   gene            135062..135349
FT                   /locus_tag="BPUM_0104"
FT   CDS_pept        135062..135349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0104"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60804"
FT                   /db_xref="GOA:A8F987"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F987"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006640319.1"
FT                   /protein_id="ABV60804.1"
FT                   /translation="MKDPRDVLKRPIITERSADLMTEKKYTFEVDVRANKTEVKDAVEE
FT                   IFGVKVEKVNVQNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIFEA"
FT   gene            135378..136211
FT                   /gene="rplB"
FT                   /locus_tag="BPUM_0105"
FT   CDS_pept        135378..136211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BPUM_0105"
FT                   /product="50S ribosomal protein L2"
FT                   /note="one of the primary rRNA-binding proteins; required
FT                   for association of the 30S and 50S subunits to form the 70S
FT                   ribosome, for tRNA binding and peptide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60805"
FT                   /db_xref="GOA:A8F988"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F988"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_014469619.1"
FT                   /protein_id="ABV60805.1"
FT                   /translation="MAIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHRKGGRNN
FT                   QGRLTVRHQGGGHKRQYRIIDFKRDKDGIPGRVATIEYDPNRSANIALVNYADGEKRYI
FT                   LAPKGIQVGTEVTSGPEADIKPGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLNSGEVRMILSACRATIGQVGNEQHELINIGKAGRSRWKGVRPTVRG
FT                   SVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLGFKTRKKTNKSDKFIVRRRKNK"
FT   gene            136269..136547
FT                   /locus_tag="BPUM_0106"
FT   CDS_pept        136269..136547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0106"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60806"
FT                   /db_xref="GOA:A8F989"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F989"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017551218.1"
FT                   /protein_id="ABV60806.1"
FT                   /translation="MARSLKKGPFVDDHLMAKVEKLNETDKKQVVKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVFISEDMVGHKLGEFAPSRTYKGHASDDKKTRR"
FT   gene            136565..136906
FT                   /locus_tag="BPUM_0107"
FT   CDS_pept        136565..136906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0107"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60807"
FT                   /db_xref="GOA:A8F990"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F990"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020449862.1"
FT                   /protein_id="ABV60807.1"
FT                   /translation="MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPKAASP
FT                   IIEKVLKSAIANAEHNYELDANSLVITQAFVDEGPTLKRFRPRAMGRASAINKRTSHIT
FT                   IVVSEKKEG"
FT   gene            136910..137566
FT                   /locus_tag="BPUM_0108"
FT   CDS_pept        136910..137566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0108"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60808"
FT                   /db_xref="GOA:A8F991"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F991"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015591964.1"
FT                   /protein_id="ABV60808.1"
FT                   /translation="MGQKVNPVGLRIGVIRDWESKWFAGKDYADFLHEDLKIREFISKR
FT                   LSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILE
FT                   IKRADLDAQLVAENIARQLENRISFRRAQKQTIQRTMRAGAQGIKTMVSGRLGGADIAR
FT                   SEYYSEGTVPLHTLRADIDYATAEADTTYGKLGVKVWIYRGEVLPTKKNTAEGGK"
FT   gene            137568..138002
FT                   /locus_tag="BPUM_0109"
FT   CDS_pept        137568..138002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0109"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60809"
FT                   /db_xref="GOA:A8F992"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F992"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P14577.2"
FT                   /protein_id="ABV60809.1"
FT                   /translation="MLLPKRVKYRREHRGKMRGRAKGGTEVHFGEYGIQALEASWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKVLF
FT                   EISGVSEEVAREALRLASHKLPIKTKFVKREEIGGESNES"
FT   gene            137992..138192
FT                   /locus_tag="BPUM_0110"
FT   CDS_pept        137992..138192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0110"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60810"
FT                   /db_xref="GOA:A8F993"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A8F993"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P12873.1"
FT                   /protein_id="ABV60810.2"
FT                   /translation="MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIRE
FT                   VRKSIARMKTVIRQREIAANK"
FT   gene            138218..138481
FT                   /locus_tag="BPUM_0111"
FT   CDS_pept        138218..138481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0111"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60811"
FT                   /db_xref="GOA:A8F994"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F994"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A7GK29.1"
FT                   /protein_id="ABV60811.1"
FT                   /translation="MSERNQRKVYQGRVVSDKMDKTITVVVETYKKHSLYGKRVRYSKK
FT                   LKAHDENNQAKIGDIVKVMETRPLSATKRFRLVEVVEEAVII"
FT   gene            138521..138889
FT                   /locus_tag="BPUM_0112"
FT   CDS_pept        138521..138889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0112"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60812"
FT                   /db_xref="GOA:A8F995"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F995"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002460061.1"
FT                   /protein_id="ABV60812.1"
FT                   /translation="MIQQETRLKVADNSGAREVLTIKVLGGSGRKTANIGDVIVCTVKQ
FT                   ATPGGVVKKGEVVKAVIVRTKSGARRNDGSYISFDENACVIIRDDKSPRGTRIFGPVAR
FT                   ELRDNNYMKIVSLAPEVL"
FT   gene            138925..139236
FT                   /locus_tag="BPUM_0113"
FT   CDS_pept        138925..139236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0113"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60813"
FT                   /db_xref="GOA:A8F996"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F996"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356538.1"
FT                   /protein_id="ABV60813.1"
FT                   /translation="MHVKKGDKVVVISGKDKGKQGVILAAFPKNDRVLVEGINLVKKHS
FT                   KPTQANPQGGISEQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVLDK"
FT   gene            139262..139801
FT                   /locus_tag="BPUM_0114"
FT   CDS_pept        139262..139801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0114"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60814"
FT                   /db_xref="GOA:A8F997"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F997"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017434009.1"
FT                   /protein_id="ABV60814.1"
FT                   /translation="MNRLKEKYVKEITPALVSKFEYKSVMQVPKIEKIVINMGVGDAVQ
FT                   NAKAIDTAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLDKLI
FT                   SVSLPRVRDFRGISKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRGMDIVIVTTANTD
FT                   EEARELLTQVGMPFQK"
FT   gene            139824..140009
FT                   /gene="rpsN"
FT                   /locus_tag="BPUM_0115"
FT   CDS_pept        139824..140009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BPUM_0115"
FT                   /product="30S ribosomal protein S14"
FT                   /note="located in the peptidyl transferase center and
FT                   involved in assembly of 30S ribosome subunit; similar to
FT                   what is observed with proteins L31 and L33, some proteins
FT                   in this family contain CXXC motifs that are involved in
FT                   zinc binding; if two copies are present in a genome, then
FT                   the duplicated copy appears to have lost the zinc-binding
FT                   motif and is instead regulated by zinc; the proteins in
FT                   this group appear to contain the zinc-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60815"
FT                   /db_xref="GOA:A8F998"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F998"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010529000.1"
FT                   /protein_id="ABV60815.1"
FT                   /translation="MAKKSMIAKQQRKQKFKVQEYTRCERCGRPHSVIRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            140041..140439
FT                   /locus_tag="BPUM_0116"
FT   CDS_pept        140041..140439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0116"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60816"
FT                   /db_xref="GOA:A8F999"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F999"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P12879.4"
FT                   /protein_id="ABV60816.1"
FT                   /translation="MVMTDPIADLLTRIRNANMVRHEKLEVPASKIKREIAEILKREGF
FT                   IRDVEYVEDSKQGIIRMFLKYGQNNERVITGLKRISKPGLRVYAKSNEVPRVLNGLGIA
FT                   IISTSQGVLSDKEARAKQAGGEVLAYVW"
FT   gene            140471..141007
FT                   /locus_tag="BPUM_0117"
FT   CDS_pept        140471..141007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0117"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60817"
FT                   /db_xref="GOA:A8F9A0"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9A0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356543.1"
FT                   /protein_id="ABV60817.2"
FT                   /translation="MSRIGKKLIEIPSGVTVTNNDNTVTVKGPKGELTRTFHPDMEIKI
FT                   EDSVLTVSRPSDHKEHRALHGTTRSLIANMVEGVSKGFERGLELIGVGYRAAKSGNKLV
FT                   LNVGYSHPVEIVPEAGVEVEVPSQTKVVIKGIDKERVGALASNIRAVRSPEPYKGKGIR
FT                   YEGEFVRRKEGKTGK"
FT   gene            141040..141402
FT                   /locus_tag="BPUM_0118"
FT   CDS_pept        141040..141402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0118"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60818"
FT                   /db_xref="GOA:A8F9A1"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P46899.1"
FT                   /protein_id="ABV60818.1"
FT                   /translation="MITKTSKNATRLKRHARVRAKLSGTAERPRLNVFRSNKNIYAQVI
FT                   DDVNGVTLVSASTLDKDLKIENSSDAAAATKVGELVAKRAVEKGISNVVFDRGGYLYHG
FT                   RVKALAEAAREAGLKF"
FT   gene            141427..141927
FT                   /locus_tag="BPUM_0119"
FT   CDS_pept        141427..141927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0119"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60819"
FT                   /db_xref="GOA:A8F9A2"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F9A2.1"
FT                   /protein_id="ABV60819.1"
FT                   /translation="MSRIDQSKLELEERLVTVNRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPEAIRKAVEDAKKNLIEVPMVGTTIPHEIIGRFGAGNVLLKPASEGTG
FT                   VIAGGPVRAVLELAGLADILSKSLGSNTPINMIRATLQGLSELKRAEDVAKLRGKSVED
FT                   LLG"
FT   gene            141941..142123
FT                   /locus_tag="BPUM_0120"
FT   CDS_pept        141941..142123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0120"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60820"
FT                   /db_xref="GOA:A8F9A3"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_006640333.1"
FT                   /protein_id="ABV60820.1"
FT                   /translation="MANKLEITLKRSVIGRPEDQRVTVRTLGLKKTNQTVVHEDNAAIR
FT                   GMINKVSHLVSVKEQ"
FT   gene            142154..142594
FT                   /locus_tag="BPUM_0121"
FT   CDS_pept        142154..142594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0121"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60821"
FT                   /db_xref="GOA:A8F9A4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216888.1"
FT                   /protein_id="ABV60821.1"
FT                   /translation="MKLHELKPSEGSRKERNRVGRGIGSGNGKTSGKGHKGQNARSGGG
FT                   VRPGFEGGQMPLFQRLPKRGFTNINRKDYAVINLDRLNSFDEGTEVTPELLLETGAISK
FT                   LKAGVKILGNGKLEKKLTVKANKFSASAKEAIEAAGGTAEVI"
FT   gene            142596..143888
FT                   /locus_tag="BPUM_0122"
FT   CDS_pept        142596..143888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0122"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60822"
FT                   /db_xref="GOA:A8F9A5"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9A5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496334.1"
FT                   /protein_id="ABV60822.1"
FT                   /translation="MFKTISNFMRVKDIRNKIIFTLLMLIVFRIGAFIPVPNVNAEVLQ
FT                   AQDQMSVFGILNTFGGGALFQFSILAMGIMPYITASIIIQLLQMDVVPKFTEWSKQGEV
FT                   GRRKLAQFTRYFTIVLGFIQALGMSYGFNNMAGGMLIENPGVSTYLLIAVVLTAGTAFL
FT                   MWLGEQITAHGVGNGISIIIFAGIIAGIPQTLKQVYAQQFVGGDGQLFMQILKIALIVI
FT                   AILVIVIGVIYIQMAVRKIAIQYSKGTGRAQMSASQATHLPLKVNPAGVIPVIFAVSFI
FT                   ITPQTVASFFGTNNVTTWITNNFDYTKPIGMTIYVALIVAFTYFYAFVQVNPEQMAENL
FT                   QKQGGYIPGVRPGKMTQDRITSILYRLTFVGAIFLAVISILPIFFIQFAGLPSAAQIGG
FT                   TSLLIVVGVALETMKQLESQLVKRNYRGFMK"
FT   gene            143944..144597
FT                   /locus_tag="BPUM_0123"
FT   CDS_pept        143944..144597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0123"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60823"
FT                   /db_xref="GOA:A8F9A6"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356547.1"
FT                   /protein_id="ABV60823.1"
FT                   /translation="MNLVLMGLPGAGKGTQAERIVDDYGIPHISTGDMFRAAMKEETQL
FT                   GLEAKSFIDKGELVPDEVTIGIVRERLGKNDCEQGFLLDGFPRTVAQAEALEDILKDLG
FT                   RTIDYVINIKVDKDALMERLTGRRICKNCGATYHLVFNPPAKENVCDKCGGELYQRADD
FT                   NAETVSTRLEVNLKQTEPLLNFYSEKGYLANIDGAKHINDVYADIKDLLGGLNK"
FT   gene            144594..145340
FT                   /locus_tag="BPUM_0124"
FT   CDS_pept        144594..145340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0124"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60824"
FT                   /db_xref="GOA:A8F9A7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9A7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359166.1"
FT                   /protein_id="ABV60824.1"
FT                   /translation="MIICKTPRELEIMREAGRIVALTHEKLKKHIKPGISTKELDQIAE
FT                   RFITKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGKRVLRDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGVISDEDRKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENENFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITDTGFDILTKI"
FT   gene            145431..145634
FT                   /locus_tag="BPUM_0125"
FT   CDS_pept        145431..145634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2ITL5"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ALS35531.1"
FT                   /translation="MFGGCHVLIADGEKRKFHSPKKKYQSYNLLWLRISGSSEQYIQNR
FT                   SGDGWTIEMNSFGHLSESKLLI"
FT   gene            145653..145871
FT                   /gene="infA"
FT                   /locus_tag="BPUM_0126"
FT   CDS_pept        145653..145871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BPUM_0126"
FT                   /product="translation initiation factor IF-1"
FT                   /note="stimulates the activities of the other two
FT                   initiation factors, IF-2 and IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60825"
FT                   /db_xref="GOA:A8F9A8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017381498.1"
FT                   /protein_id="ABV60825.1"
FT                   /translation="MAKDDVIEVEGTVAETLPNAMFKVELENGHTVLAHVSGKIRMHFI
FT                   RILPGDKVTVELSPYDLTRGRITYRYK"
FT   gene            145903..146016
FT                   /gene="rpmJ"
FT                   /locus_tag="BPUM_0127"
FT   CDS_pept        145903..146016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BPUM_0127"
FT                   /product="50S ribosomal protein L36"
FT                   /note="smallest protein in the large subunit; similar to
FT                   what is found with protein L31 and L33 several bacterial
FT                   genomes contain paralogs which may be regulated by zinc;
FT                   the protein from Thermus thermophilus has a zinc-binding
FT                   motif and contains a bound zinc ion; the proteins in this
FT                   group have the motif"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60826"
FT                   /db_xref="GOA:A8F9A9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9A9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P66291.1"
FT                   /protein_id="ABV60826.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG"
FT   gene            146038..146403
FT                   /locus_tag="BPUM_0128"
FT   CDS_pept        146038..146403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0128"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60827"
FT                   /db_xref="GOA:A8F9B0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A9VPA2.1"
FT                   /protein_id="ABV60827.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAQQVLKEAGVSEDTRV
FT                   RDLTEDELGKIRDIIDKLKVEGDLRREVSLNIKRLIEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            146424..146819
FT                   /locus_tag="BPUM_0129"
FT   CDS_pept        146424..146819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0129"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60828"
FT                   /db_xref="GOA:A8F9B1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015482709.1"
FT                   /protein_id="ABV60828.1"
FT                   /translation="MAAARKQNTRKRRVKKNIEAGIAHIRSTFNNTIVTITDVHGNAIS
FT                   WSSAGALGFRGSRKSTPFAAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQA
FT                   AGLEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            146995..147939
FT                   /locus_tag="BPUM_0130"
FT   CDS_pept        146995..147939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0130"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60829"
FT                   /db_xref="GOA:A8F9B2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:Q65P79.1"
FT                   /protein_id="ABV60829.1"
FT                   /translation="MIEIEKPKIETVEISDDAKYGKFVVEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTSIQIDGVLHEFSTIEGVVEDVTTIILNIKKLALKIYSEEEKTLEIDVQDE
FT                   GTVTAADITHDSDIEILNPDLHIATLGKNASFRVRLTAQRGRGYNPADANKRDDQPIGV
FT                   IPIDSIYTPVSRVTYQVENTRVGQITNYDKLTLDVWTDGSTGPKEAIALGSKILTEHLN
FT                   IFVGLTDEAQHAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKAKLEELGLGLRKDD"
FT   gene            148016..148378
FT                   /locus_tag="BPUM_0131"
FT   CDS_pept        148016..148378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0131"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60830"
FT                   /db_xref="GOA:A8F9B3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010285110.1"
FT                   /protein_id="ABV60830.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAYIRNEVANAETNQDALQKLFADVATRYEDRQGGYTRIMKL
FT                   GPRRGDGAPMAVIELV"
FT   gene            148503..149345
FT                   /gene="cbiO"
FT                   /locus_tag="BPUM_0132"
FT   CDS_pept        148503..149345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="BPUM_0132"
FT                   /product="energy-coupling factor transporter ATPase"
FT                   /note="with CbiNQ forms the ABC transporter for cobalt
FT                   import; Bacillus spp. have two adjacent copies of this
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60831"
FT                   /db_xref="GOA:A8F9B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9B4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008713.1"
FT                   /protein_id="ABV60831.1"
FT                   /translation="MGKTLIDVKDIVFRYHKDAEKPALDQVSLHVNQNEWLAIVGHNGS
FT                   GKSTLARVLNGLILPDAGTVKVGEIELKEESVWDIRKKVGMVFQNPDNQFVGSTVRDDV
FT                   AFGLENNGVERELMIERVDWAVKQVNMQEFLDQEPHHLSGGQKQRVAIAGVLAASPDIM
FT                   ILDEATSMLDPIGREEVLETVRLLKEQGTVTVISITHDLDEAAKADRVIVMNGGKKFAE
FT                   GTPEEVFELDEQLVQIGLDLPFSYRLSKQLKQQGVPLANAHLTQEGLVKELWTLRSKN"
FT   gene            149321..150190
FT                   /gene="cbiO"
FT                   /locus_tag="BPUM_0133"
FT   CDS_pept        149321..150190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="BPUM_0133"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /note="with CbiNQ forms the ABC transporter for cobalt
FT                   import; Bacillus spp. have two adjacent copies of this
FT                   gene"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60832"
FT                   /db_xref="GOA:A8F9B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9B5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008714.1"
FT                   /protein_id="ABV60832.1"
FT                   /translation="MDITIKELEHRYQMKTPFERLALYDVNASIQEGSYVAVIGHTGSG
FT                   KSTLLQHLNGLLKPTKGSIALGDTVLQANKKQKDLKSLRKKVGIVFQFPEHQLFEETIL
FT                   KDICFGPMNFGVPQQKAEAKAKEMLKLVGLPESLLSRSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPRGRKEIMDMFYELHQKANLTTILVTHSMEDAAHYADQMIVMHKG
FT                   TVKATGTPRELFANRTDMSSFGLDLPETIKFQQTVEEELGITFPRPLLTMDEMAEALTA
FT                   LYQEDTTS"
FT   gene            150187..150984
FT                   /locus_tag="BPUM_0134"
FT   CDS_pept        150187..150984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0134"
FT                   /product="cobalt ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60833"
FT                   /db_xref="GOA:A8F9B6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9B6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008715.1"
FT                   /protein_id="ABV60833.1"
FT                   /translation="MMDSMIIGKYVPGTSFVHRLDPRTKLLSIFFFVFIVFFANNYITY
FT                   GLLGIFTLLVVMVSQVPLYFILKGMKPILWIVLFTFILHIFMTKDGALLFHFGFLNIYE
FT                   EGLKQGIFISLRFVYLIMMTTLLTLTTTPIEVTDGMEKLLHPFRKIKLPVHELALMMSI
FT                   SLRFIPTLLEETDKIMKAQMARGVDFTSGPLKDRMKAIVPLLVPLFVSAFKRAEELATA
FT                   MEARGYRGGEGRTKYRQLVWGMKDTFTLLLFILLTALLVLLRN"
FT   gene            150996..151739
FT                   /locus_tag="BPUM_0135"
FT   CDS_pept        150996..151739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0135"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60834"
FT                   /db_xref="GOA:A8F9B7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F9B7.1"
FT                   /protein_id="ABV60834.1"
FT                   /translation="MKVKCTVSYDGTHFKGYQVQPGQRTVQTEIESALAKMHKQDELVP
FT                   IVASGRTDSGVHAKGQVIHFDTPLSIPMERWPFALNSLLPDDIRVLKAEEVDESFHARF
FT                   SVVSKEYRYKVSTETHQNVFTRQYACHFPYRLDADKMREAAGYLIGTHDFTSFCAANTE
FT                   VQDKVREIYTLEWKNVSDGLEMRVRGNGFLYNMVRIIAGTLLEVGSGKFHPDEIKAMLA
FT                   ARNREAAGKTAPSHGLYLWEVFYDN"
FT   misc_feature    151794..151855
FT                   /note="BPUM_nc0002; ribosomal protein L13 leader"
FT   gene            151906..152343
FT                   /locus_tag="BPUM_0136"
FT   CDS_pept        151906..152343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0136"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60835"
FT                   /db_xref="GOA:A8F9B8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_015382596.1"
FT                   /protein_id="ABV60835.1"
FT                   /translation="MRTTPMANASTIERKWLVVDAAGKTLGRLSTEVASLLRGKHKPTY
FT                   TPHVDTGDHVIIINAEKIELTGKKLTDKIYYRHTMHPGGLKQRTALEMRTNYPEKMLEL
FT                   AIKGMLPKGPLGRQMFKKLNVYRGSEHPHQAQQPEVYELRG"
FT   gene            152364..152756
FT                   /locus_tag="BPUM_0137"
FT   CDS_pept        152364..152756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0137"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60836"
FT                   /db_xref="GOA:A8F9B9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9B9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A7Z0S2.1"
FT                   /protein_id="ABV60836.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRIVVNNREITEYIPFAALI
FT                   EDVKQPLNITETANSYDVLVTVHGGGFSGQAGAIRHGISRALLEVDPEYRTSLKRAGLL
FT                   TRDPRMKERKKYGLKGARRAPQFSKR"
FT   gene            152949..153464
FT                   /locus_tag="BPUM_0138"
FT   CDS_pept        152949..153464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0138"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60837"
FT                   /db_xref="GOA:A8F9C0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008717.1"
FT                   /protein_id="ABV60837.1"
FT                   /translation="MNLTTERCLIRPFTDDDWQDVYAYTSDPVVMKYIPEDVFSKEDAK
FT                   DFVKNNRHEDAKYVAVLLKEDQTCIGHISFHPYFGDHTYEIGWVFNPAYQNKGYASEAA
FT                   YAVLHHGFRTMNLHRIIATCQPENVPSWRLMEKMGMRREGYFKKCIPQENEWWDEFYYA
FT                   ILREEWKA"
FT   gene            153562..154308
FT                   /locus_tag="BPUM_0139"
FT   CDS_pept        153562..154308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0139"
FT                   /product="2-pyrone-4,6-dicarboxylate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60838"
FT                   /db_xref="GOA:A8F9C1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217156.1"
FT                   /protein_id="ABV60838.1"
FT                   /translation="MRIFDAHFHIIDFNFPIQENQGYIPPSYDVNDYKRETADLGIVGG
FT                   AIVSGSFQGFDQGYLLKALDELGPGFCGVTQLPFTATDDEIVHLDQHGVKALRFNVKRG
FT                   GSEDISKLDYFARRVYELAGWHSELYIDAKHLPEISSMLEKLPAISIDHLGLSEEGLPH
FT                   LLKLVDKGVRVKATGFGRVDLNVEHALTSIYQTNPDALMFGTDLPSTRAKRPFEYGDVE
FT                   LVQQLFDEKAADHILYKNAHQWYFGQ"
FT   gene            154328..154801
FT                   /locus_tag="BPUM_0140"
FT   CDS_pept        154328..154801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0140"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60839"
FT                   /db_xref="GOA:A8F9C2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008719.1"
FT                   /protein_id="ABV60839.1"
FT                   /translation="MGFSQLTFREAKLDDLDKIVFMLADDMLGQKRERYTQPLLESYIE
FT                   AFQSIDADPNIELIVACDQEEAVGVLQLTMTPFLTHQGGWRALIEGVRTALTHRGKGIG
FT                   TMLIKRAIQHASDRGCHMIQLTTDKQRPDARRFYEKLGFEATHDGMKLQLPHE"
FT   gene            154892..155908
FT                   /locus_tag="BPUM_0141"
FT   CDS_pept        154892..155908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0141"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60840"
FT                   /db_xref="GOA:A8F9C3"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008720.1"
FT                   /protein_id="ABV60840.1"
FT                   /translation="MGKEIYLNKTKEDLLTFVMKNKKDISATMIENEDVVLDWNGDQET
FT                   PLASTVKLMVLFHFVKTVSSGDTKLDEKVALSDIERFYIDRTDGGAHTYWLEVNDFSEH
FT                   ATLLDVAKGMMQFSSNACTDYLIDRLGLDKINNQMKQEGLTEHDEVMPLTPKLLWPAYI
FT                   SDHERDAFKQMSDVTDEQYKSLIIDIFNIMKNDPEHKKALEEKLMKKDLLSLRIQSLLT
FT                   QKMTRSTTNQYAHFMKRLQDELLTTEEKSLFSQIVLGETLKTEKDQYIWYKSGATLFVF
FT                   TAALYRKTDTSSISISLFINDTKANNSHWIEEVFNEFMLTAAGDQNFRQRLIQAFTK"
FT   gene            complement(155945..156514)
FT                   /locus_tag="BPUM_0142"
FT   CDS_pept        complement(155945..156514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0142"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60841"
FT                   /db_xref="InterPro:IPR032250"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008721.1"
FT                   /protein_id="ABV60841.1"
FT                   /translation="MKKWIYILLLLTVVLSGCGSQATEQKSDIKGIEDISLKQLSKHKS
FT                   SYIGDNGAIGAILSDLPGNVIREYEIVDEKELKVTYGVKENANDTEEQFDAYWFDQKNT
FT                   IEKTYLYNAFAFFILVDNVEQVTLKMSSNNEPAVTFNRQQLEKKLPHSFKEYQDNVELW
FT                   QKELVDGVVKSKEKRQDVYRVFPMQK"
FT   gene            156661..157104
FT                   /locus_tag="BPUM_0143"
FT   CDS_pept        156661..157104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0143"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60842"
FT                   /db_xref="GOA:A8F9C5"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008356567.1"
FT                   /protein_id="ABV60842.1"
FT                   /translation="MAEVLSFYQLKTKRDVTLEKKLLRTLSLQQVTDASEKFTKKLFPF
FT                   ADDPAGIMSDGCIDFAIEAFLAGGRYGESSKYGESFDDIKKRSVHEENELVEELAGCLQ
FT                   SWGNMFRMERKMSCLYPFAKDFLSMWWQEGFRESEKRHKLRLH"
FT   gene            157163..157876
FT                   /locus_tag="BPUM_0144"
FT   CDS_pept        157163..157876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0144"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60843"
FT                   /db_xref="GOA:A8F9C6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359175.1"
FT                   /protein_id="ABV60843.1"
FT                   /translation="MKRKLKWTGFLIGFIVLLFLFRFQFLNDDSWKSWNLPLSGKIIYL
FT                   DPGHGGPDGGAVGGELLEKEIALDVSMKIRDYLQEQGALVLMTREDDSDLSSKNTKGYA
FT                   RKKAEDLRNRVKAINESEADFYLSIHLNAIPSNKWSGAQTFFYGKYEENEKAAKFIQDE
FT                   LRNNLENTDRKAKRINGIYLMQNVTKPGALVEIGFLSNPKEASQLATPKYQDQIAASIY
FT                   KGILRYLTEQKEPPE"
FT   gene            157980..159038
FT                   /locus_tag="BPUM_0145"
FT   CDS_pept        157980..159038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0145"
FT                   /product="chromosome partitioning protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60844"
FT                   /db_xref="GOA:A8F9C7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217013.1"
FT                   /protein_id="ABV60844.1"
FT                   /translation="MIGQDDVRKLVGKMDEPFLHIPLGELDAIKEISLKPEKEHVSLKV
FT                   AIAKTGTAEQMKLQQDIVQALKAEGANTVGLRFEELPQETLERFMPSQDEEENLLNSKN
FT                   PPEFLAIASGKGGVGKSTVSVNLAVALARLGKKVGLIDADIYGFSVPDMMGITVRPTVK
FT                   GEKIIPVERFGVKVISMGFFVEENAPVIWRGPMLGKMLNNFFHEVEWGELDYLLLDLPP
FT                   GTGDVALDIHTMLPSCKEIIVTTPHPTAAFVAARAGAMALQTDHDVLGVVENMSYYESK
FT                   KTGEKEYVFGKGGGDKLAEELRVSVLGQIPLRQPDWNEDDFAPSVYDASHPTGEVYQHI
FT                   ANKVIEQLAVKA"
FT   gene            complement(159077..159652)
FT                   /locus_tag="BPUM_0146"
FT   CDS_pept        complement(159077..159652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0146"
FT                   /product="spore gernimation protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60845"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008725.1"
FT                   /protein_id="ABV60845.1"
FT                   /translation="MSKGILRIMSCFLLLSLTACAPKTQSSSNMDYDETKKMVVDILKT
FT                   DDGKKAIQQLLNDEAMNEALVMDEQTVKQTIEKTLTSDKGKEFWKKVFEDSKFAETFAK
FT                   SMQQQHEKMLKQLMKDPDYQQLMMDILKDPEMEKKYGELVKSKEFRKHLEKVITETLSS
FT                   PLYKKKFEDELKKAASESSDSGSKESGS"
FT   gene            159743..160345
FT                   /locus_tag="BPUM_0147"
FT   CDS_pept        159743..160345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0147"
FT                   /product="KinB-signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60846"
FT                   /db_xref="GOA:A8F9C9"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9C9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366468.1"
FT                   /protein_id="ABV60846.1"
FT                   /translation="MKSRDLVRFFFSVLAVGAVITSVVGFALEWGKYQKLFISFEILEI
FT                   ASVLFWFIGVGMIFSVISQMGFVVFLTVHRFALEIFRSHSLWNTIQLFLVIFVLFDLAY
FT                   LRFLFFGENESFLPYLWLPVFIGVFALIVSYFKQQQSSKKTFVSAMFLMVVITALEWFP
FT                   ALRVNEEDWLYLMLFPLLGCNAFQLLAMPRFSKAKAT"
FT   gene            complement(160338..161102)
FT                   /locus_tag="BPUM_0148"
FT   CDS_pept        complement(160338..161102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0148"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60847"
FT                   /db_xref="GOA:A8F9D0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217051.1"
FT                   /protein_id="ABV60847.1"
FT                   /translation="MSRLYVLPIKRLKQVVIILVAALAAATFFYVQKAPPLSVFKTEHG
FT                   PRAIYKGETSSKHVSLTFNIGWGDEKAVPILNVLREYDIKNATFFLSASWAERHPDIVK
FT                   QIREDGHQIGSLGYAYKNYSQLEDSEIKQDLVRAQNSFQKLGLDDIQLLRPPTGQFNEK
FT                   ALKIATQYGYTVVHYSVNSQDWLNPGVDQIVQNVNDRMKNGDIVLLHASDSATQTAQAL
FT                   PAILKQIKEKNLKNVTVGELISNTKTRSSEVK"
FT   gene            161529..163078
FT                   /locus_tag="BPUM_03815"
FT                   /old_locus_tag="BPUM_r0007"
FT   rRNA            161529..163078
FT                   /locus_tag="BPUM_03815"
FT                   /old_locus_tag="BPUM_r0007"
FT                   /product="16S ribosomal RNA"
FT   gene            163255..166192
FT                   /locus_tag="BPUM_03820"
FT                   /old_locus_tag="BPUM_r0008"
FT   rRNA            163255..166192
FT                   /locus_tag="BPUM_03820"
FT                   /old_locus_tag="BPUM_r0008"
FT                   /product="23S ribosomal RNA"
FT   gene            166252..166367
FT                   /locus_tag="BPUM_03825"
FT                   /old_locus_tag="BPUM_r0009"
FT   rRNA            166252..166367
FT                   /locus_tag="BPUM_03825"
FT                   /old_locus_tag="BPUM_r0009"
FT                   /product="5S ribosomal RNA"
FT   gene            166410..166484
FT                   /locus_tag="BPUM_03830"
FT                   /old_locus_tag="BPUM_t0003"
FT   tRNA            166410..166484
FT                   /locus_tag="BPUM_03830"
FT                   /old_locus_tag="BPUM_t0003"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:166442..166444,aa:Asn,seq:gtt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            166486..166557
FT                   /locus_tag="BPUM_03835"
FT   tRNA            166486..166557
FT                   /locus_tag="BPUM_03835"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:166519..166521,aa:Thr,seq:ggt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            167323..167517
FT                   /locus_tag="BPUM_0149"
FT   CDS_pept        167323..167517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60848"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D1"
FT                   /protein_id="ABV60848.1"
FT                   /translation="MKEGDFMIIAITGVTYGSKVREPKGALHYYYTHALEIGNSKEELF
FT                   IQMDLQISSRKKLHGGNRK"
FT   gene            167514..168482
FT                   /locus_tag="BPUM_0150"
FT   CDS_pept        167514..168482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0150"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60849"
FT                   /db_xref="GOA:A8F9D2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008729.1"
FT                   /protein_id="ABV60849.1"
FT                   /translation="MRINHNIAALNTLNRLSANNGASQKNMEKLSSGLKINRAGDDAAG
FT                   LAISEKMRGQIRGLEMASKNAQDGISLIQTAEGALTETHSILQRVRELVVQAGNTGTQQ
FT                   GEDLTAIKDEITALVDEVDGISNRTEFNGKKLLNGTFNGTGTPGTPGTPADSEAGTPEI
FT                   PATPATDGEALVFQIGANATQQIKVNIQDMSAAALGVAGTDGKTETGKSVKDIDVSKFE
FT                   TIAADEDGGFDDQLAIVDGAIKQVSAQRSKLGAVQNRLEHTINNLGASSENLTAAESRI
FT                   RDVDMAKEMSEFTKNNILSQASQAMLAQANQQPQNVLQLLR"
FT   gene            168813..170255
FT                   /locus_tag="BPUM_0151"
FT   CDS_pept        168813..170255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0151"
FT                   /product="sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60850"
FT                   /db_xref="GOA:A8F9D3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008730.1"
FT                   /protein_id="ABV60850.1"
FT                   /translation="MKDLFVKQEWFGYVRQDVLAGILVALALIPEAIAFSIIAGVDPKV
FT                   GLYASFCIAIVISFVGGRPGMISAATGAMALVMVNLVADHGLQYLFAATILTGLIQIVF
FT                   GLCRVSRLMKFIPRSVMVGFVNALAIMIFMAQLPHFVGESLAMYIMTGGALLIIYLLPM
FT                   VVKVIPSPLIAIIVMTIIAVFGHIDVRTVGDMGELPSTLPAFLIPQVPFSWETLAIIFP
FT                   YSLALAMVGLLESLLTAQIVDDMTETSSRKNKEARGQGIANVVAGFFGGMAGCAMIGQS
FT                   VINTKAGGRGRLSTFVAGAFLMVLIFVLGDVVVQIPMAALVAVMIMVSVGTFDWSSFQQ
FT                   LKKNPKTDSIVMIVTVVTVVLTHDLSKGVFAGVLLSAVFFVAKISKLHITSTEKQVGTW
FT                   VYRIKGQIFFASVTDFIQAFHQGNDLQTVVIDLSEARIWDESGVAAIERVKEKYHAAGV
FT                   QVDIVGMDTQSRNLVKQVNGSS"
FT   gene            170314..171279
FT                   /locus_tag="BPUM_0152"
FT   CDS_pept        170314..171279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60851"
FT                   /db_xref="GOA:A8F9D4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008731.1"
FT                   /protein_id="ABV60851.1"
FT                   /translation="MLVRLNQVLGRMMPFITPISVLLGVLLAAYLKDFTFMVPWVFAIM
FT                   TFSGSLSSTFSALKHTVMHPLPLILSFMILHVLMPLYAWSAGHLIFAGDSMTITGLTLA
FT                   MVIPTGVSSLIWAAMYKGNVGLTLSIILIDTLLSPLIVPVSLSLFVGTQVHMDMVAIMK
FT                   GLFGMVVLPSILGMLVRQYAKPSVTKAMSQTLAPFSKLGLFVVVSINSSVVAPYLRELD
FT                   AAFFSKAATVFFIAMSGYAFAWLIGKVMKCTQGEIVAIVYTGGMRNISAGAVLAISFFP
FT                   PAVAVPVVIGMLFQQVLAALFGSLLNRFELKAPAVTKSLT"
FT   gene            complement(171319..172566)
FT                   /locus_tag="BPUM_0153"
FT   CDS_pept        complement(171319..172566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60852"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358872.1"
FT                   /protein_id="ABV60852.1"
FT                   /translation="MKKTASLILASILMMSTLTAASPANQERTDTKGKKATVKTGIETL
FT                   LSGNLSWLKGKKVGLITNPTGIDANMKSSVDLLFEHPNIKLTALYGPEHGVRGDAQAGE
FT                   GVESYTDEKTGLPVYSLYGKTRKPTPDMLKNVDVLLFDIQDVGSRYYTYIYTMAYAMEA
FT                   AKENNIPFVVLDRPNPIGGLKVEGPVLEPEHASFVGLYPIPLRHGMTTGELATFFNKEF
FT                   RINADVTVIKMKHWKRSMTFDDTKLPFVLPSPNMPTVDSTFVYPATGLIEGTNVSEGRG
FT                   TTKPFELIGAPYINSNELADHLNQLKLKGVKFRPVSFTPTFSKHAGKLSHGVQLYVTDR
FT                   SSFEAVKTGLSIIKAIHDLYPKEFEFLQTGSFDKLIGNGWIKEEINQGTSVKHIMKRYH
FT                   HDLKSFEKKRKKYLIY"
FT   gene            complement(172578..174497)
FT                   /locus_tag="BPUM_0154"
FT   CDS_pept        complement(172578..174497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60853"
FT                   /db_xref="GOA:A8F9D6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358873.1"
FT                   /protein_id="ABV60853.1"
FT                   /translation="MLKALFPAALVLALLTSSIPTEKVSSAPLPTAKQMVQNMSLDEKI
FT                   GQMLMPDFRNWQTKDESTPTGFTKMNKEVSHLVEKYHLGGVILFAENVVDTKQTVKLTH
FT                   EFQKASPKIPLLISIDQEGGIVTRLQKGTHFPGNMSIGASRSKKNAYDTGKIIGKELNT
FT                   LGINTNFSPVLDVNNNPNNPVIGVRSFSSDPALVTRLGLQTMKGLQKEKTISTLKHFPG
FT                   HGDTAVDSHYGLPLVEHDLDRLKKVELYPFQQAINAGADMVMTAHVQFPAIDDTTYKSK
FT                   KDGEEIMVPATLSKKVITNLLKEEMGFQGVVVTDALNMKAIADNFGQEEAVVMAIKAGV
FT                   DIALMPAPVTSLKTEKNLENVFNAVKQAIVKKEIPMSQINESVEKILQLKIKRGIISSK
FT                   KPMTLEKKIKKATQVVGKKSHRKAEQKMAREGITLLKNNNKTLPFKPKKNDKILVMAPY
FT                   EDQTKAMSVTIDSLIKQKKIKPVRIQSYAFADKSFNKETAKLIQDADYVITGSYVVQND
FT                   PAVNDGVIDDNVQDPKKWATAFPRAVMKEAAAQNKKMVVMSLRNPYDAANFEEADALLA
FT                   VYGFKGYSNGQFNQPNIPAGLEVIFGTASPKGKLPVDIPSVTHQNQTLYPFGYGLNLKG
FT                   KQIK"
FT   gene            complement(174511..175866)
FT                   /locus_tag="BPUM_0155"
FT   CDS_pept        complement(174511..175866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0155"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60854"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008734.1"
FT                   /protein_id="ABV60854.1"
FT                   /translation="MKKYFLLITSLLMLFGLPAQTFATSSHLVSSLSKTAPEEYPVLKK
FT                   AKRPEQVGFSSRQLRKVDHMIQKDIKAGFPGAALIIIKDGKIVHQKAYGYRQKYNGTTE
FT                   LKSYKKMKKNTMFDLASNTKMYATNYALQKLVYEKKLDVNEKIQAILPDFKDEPDAKVT
FT                   GKDQLLVKDLLTHSAGLPSSVLFYSKEAAGTFYSQDRKTTMKWLPKVPLQYKPGTQHIY
FT                   SDIDYMLLGMIIEKKTGMPLDQYVESTIYQPLGLKHTMFNPLQKGFKPKHFAATERVGN
FT                   SRDGVIDFENIRRYTLLGEVHDEKAFYSMAGVSGHAGLFSNISDMAVLLQLMLNKGGYG
FT                   KTTIFDQASIDLFTASSDTNPTYGLGWRKNGHTDMEWMFGKYASNEAYGHTGWTGTMTL
FT                   IDPKHNLGIVLLTNKKHSPVVSPEANPNQFEGDLFPTGTYGSIMTAIYESFK"
FT   gene            complement(175886..177259)
FT                   /locus_tag="BPUM_0156"
FT   CDS_pept        complement(175886..177259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0156"
FT                   /product="PTS sugar transporter subunit IIC"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60855"
FT                   /db_xref="GOA:A8F9D8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008735.1"
FT                   /protein_id="ABV60855.1"
FT                   /translation="MSHQTKYQQLAKDILSLCGGSENIYSHTHCMTRLRITPIDNEQVD
FT                   INAIKELDGVIGVVEAETLQIILGTGVVNQVSSAFEQLLNASGSYDLNNEAQKNKQAIS
FT                   QKNRTPFKLFLRRIASIFIPIIPALVASGLITGITKAIVQAGWLDEKSQAAIILTVIGS
FT                   GLFAYLGILVGTNAAKEFGGSPALGALAGILIINPASADIMLFGTNILPGRGGLIGVLL
FT                   AAIFMALVETRIRRFVPQSLDIIVTPTITLLITGIFTYVVFMPVGGFISDAITSGLTYL
FT                   LNMGGIFAGFVLGATFLPLVVTGLHQGLTPIHMELINSIGDDPLLPILAMGGAGQVGAA
FT                   FAIYMKTKKKKLKRAIAGGLPSGMLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAY
FT                   FQIATKAIGVSGLPLTFIVHTHQMLLYLIGLFIAYVAGFIFTYLFGFHDDMAVEFEEK"
FT   gene            complement(177256..178125)
FT                   /locus_tag="BPUM_0157"
FT   CDS_pept        complement(177256..178125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0157"
FT                   /product="RpiR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60856"
FT                   /db_xref="GOA:A8F9D9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9D9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366475.1"
FT                   /protein_id="ABV60856.1"
FT                   /translation="MSAGGLTLLHTMKAKLPQSEKIIADYILAHPDKVIKSTVHEISQA
FT                   AGASSSAVIRLCKSLGLDGYHDLKMRIAGDLMHSDKQGYRDIEQDEPIQSIIQKTAGNS
FT                   IQSIKDTASILNADALEKAVQLLLHANQIHFIGVGASGIVAADAQQKFLRINYAATAFT
FT                   DMHIASTVIANAGENDIVFGISFSGETLDIIQALQLAKDNGVKTIALTHPGHTSVSALC
FT                   DVHLSTSGSNEAPFRSAATSSRMAQLYLIDVLFLSLASRQYEETAQYIDKTRHAIRSMK
FT                   RKSKGDST"
FT   gene            complement(178140..179051)
FT                   /gene="murQ"
FT                   /gene_synonym="yfeU"
FT                   /locus_tag="BPUM_0158"
FT   CDS_pept        complement(178140..179051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /gene_synonym="yfeU"
FT                   /locus_tag="BPUM_0158"
FT                   /product="N-acetylmuramic acid 6-phosphate etherase"
FT                   /note="catalyzes the cleavage of the lactyl ether moiety of
FT                   N-acetylmuramic acid-6-phosphate (MurNAc-6-P) to form
FT                   N-acetylglucosamine-6-phosphate (GlcNAc-6-P) and lactate;
FT                   involved in MurNAc dissimilation pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60857"
FT                   /db_xref="GOA:A8F9E0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9E0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F9E0.1"
FT                   /protein_id="ABV60857.1"
FT                   /translation="MQPSQLRSLTTESRNPNTMGISQADPLEILQMINEEDMKVAQAVN
FT                   LVLPHVKTASDFAYDSISNGGRLIYLGAGTSGRLGVMDAVECPPTYSVSPDVIVGIMAG
FT                   GDSAFSHAAEDVEDSEEAGKQDLVHIHLTSKDTVVGIAASGRTPYIIGALNYAKSIGAK
FT                   TVALSCNEQSKISELADCAIEVIVGPEAITGSTRMKAASAHKMILNMLSTSVMIRQGKV
FT                   YENLMVDVKVSNHKLKERAITIIQHVTNASYEQALKTLEAADLEVKTAIVMLQTNTDKK
FT                   TAKDLLNKANGHIDKAISHHQS"
FT   gene            179273..179347
FT                   /locus_tag="BPUM_03840"
FT                   /old_locus_tag="BPUM_t0004"
FT   tRNA            179273..179347
FT                   /locus_tag="BPUM_03840"
FT                   /old_locus_tag="BPUM_t0004"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:179306..179308,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            179355..179430
FT                   /locus_tag="BPUM_03845"
FT                   /old_locus_tag="BPUM_t0005"
FT   tRNA            179355..179430
FT                   /locus_tag="BPUM_03845"
FT                   /old_locus_tag="BPUM_t0005"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:179388..179390,aa:Val,seq:tac)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            179434..179506
FT                   /locus_tag="BPUM_03850"
FT                   /old_locus_tag="BPUM_t0006"
FT   tRNA            179434..179506
FT                   /locus_tag="BPUM_03850"
FT                   /old_locus_tag="BPUM_t0006"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:179467..179469,aa:Thr,seq:tgt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            179534..179618
FT                   /locus_tag="BPUM_03855"
FT                   /old_locus_tag="BPUM_t0007"
FT   tRNA            179534..179618
FT                   /locus_tag="BPUM_03855"
FT                   /old_locus_tag="BPUM_t0007"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:179568..179570,aa:Tyr,seq:gta)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            179623..179694
FT                   /locus_tag="BPUM_03860"
FT                   /old_locus_tag="BPUM_t0008"
FT   tRNA            179623..179694
FT                   /locus_tag="BPUM_03860"
FT                   /old_locus_tag="BPUM_t0008"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:179655..179657,aa:Gln,seq:ttg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            179829..180740
FT                   /locus_tag="BPUM_0159"
FT   CDS_pept        179829..180740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0159"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60858"
FT                   /db_xref="GOA:A8F9E1"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008738.1"
FT                   /protein_id="ABV60858.1"
FT                   /translation="MGEQKKVTLVGVPMDLGQMRRGVDMGPSAIRCAGVKEKLESLSFG
FT                   VEDLGDIPVEQRDDEKGLYTSEKLKNLTENAGANQLLAEKVDSIVQSGSFPLILGGDHS
FT                   IAIGTLAGVSKHYENLGVIWYDAHGDLNTEETSPSGNIHGMPLAVSLGLGHADLTNIGG
FT                   YSPKLKPENVVLIGARSLDEGERALIREKGIKVYTMHEIDRLGMTRVMEEAISYLKERT
FT                   DGVHLSLDLDGLDPAECPGVGTPVAGGISYRESHLAMELLEEAGILTSAEFVEVNPVLD
FT                   EKNKTAEAAVALIGSLMGEKLL"
FT   gene            180924..181487
FT                   /locus_tag="BPUM_0160"
FT   CDS_pept        180924..181487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0160"
FT                   /product="RNA polymerase subunit sigma"
FT                   /note="Member of the extracytoplasmic function sigma
FT                   factors which are active under specific conditions; binds
FT                   with the catalytic core of RNA polymerase to produce the
FT                   holoenzyme and directs bacterial core RNA polymerase to
FT                   specific promoter elements to initiate transcription: this
FT                   protein is involved in detoxification and protection
FT                   against antimicrobial"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60859"
FT                   /db_xref="GOA:A8F9E2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217112.1"
FT                   /protein_id="ABV60859.2"
FT                   /translation="MDTMIKKRIKQLKKGDQNAFADIVDLYKDKIYQLCYRMLGNAHEA
FT                   EDIAQEAFIRAYVNIESFDVNRKFSTWLYRIATNLTIDRIRKKKPDYYLDAEVAGTEGL
FT                   NMYSQIAADGILPEEEVVSLELSSTIQQKILRLPDKYRSVIVLKYIDELSLKEISEILN
FT                   IPVGTVKTRIHRGREALRKQLRDL"
FT   gene            181502..182128
FT                   /locus_tag="BPUM_0161"
FT   CDS_pept        181502..182128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0161"
FT                   /product="anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60860"
FT                   /db_xref="GOA:A8F9E3"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217249.1"
FT                   /protein_id="ABV60860.1"
FT                   /translation="MSCQEKIVLLMHQYLDGDIEPQDEKELKSHLQSCEECCTHFQQIE
FT                   KSIALVQSTSHIEAPTDFTAKVMAGLPKEKKRVSIQRWIKAHPLMVAAALFLILMGGSL
FT                   FTSWNTDHNFSVSKQPNLVVVNDTVTVPKGETVKGDVTVKNGKLIVEGKVDGNVTVVNG
FT                   EQLTASAGQVTGQINEINEVFDWIWYKMKSTAQNVMRVIGPEEQK"
FT   gene            182347..183168
FT                   /locus_tag="BPUM_0162"
FT   CDS_pept        182347..183168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60861"
FT                   /db_xref="GOA:A8F9E4"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008360587.1"
FT                   /protein_id="ABV60861.1"
FT                   /translation="MALGDIPFLQYLGNAVDILVVWYVIYKLMMVIRGTKAVQLLKGIV
FT                   VIVLVRMGSAYLGLNTLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   VEEQQQKTIEAITKAINYMAKRRIGALLTIERDTGMNDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKRDEIAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTVIVS
FT                   EETGGISVARNGDLHRELTEEALQEMLIAEFSKNSKDASSTKWYWRGKKNG"
FT   gene            183161..184570
FT                   /locus_tag="BPUM_0163"
FT   CDS_pept        183161..184570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0163"
FT                   /product="YbbR-like domain-containing protein YbbR"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60862"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008742.1"
FT                   /protein_id="ABV60862.1"
FT                   /translation="MDKILNNRWAVKLLALVFALLLYGAVNSAQAPTPKKIGESFFPTS
FT                   TTDEATLTDIPVKAYYDDEKYVVTGVPQTVNVTIKGSTSAVKTARQTKNFEIYADMQNL
FT                   STGTHKVELKARDVSKGLTLSINPSVTTVTIQEKTTAEFPVETEFYNQNKIKDGYSPEQ
FT                   PIVNPKKVTVTGSKDVIDKISVIKAFVNLEDVDQQIEKEAKLTVYDSSGNELPVELSPS
FT                   VVNITVPISSPSKKVPFKIERTGSLPDGISISSIETSPSEVTVYGSQKVLDSLDFIDGV
FT                   KLDLSKIKDDTEIDADIPIPDGVKKVSPETVKIKVKVATAQEKKIDNVPISIVGLSKDL
FT                   TSEFVSPSSGRLTLTAKGSKSAIDKLKASDVEAYINVGDLNEGTHEVTVQVNGPQNVTW
FT                   TLSRSKVKVKLTSTETEDQPASTNDQKKPSSDDDDQKEKSKEESTQDKAKKESSQRQRI
FT                   KEDKKEDEASS"
FT   gene            184596..185942
FT                   /locus_tag="BPUM_0164"
FT   CDS_pept        184596..185942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0164"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60863"
FT                   /db_xref="GOA:A8F9E6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9E6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358879.1"
FT                   /protein_id="ABV60863.1"
FT                   /translation="MGKYFGTDGVRGVANSELTPELAFKIGRFGGYVLTKDKERPKVLV
FT                   GRDTRVSGHMLEGALVAGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQENEIEQLMDQPVDQLPRPVGADLGTVNDYFEGGQKYLQFL
FT                   KQTADEDFTGIHVALDCAHGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALSVFVKEKGADIGLAFDGDGDRLIAVDEKGDIVDGDQIMYICARYLKGEGRLKDNTVV
FT                   STVMSNLGFYKALEKQGIKSIQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
FT                   GMLSAIMLVNTLKATGKTLSELAAEMEKFPQLLVNVKVSDKYKVEENEKVKAVIQEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCDEYVTRITAVVKEEMGIE"
FT   misc_binding    186249..186410
FT                   /bound_moiety="glucosamine-6-phosphate"
FT                   /note="possible glmS riboswitch; BPUM_nc0023"
FT   gene            186518..188320
FT                   /locus_tag="BPUM_0165"
FT   CDS_pept        186518..188320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0165"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60864"
FT                   /db_xref="GOA:A8F9E7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:E0U070.1"
FT                   /protein_id="ABV60864.1"
FT                   /translation="MCGIVGYIGQNDAKEILLKGLEKLEYRGYDSAGIAVANEEGVHVF
FT                   KEKGRIAELREVVDANVASSAGIGHTRWATHGVPSHLNAHPHQSASGRFTLVHNGVIEN
FT                   YVQLTREYLQDVTLKSDTDTEVVVQVIEQFVSRGLDTEEAFRQTLLQLKGSYAIALFDN
FT                   ENKETIYVAKNKSPLLVGFGEDFNVVASDAMAMLQVTNEYAELMDKEMVIVTKDEVIIK
FT                   NLDGDIMTRPSYIAELDASDIEKGTYPHYMLKETDEQPLVMRKIIQEYQDENGKLSVAG
FT                   DIASAVAEADRIYIVACGTSYHAGLVGKQYIEDWAKVPVEVHVASEFSYNMPLLSKKPL
FT                   FIFLSQSGETADSRAVLVQVKELGHKALTITNVPGSTLSREADFTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAILASVAAELNGQSLDFDLVKELGIVANAMEALVDQKDEMEQIARDFFT
FT                   VTRNAFFIGRGLDYYVCLEGSLKLKEISYIQAEGFAGGELKHGTIALIEEGTPVIALAT
FT                   QEHVNLSIRGNVKEVVARGANPCVISLKGLEDEGDRFVLPAVHPALAPLASVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   gene            188383..188580
FT                   /locus_tag="BPUM_0166"
FT   CDS_pept        188383..188580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60865"
FT                   /db_xref="GOA:A8F9E8"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E8"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ABV60865.1"
FT                   /translation="MSKELVNDKFDRTMFFDSGYNIRRLQFSDRFQGGDVIFNRYLKKE
FT                   KWGIVFFLIGYIVCLLALIC"
FT   gene            188828..189184
FT                   /locus_tag="BPUM_0167"
FT   CDS_pept        188828..189184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60866"
FT                   /db_xref="InterPro:IPR014580"
FT                   /db_xref="InterPro:IPR023204"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9E9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_018931808.1"
FT                   /protein_id="ABV60866.1"
FT                   /translation="MTKHKVYTMSFAKVYPLYIAKAERKGKTKAEVDTIICWLTGYSPE
FT                   ELQEQIDKQIDIETFFAEAPELHPSRSLIKGVICGVRVEDIEEETMKNIRYMDKLIDEL
FT                   AKGKKMEKILRGSS"
FT   gene            189347..189538
FT                   /locus_tag="BPUM_0168"
FT   CDS_pept        189347..189538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60867"
FT                   /db_xref="GOA:A8F9F0"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217265.1"
FT                   /protein_id="ABV60867.1"
FT                   /translation="MDMKMILPLILLQAILMVIGLFDLLKRDPSRIRGEVKWVWALVIV
FT                   FVASAGPIAYFIFGRKQS"
FT   gene            189557..190474
FT                   /locus_tag="BPUM_0169"
FT   CDS_pept        189557..190474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0169"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60868"
FT                   /db_xref="GOA:A8F9F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008746.1"
FT                   /protein_id="ABV60868.1"
FT                   /translation="MNMLECHGLTKSYGRHEVLKDVSFSVGEVGCVGFLGANGAGKTTT
FT                   IRILTGLARPTSGVIKVAGMDVTKDMDDISHVIGYCPQHPAFYQDMTGQEWMHWVGGLF
FT                   HLEKNTIRSKTEELLKLCRVYEAKDRAIGSYSGGMKQRLAIAQALINSPKVLILDEPVS
FT                   ALDPMGRKDILTLIERLKHEMLIFMSTHILDDIERVADHIIMINSGKIEMSSSMKQIKE
FT                   DYIQPVIEFQLEQQNTKLMALLKERDWVEECMETGDAYQVRVNNQQTALKELPALITET
FT                   DGVLLHYRLSKLTLEDIFMKVVTA"
FT   gene            190471..191235
FT                   /locus_tag="BPUM_0170"
FT   CDS_pept        190471..191235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60869"
FT                   /db_xref="GOA:A8F9F2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008747.1"
FT                   /protein_id="ABV60869.1"
FT                   /translation="MMMLKKEFRELFTSYKMLFVPIIFTILMITQPITLKMLPDLLSKS
FT                   ANLPEGSTFYIPEPSAGEALASALSKFDSLGVFILIMIVMGTIAGERASGVTAMIMVKP
FT                   ISRMSYYVSKICAYACLTLFSLIVAVLASVYYVDIQFGHVDWGDVLKGTLLYYPNLLLI
FT                   VVSTICSSAFFKRSVTAGGVSLLINLILFTVPSFYEDTLGKFAPKGVTSAAEEMIHRGT
FT                   YSDQLLTSVLGVLVLIGFFFLIGWFFFRRQEL"
FT   gene            191352..191741
FT                   /locus_tag="BPUM_0171"
FT   CDS_pept        191352..191741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0171"
FT                   /product="enamine deaminase RidA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60870"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008748.1"
FT                   /protein_id="ABV60870.1"
FT                   /translation="MRTSRNPETIHPPVAPYAHQIETTGPQRWLTLSGQVGMEVDGTIP
FT                   ESPLEQLELALENVKRNVEAADMAVEDITKLVFYLVGEFDAESRKRIMGQFLGDHLPCM
FT                   TMIYVVALASPALKVEVDAWACREI"
FT   gene            191943..192140
FT                   /locus_tag="BPUM_0172"
FT   CDS_pept        191943..192140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60871"
FT                   /db_xref="GOA:A8F9F4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008749.1"
FT                   /protein_id="ABV60871.1"
FT                   /translation="MFLSNKRLKRNAIFFAGVGAVLLILMMLKWLPISADWELPLIFFG
FT                   LVILFYLKRMMRKEEGNHHS"
FT   gene            192289..193416
FT                   /locus_tag="BPUM_0173"
FT   CDS_pept        192289..193416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60872"
FT                   /db_xref="GOA:A8F9F5"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008750.1"
FT                   /protein_id="ABV60872.1"
FT                   /translation="MKGSRVELIDSLRGFSLLGILIVNMLNFQYDYDFEKMFDSSFWGQ
FT                   EFGVYVTEILFQGSFYPIFSFLFGYSFIKLIESTKARGLNTNAIVVRRGFGLIVLGMLH
FT                   YIFIWNGDILLYYGACTFFLMMFLSSRIKTMLIWSGVLGALSLVIVPYMMKLVYGTDEL
FT                   LTDVYAKGAYGDILLSRITVEDDMLIVTIILAIVSITLMPILGFLFGTISVGPFALLGM
FT                   AIGKKGHLTEEDRGMAYRRGWVWMIVVGLALKCATFIDAPWSEFVMILGGYVLAIGYIQ
FT                   AFIVFYYSKAAQGLKRLLAGLGRLSLSNYLAQSIICTTIFYSYGLGLFGQMGSMFGLLL
FT                   ALGLYTAQLFISYLYLKKWRRGPVEWMMGKLVYWR"
FT   gene            193578..193949
FT                   /locus_tag="BPUM_0174"
FT   CDS_pept        193578..193949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0174"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60873"
FT                   /db_xref="GOA:A8F9F6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008751.1"
FT                   /protein_id="ABV60873.1"
FT                   /translation="MQITISNHSKEPIYEQITNQIKSMILTGELAEGAALPSIRKLAKD
FT                   LQISVITTKRTYEELEKAGFIYSIVGKGSFVAEQNLEVMREKKLKVIEEQLGAVVTNGK
FT                   ELGLSFDELQQLLKFLYEE"
FT   gene            193955..194830
FT                   /locus_tag="BPUM_0175"
FT   CDS_pept        193955..194830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0175"
FT                   /product="sodium ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60874"
FT                   /db_xref="GOA:A8F9F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216953.1"
FT                   /protein_id="ABV60874.1"
FT                   /translation="MEHVIEFKGVSKRFKEFSVQNLDLQVKKGFVTGFIGENGAGKSTT
FT                   IKMIMNLLKPDSGEVKIFGLDYRTHEKEIKERIGFVYDANVFFPGLNLKDIKRIVAPAY
FT                   KRWDDQLFYQYIEQFGLPLNKAIKTFSKGMQMKASLAIALSHHAELIIMDEPTAGLDPV
FT                   FRRELLGTLQELMIDGNRTIFFSTHVTTDLDRIADYIAFIQNGRLVFQQSIHEVAENYA
FT                   LVKGSLDLLDRDTEKSFIHIQRTAAGFEALTDRIDEVKLIFGDAVVIEPASLEDIMFYL
FT                   KGGVAHVSFN"
FT   gene            194814..195419
FT                   /locus_tag="BPUM_0176"
FT   CDS_pept        194814..195419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0176"
FT                   /product="multidrug ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60875"
FT                   /db_xref="GOA:A8F9F8"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008343909.1"
FT                   /protein_id="ABV60875.1"
FT                   /translation="MFHLIKRDVILQKKQLLIFIPFILFFIFMDVHPVLTFLVASVFIP
FT                   FNTYAYDEKAETNILLNSLPYTRKEIIASRYLGAIFYMSIAIVLTSAALFVFGKLFSLS
FT                   DIAIGSGLFLLFAACTFPLFYILKPGYITTAVIIGFIVLSAMGPPVVLYLAEQFSGITD
FT                   FIMNLSIPIVYTGSTVLIMLLYLLSWGLSTAIYQRKVF"
FT   gene            195607..195822
FT                   /locus_tag="BPUM_0177"
FT   CDS_pept        195607..195822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0177"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60876"
FT                   /db_xref="GOA:A8F9F9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9F9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008754.1"
FT                   /protein_id="ABV60876.1"
FT                   /translation="MEIKNRIKVLRAERDWTQKDLAEKLGVTRQTVAAIENGKYSLSLK
FT                   LAFQIARTFEVDLYDVFQEVDKEEQQ"
FT   gene            195819..196118
FT                   /locus_tag="BPUM_0178"
FT   CDS_pept        195819..196118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60877"
FT                   /db_xref="GOA:A8F9G0"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008343907.1"
FT                   /protein_id="ABV60877.1"
FT                   /translation="MITTIILYSLIILSILSTAFQLKKSREYKHDERGQFILAKAGSFS
FT                   IIGIALAYILVAVIQASVHQFSSPREWFYIAITFMYVSSVCANTIGIIYCERKY"
FT   gene            196174..197121
FT                   /locus_tag="BPUM_0179"
FT   CDS_pept        196174..197121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0179"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60878"
FT                   /db_xref="GOA:A8F9G1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008756.1"
FT                   /protein_id="ABV60878.1"
FT                   /translation="MKKILRIMLISIGTIITVMVVFLASVYFVNLFSNEREKGKIEAYG
FT                   QKVMVDGKQMNVLIQGDGKETIVLLPGYGTASPVLDFKPLVKELSPYYRVVVIEPFGYG
FT                   LSDDTDKVRTSQNIVNEIHECLQKLNINKYTVMGHSISGIYGLEYVNQYEKEVQAFVGI
FT                   DSSFPKQEDADELPVSSLQLLHQSGFYRLIVKMNPDQLVMPKVGDQTKAQIKMLTFRNF
FT                   MDESQASEADNFRNNFKNAQRLHFPKKLPVVFYLADQTEKETPNWKPMHEELLKNVDHG
FT                   KVVTFKGGHYLHHTKSKEIAADFREFLSEIESNR"
FT   gene            197351..198739
FT                   /locus_tag="BPUM_0180"
FT   CDS_pept        197351..198739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0180"
FT                   /product="D-alanine/D-serine/glycine permease"
FT                   /note="involved in the transport across the cytoplasmic
FT                   membrane of D-alanine, D-serine and glycine"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60879"
FT                   /db_xref="GOA:A8F9G2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008757.1"
FT                   /protein_id="ABV60879.1"
FT                   /translation="MAQKELKRGLSARHIQMIALGGTIGVGLFMGSAKAIQWTGPSVLL
FT                   AYAVCGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPLAGYMTAWSNWFQWVIVGMS
FT                   EIIAVGAYMKYWFPELPAWIPGLIAMIILGAANLISVKSFGEFEFWFAMIKIVTIILMI
FT                   IAGLGIIFFGFGNGGTPIGLSNLWAHGGFFTGGFTGFLFALSLVIAAYQGVELIGITAG
FT                   EAQNPEKTLTNAIKSIIWRILIFYIGAIFVIVTVYPWDQLNTLGSPFVATFAKIGITAA
FT                   AGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPAFFTKISKNGVPYFGTFAVLIG
FT                   LAIGVVLNYVAPPNIFVYVYSASVLPGMVPWFVILISHIGFRKAKGAALDQHPFKMPLA
FT                   PFSNYLTIGFLLMVLVFMLINQDTRISLIVAIGFLIVVALSFYVFGIGKRKPIETASSD
FT                   QTVK"
FT   gene            complement(198778..199659)
FT                   /locus_tag="BPUM_0181"
FT   CDS_pept        complement(198778..199659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0181"
FT                   /product="glycerophosphodiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60880"
FT                   /db_xref="GOA:A8F9G3"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008758.1"
FT                   /protein_id="ABV60880.1"
FT                   /translation="MKKSRLLAFVLLSFALLSIAWVPATVSAHEHLLSPDRILTVAHRG
FT                   ASGYAPEHTLASYKLATKMNADYLELDLQMTKDGHLIVMHDETVDRTTNGTGSVKDLTL
FT                   AEIKQLDAGTWFNEANPDRQNANYIGQRVLTLDEVLRYFGKRENYYIETKKPDIYPQME
FT                   EKLLATLKKHHLLGKHTKKGQVIIQSFSQDSLLKLQKLAPRLPKVQLLDRTQMTSITDD
FT                   QLDFIKSYAVGVGPNFRALTLENVQQVRSHGLLLHPYTVNNEADMTRLLQYGVTGLFTN
FT                   FPDVFNRVKASI"
FT   gene            complement(199752..201086)
FT                   /gene="glpT"
FT                   /locus_tag="BPUM_0182"
FT   CDS_pept        complement(199752..201086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BPUM_0182"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="catalyzes the uptake of glycerol-3-phosphate into
FT                   the cell with the simultaneous export of inorganic
FT                   phosphate from the cell"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60881"
FT                   /db_xref="GOA:A8F9G4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217195.1"
FT                   /protein_id="ABV60881.1"
FT                   /translation="MFKWFKPAPHIDRLDDAKTDETYKKLRLQVFLGIFIGYAGYYLLR
FT                   KNFAFAIPYLQEEGFTKSELGFVLAAVSIAYGFSKFIMGMISDRCNPRYFLATGLFLSA
FT                   LINILFVSFPWVTSSVWIMFLFMFLNGWFQGMGWPPCGRTMAHWFSVSERGTKMSIWNV
FT                   AHNIGGGILAPLITLGIVLFATWKSIFFFPAIIAIIVSFVIILLVRDTPQSTGLPPIEE
FT                   YRNDYPAQQYEDQEKELTVKEILFKYVLNNKFLWYIAIANVFVYFVRYGVVDWAPTYLT
FT                   EAKGFSPEHSRWSYFLYEYAGIPGTLLCGWISDRFFRSRRAPAGVLFMAGVLIAVLVYW
FT                   LNPAGNPMVDNIALISIGFLIYGPVMLIGLQAIDLAPKKAAGTAAGLTGFFGYIGGSAF
FT                   ANAMMGVVVDHYDWTGGFILLVGSCVLAIVFLAMTWNTGKRVEQA"
FT   gene            201114..201272
FT                   /locus_tag="BPUM_0183"
FT   CDS_pept        201114..201272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60882"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G5"
FT                   /protein_id="ABV60882.1"
FT                   /translation="MTEAKVRDQRLILYFLRDKRIDNAFFCTPIISEGKDVYDEAFVII
FT                   LEKQFIK"
FT   gene            complement(201313..202083)
FT                   /locus_tag="BPUM_0184"
FT   CDS_pept        complement(201313..202083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0184"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60883"
FT                   /db_xref="GOA:A8F9G6"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008761.1"
FT                   /protein_id="ABV60883.1"
FT                   /translation="MKKVSYTLIACLLSVGLAACSSNDAKQDKQNVSAKNKETTQADQK
FT                   EQQKQMEEMQKKLDAQKIDDQKVVATVNQDKITGNEYNSALSTIQGQLQQSGQDPTSKE
FT                   GAKAVKKQTIDALVGQELILQDAEKKGIKASDKEVDKQLKEEKKQFKDNAQFEEALKKS
FT                   GLTMDQLKSDIADSIKYSQYVDKEIKSASVSEKDVKAYYDQYADEMKKQKQKAPEYKEV
FT                   KSQIKKQLESQEKQKEVQKEIEKLKKSAKINVSL"
FT   gene            202058..202219
FT                   /locus_tag="BPUM_0185"
FT   CDS_pept        202058..202219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0185"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60884"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G7"
FT                   /protein_id="ABV60884.1"
FT                   /translation="MSVYDTFFIIFSPFGMRTSSAHSNRFLGKIKPYRQFVSGLTCFLS
FT                   VCPHFVFS"
FT   gene            complement(202225..204288)
FT                   /locus_tag="BPUM_0186"
FT   CDS_pept        complement(202225..204288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60885"
FT                   /db_xref="GOA:A8F9G8"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008763.1"
FT                   /protein_id="ABV60885.1"
FT                   /translation="MSNNQTPNPLITEKSPYLLQHAHNPVHWYPWGQEAFDKAKRENKP
FT                   VLVSIGYATCHWCHVMAHESFEDQQVADILNEHFISIKVDREERPDIDSMYMSVCQMMT
FT                   GQGGWPLNVFVTPDQKPFYAGTYFPKRSAYGRPGFIEALTQLLDAYHNDRDHIESLAEK
FT                   ATNNLRIKAAGQTENTLTQETIHKAYYQLMSSFDTLHGGFGTAPKFPAPHMLSFLMRYY
FT                   EWTGQENALYAVTKTLDGIANGGIYDHVGSGFSRYSTDEKWLVPHFEKMLYDNALLMEA
FT                   YTEAYQLTQQPTYEKLVHRLIHFIKRDMMNPDGSFYSAIDADSEGKEGQFYVWSKDEIM
FT                   THLGEDLGALFCAVYHITDEGNFEGENIPHTISTSFDDIKASFSIDDQTLQSKLQEARY
FT                   ILQSVRQQRPAPLVDDKVLTSWNALMISALAKTGRVFDAEEAIRMAKQAISFLETHLVQ
FT                   HDRLMVRYREGDVKHLGFIEDYAHMLKAYMSLYEATFELAWLEKATAIAENMFELFWDK
FT                   EKGGFFFSGSDAEALLVREKEVYDGAMPSGNSTALKHLLILSRLTGRQNWLDTLEQMFQ
FT                   AFYVDVSSYPSGHTAFLQGLLAQYATKREIIILGKNGDPQKEQLLQALQKRFMPFDIIL
FT                   TAETGQELAKLAPFTKDYKTIDGKTTVYICENYSCRQPITDIDEAMAQLSLS"
FT   gene            204711..204920
FT                   /locus_tag="BPUM_0187"
FT   CDS_pept        204711..204920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60886"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9G9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008764.1"
FT                   /protein_id="ABV60886.1"
FT                   /translation="MDYDYKKKEKKNGNCVISVRDRWENSIIEFEKKQHHIDIVVNYRN
FT                   DKTTKYSIPIEIFGKVYEDLQRGN"
FT   gene            complement(205051..205557)
FT                   /locus_tag="BPUM_0188"
FT   CDS_pept        complement(205051..205557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60887"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008765.1"
FT                   /protein_id="ABV60887.1"
FT                   /translation="MTLQHYIGSNKELPLGTIGQNPTYKPLSELNIKLFDQKQKKHKTY
FT                   QKEDPLIEVFETEEDFEGIHIDYLDPFYETVRNKFTHPFVYELDIIHSPRALFRFIEKE
FT                   LSTGETIEIYSCLNELETKEKDDQLDVEIDLSKKRFGNHIVFKDIDELIDMFELEHLQY
FT                   VLVKK"
FT   gene            205731..205991
FT                   /locus_tag="BPUM_0189"
FT   CDS_pept        205731..205991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0189"
FT                   /product="cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60888"
FT                   /db_xref="GOA:A8F9H1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_016764952.1"
FT                   /protein_id="ABV60888.1"
FT                   /translation="MEYNQQMKNRLRRIEGQIKGVLAMMEQGKDCREVVTQLSASRNAI
FT                   DRAMGVIVSTNLEQCVRESLEQGKDTEGLVKEAVELLVKSR"
FT   gene            206116..206598
FT                   /locus_tag="BPUM_0190"
FT   CDS_pept        206116..206598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60889"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008766.1"
FT                   /protein_id="ABV60889.1"
FT                   /translation="MEEQKKRTTIVLFSGDYDKAMAAYIIANGAAAYDHEVTIFHTFWG
FT                   LNALRKDEMVPMKKGFLEKMFGKMMPRGADRMGISKMNFAGMGPKMIKHVIKKHNAMTL
FT                   PQLIEMAKEQDINLVACTMTMDLLGLQEKELLDDIQYAGVAAYLAEAEIGRVNLFI"
FT   gene            206613..206966
FT                   /locus_tag="BPUM_0191"
FT   CDS_pept        206613..206966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0191"
FT                   /product="sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60890"
FT                   /db_xref="GOA:A8F9H3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008767.1"
FT                   /protein_id="ABV60890.1"
FT                   /translation="MVQTILLIIVIGLLVSRFLPVRGVKQMDAAHMKKKLKSKGQQLID
FT                   VRSPTEFQTNHIKGFQNIPLSHLKKRASQLEKNEEVYVICQSGMRSMQAAKILKKQGFT
FT                   QITNIKGGMNAWH"
FT   gene            207014..207574
FT                   /locus_tag="BPUM_0192"
FT   CDS_pept        207014..207574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60891"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008768.1"
FT                   /protein_id="ABV60891.1"
FT                   /translation="MQQPTVILDAKGLACPMPIVKTKKQMNELLPGDVLEVQATDKGST
FT                   ADLAAWSKSAGHEFLGTTVEGQVLHHLIRKGGEQQKEGKSMISEMSLETFQQKVKEDPS
FT                   LMILDVRELDEYEAGHIPRAVHIPLGEVDQRAEELSRETDIYLICHSGRRSELAAQKLK
FT                   EKGFHQLTNIVPGMNSWTGAIEK"
FT   gene            207589..208716
FT                   /locus_tag="BPUM_0193"
FT   CDS_pept        207589..208716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60892"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008769.1"
FT                   /protein_id="ABV60892.1"
FT                   /translation="MTVKAMTAEQLTKKIVNKEPLFLLDVRNQADVQDWKIEGEAIVHM
FT                   NVPYFDLLEGVEGILHDIPHDREVLVVCAKEGSSIMVAEMLSEAGRTVHYLEGGMKAWS
FT                   EHLEPVKIGDLSGGGELYQFVRMGKGCLSYMIMSNGESAIVDAARMTDVYIRFAKKHHV
FT                   SITQVLDTHLHADHISGGKKLAEQTGASYWLPPKDAEEVIFEYNRLEEGERIAIGAATI
FT                   DIHPLYSPGHTIGSTSFIVDDQYLLSGDILFVDSIGRPDLAGMAEDWAGDLRETLYDRY
FT                   GALSKELIVLPAHFMIMDEVNEDGSVWKELGVLFEENHGLNIEDEAVFREMVTKNLPAQ
FT                   PNAYQDIRQTNMGKLSPDDEAQREMEIGPNRCAIR"
FT   gene            208750..208980
FT                   /locus_tag="BPUM_0194"
FT   CDS_pept        208750..208980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60893"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008343881.1"
FT                   /protein_id="ABV60893.1"
FT                   /translation="MTSDQMLDVTGLACPMPIIRTKKKMNDLAEGQVLEIHATDKGAKA
FT                   DLAAWAKSSGHELITQTEEGHVLKFWVRKGS"
FT   gene            209039..209815
FT                   /locus_tag="BPUM_0195"
FT   CDS_pept        209039..209815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60894"
FT                   /db_xref="GOA:A8F9H7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358722.1"
FT                   /protein_id="ABV60894.1"
FT                   /translation="MDFAFLITLFIIGCIGSFLSGMVGIGGSVINYPMLLYIPPLVGVM
FT                   ALSAHEVSGIGAIQVLFSTLGGVLAYRKSGFLHRSLILYMGSSILAGSLLGSYVSHFMP
FT                   ENGMNLVYGLLAIVAVVLMLIPKKGQRADAEEEVTFHKGLAAGIAFVIGSVSGVLGAGG
FT                   AFILVPVMLSILKIPVRMTIASSLAITFLSAIGASAGKVLTGQVMLLPAVVLMLASLIA
FT                   APIGAKVGQKINAVYLQWALAAMITATAVKIWLDLL"
FT   gene            complement(209851..210027)
FT                   /locus_tag="BPUM_0196"
FT   CDS_pept        complement(209851..210027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60895"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H8"
FT                   /protein_id="ABV60895.1"
FT                   /translation="MKRWPSLFAERCPKCKTALEVSKSNALQGKVVKTCPNLHYQKEYH
FT                   PALETYIEHDDIK"
FT   gene            complement(210162..211595)
FT                   /locus_tag="BPUM_0197"
FT   CDS_pept        complement(210162..211595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0197"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number="6.1.1.15"
FT                   /note="catalyzes the formation of prolyl-tRNA(Pro) from
FT                   proline and tRNA(Pro)"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60896"
FT                   /db_xref="GOA:A8F9H9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9H9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008773.1"
FT                   /protein_id="ABV60896.1"
FT                   /translation="MSKKQFVEKITSMEDDFAQWYTDVVTKARLVDYSSVRGSMIIQPY
FT                   GFKIWENIRDELDRQIKETGHENVYMPLFIPESLLQQEKDHIEGFAPEVAWVTHGGESE
FT                   LQERLCVRPTSEVLFAEHYKNIIHSYRDLPKLYNQWANVVRWEKTTRPFLRTLEFLWQE
FT                   GHTCHETEQEAIEETERMLHIYASLCEELLAIPVIKGRKTEKEKFAGARFTYTVESLMH
FT                   DGKALQTATSHFFGNGFAKAFGIEFLNREGKLEHVQQTSWGFTTRIIGAMIMVHGDDRG
FT                   LVLPPNIAPTQVRIVPIASHKEGVLDHAYELKDRLTRIARADIDASDKQPGWKFNECEM
FT                   QGIPLRVEVGPKDIEKGQVMLARRDTGEKQAVTLDALEQTITSTLEDIQRTMYEKAKER
FT                   LHEKTSTAHTIEDIEHILSEENRLIKAMWCGDEVCENDIKERTGATSRCIPFEQETISE
FT                   TCVCCGKPASDMVFWAKSY"
FT   misc_binding    211992..212092
FT                   /bound_moiety="purine"
FT                   /note="possible purine riboswitch; BPUM_nc0003"
FT   gene            212169..213341
FT                   /locus_tag="BPUM_0198"
FT   CDS_pept        212169..213341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0198"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60897"
FT                   /db_xref="GOA:A8F9I0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217034.1"
FT                   /protein_id="ABV60897.1"
FT                   /translation="MNWRVYLLAVSTFAVGLVELVVGGILPSLAEDLNVSLATAGQLIT
FT                   VFAIVYAISAPVLLTATAKIERKRLYLIALLVFTIGNVFTYFSSTFALVMISRVLIAMS
FT                   TALVVVLSLTITAKLVEPAHRAKSLGLIFIGISSSLVLGVPIGIFITESFGWRVMFLGI
FT                   SILSAISMVLIYFLLDKMPVEKVTPLREQIRSLGHPKIFSAHLISLFMLAGHYMLYSYF
FT                   TPFLMEVLHMTPFWISICYLVFGLASIGGNGFGGWLSDKLGSGKAILLVTIAFAVVMFI
FT                   IPYTAGVFVLFMIMVVLWGALSWALTPALQSYLIQTDPVTSDIQQSLNTSALQIGISIG
FT                   SAVGGVLFTMTGSSVDLAKFGVVFVLIAFSCAVISLKRPPLYMDRQHRAE"
FT   gene            complement(213382..214149)
FT                   /locus_tag="BPUM_0199"
FT   CDS_pept        complement(213382..214149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0199"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60898"
FT                   /db_xref="GOA:A8F9I1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008775.1"
FT                   /protein_id="ABV60898.2"
FT                   /translation="MKIEQQIAIRQLEEKIHLFSSTVNGTFLTTDDFVLSNTHISTDTF
FT                   NLLLPTSAHIQDPQKVKTTIEHLQSQKQSFSTWVDHRLLHPDWTNLLQEYQLEEVERNT
FT                   IMMLEQTEGIDPAISSPLTIKEVLDERTLLDYKNIFIELFKESPEAIALEDYFQRFSLE
FT                   AIQSRARMFVGYVDHKPVTTGLLLEATDSYGIYDVITRAEHRGKGLGSDMFHYLLTQTE
FT                   NKQKCVMLQASADGKNIYQRAGFQPIGEMVVFE"
FT   gene            214365..214823
FT                   /locus_tag="BPUM_0200"
FT   CDS_pept        214365..214823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0200"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60899"
FT                   /db_xref="GOA:A8F9I2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008343873.1"
FT                   /protein_id="ABV60899.1"
FT                   /translation="METKEQIVLKAIQDLIIHREKRRNDPTDPLITTTDTLKQDWTLTQ
FT                   LHILSMIQANPNESNNTFLSQQLKLSKPAITKAVKKLIDKGMVDYCHRQGDKKSVYYSL
FT                   TEKGTQLAALHDELHEKAVASYLEFLQQFHEDELQVIERFLKAWKEKI"
FT   gene            214934..215179
FT                   /locus_tag="BPUM_0201"
FT   CDS_pept        214934..215179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60900"
FT                   /db_xref="GOA:A8F9I3"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359309.1"
FT                   /protein_id="ABV60900.2"
FT                   /translation="MGKEMMENFRKSATIMPFVGLFVSLLLFVYFFGITGVEEPVWAAV
FT                   LYCALPFLGYTIFYLPVYIYFKVSKKRSIHKNEEQT"
FT   gene            215176..215637
FT                   /locus_tag="BPUM_0202"
FT   CDS_pept        215176..215637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60901"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217083.1"
FT                   /protein_id="ABV60901.1"
FT                   /translation="MIVVSACLAGLKVRYNGSHRLDQRIEEFVQEGKAVTVCPELLGGF
FT                   STPRPPAEIIGGDGHDVLRGQATVVDVHGTDVTEMYVKGAKATLEQVQSLKATAVVLKE
FT                   YSPSCGSRMIYQGEFNGKTKAGDGVTSALLKQHGIQVFSEEDDWISLFQ"
FT   gene            215612..215990
FT                   /pseudo
FT                   /locus_tag="BPUM_03870"
FT                   /note="hypothetical protein; disrupted"
FT   gene            216072..216899
FT                   /locus_tag="BPUM_0203"
FT   CDS_pept        216072..216899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0203"
FT                   /product="glyoxal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60902"
FT                   /db_xref="GOA:A8F9I5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358734.1"
FT                   /protein_id="ABV60902.1"
FT                   /translation="MSGLTDTVTLANGVKMPKLGFGVWQVKDGDEAVNAVTDALEAGYR
FT                   SIDTAAAYQNEEGVGKAIQQSGISRDDLFITTKVWNRDQGYESTLEAFETSMNKLGLDV
FT                   LDLYLIHWPVEGKYKETWKALEKLYKDGRVRAIGVCNFHQHHLDDLLEEAEVVPMVNQI
FT                   ELHPKLTQEPLRDYCKEKGIHVEAWSPLGSGKLLNHPVLQDIAKKHDKSVAQVILRWDL
FT                   QHGIITIPKSVTKSRIIENTQVFDFELSAHEMGVIDQLNEDERTGPDPDNFDF"
FT   gene            complement(216939..218021)
FT                   /locus_tag="BPUM_0204"
FT   CDS_pept        complement(216939..218021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0204"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60903"
FT                   /db_xref="GOA:A8F9I6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008779.1"
FT                   /protein_id="ABV60903.2"
FT                   /translation="MQPEDIVRSGPNQFISQKGIYHELDSLISSSFQSPAVVTGYDSFH
FT                   AFSQYTKLPSHWPVVQHKGYSSPNAITRIAEELQEADVIIGIGGGTILDTAKSVAEALQ
FT                   IEVIMVPTIPGTCAASTPLSVIYDDKGNFMRVDYHKRSSYLTLIDHTFLLSSPLSYLQS
FT                   GIGDTLAKWYEAEAIIRNAKDSLPLMVHAALKQAVYVRDILVSHSEEAVHSLQTGQLSQ
FT                   AFADVTDTIITLAGTVGGYGGRYGRMAGAHAIHNGLTFIEETHHVLHGQKVAYGILVQL
FT                   AAENRMSEVEELLELYETLGLPRNMRELGITAQLEEAAKTVANHAARADETFCLIGDYS
FT                   KEQIVDAIQVIENVSASKNR"
FT   gene            218211..219179
FT                   /locus_tag="BPUM_0205"
FT   CDS_pept        218211..219179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0205"
FT                   /product="sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60904"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9I7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007498459.1"
FT                   /protein_id="ABV60904.1"
FT                   /translation="MEKQYRVLLYYQYVPIEDPETFTAEHLAFCKELGLLGRILISSEG
FT                   INGTVSGTIEQTDKYMEALKEDPRFASMPIKIDEADGHAFKKMHVRHRNELVNLSLEDD
FT                   VNPLELTGKHLSPVEFYEQMQSPDTVVIDARNDYEFDVGHFRGAVRPDIETFRELPEWI
FT                   RDNKEILEGKKILTYCTGGVRCEKFSGWLKREGFEDVSQLDGGIVTYGKDPEVQGKLWD
FT                   GQCYVFDTRLTVPVNQTEHVVVGKDFFTGEPCERYVNCANPACNRKMIATEESEHKYMR
FT                   SCSHECRTSERNLYVKQHNLSEEEVQERLAVIEQEQAISQG"
FT   gene            219506..221125
FT                   /locus_tag="BPUM_0206"
FT   CDS_pept        219506..221125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0206"
FT                   /product="amino acid:proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60905"
FT                   /db_xref="GOA:A8F9I8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008358205.1"
FT                   /protein_id="ABV60905.1"
FT                   /translation="MNHLHRRMGTFALMMVGLGSIIGSGWLFGAWRAAQIAGPAAILSW
FT                   LIGMVVILFIALSYSELGSMFPEAGGMVKYTQYSHDSFIGFIAAWANWIAIVSVIPVEA
FT                   VASVQYMSSWPWEWAKWTTHLVTKGVLTTEGLMVASVLLVIYFLLNYWTVGLFSKANTF
FT                   ITVFKIVIPGLTIGALLFVGFHSENFTSGTSIAPNGWASVLTAVATSGIVFAFNGFQSP
FT                   INMAGEAKNPGRSIPIAIVGSILIGTVIYVLLQISFIGAVDPSMIVNGWGHLNFNSPFA
FT                   DLAIALGINWLVLILYADAFVSPSGTGITYTATTSRMIYGMEKNKYMPSVLGRLHPIYG
FT                   VPRPAMFFNLAVSFIFLFLFRGWGVLAEIISVATLISYLTGPVTVMTLRKTGTDLYRPL
FT                   RIKGLSIIAPLGFVFASLTLYWARWPLTGQVLFIILIGLPIYFYYQAKSKWKGFGRNVK
FT                   AGAWMVVYLLVMMTISCLGSDKFGGYNVIHYGWDMALITVVSLLFYMWALKSGFETEFL
FT                   EDAKKINDELRTSSQEAASSKE"
FT   gene            complement(221160..221360)
FT                   /locus_tag="BPUM_0207"
FT   CDS_pept        complement(221160..221360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60906"
FT                   /db_xref="GOA:A8F9I9"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9I9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217268.1"
FT                   /protein_id="ABV60906.1"
FT                   /translation="MKAFFWSASFLFMLLFTLVFLGIVFLLSGQGMNLLWKYVLISFVT
FT                   AAVLRGVTTWLRQRVMHHLSK"
FT   gene            221546..222382
FT                   /locus_tag="BPUM_0208"
FT   CDS_pept        221546..222382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0208"
FT                   /product="transcription antiterminator LicT"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60907"
FT                   /db_xref="GOA:A8F9J0"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008783.1"
FT                   /protein_id="ABV60907.1"
FT                   /translation="MQIQKVLNNNVISVIDEQGKEIVVMGRGIAFQRRPGDPVDESLID
FT                   KVFRLEDHSVHERMKMLLLEVPYDVVKVTEEMIQYAHTKLNRRLNESLHVSLADHIHYA
FT                   IERLKKNHLIENSLIWEIKRLYKDEFLVAKDCLEMIEERLHIELPEDEAGFIAMHIINA
FT                   ELNEDMNTTVNITKEVNAILTIVKYHLNMEFDEDSLNFYRFLTHLRFFVQRLINETILV
FT                   SEDQDLYQLIKVKYPKAYECAKKIAEYVYQTYHRDLTSEEMLYLSIHLNRLIKREN"
FT   gene            222617..224476
FT                   /locus_tag="BPUM_0209"
FT   CDS_pept        222617..224476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0209"
FT                   /product="PTS beta-glucoside transporter subunit IIABC"
FT                   /note="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system; catalyzes the phosphorylation of
FT                   incoming sugar substrates concomitant with their
FT                   translocation across the cell membrane; IIB is
FT                   phosphorylated by IIA and then transfers the phosphoryl
FT                   group to the sugar; IIC forms the translocation channel"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60908"
FT                   /db_xref="GOA:A8F9J1"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008784.1"
FT                   /protein_id="ABV60908.1"
FT                   /translation="MSYRQLAEDIMKHIGTEKNVHSLVHCATRLRFTLNDRSKADKAAI
FT                   EKLNGVVTVMESGGQFQVVIGNTVPEVYREIGEFTNLLEESTSSSAKSGGESTSLFGKF
FT                   VDIVSGIFTPLLGVMAGAGILKGLLGICINAKWLTPEDTSYQILFAASDSLFYFLPLLL
FT                   AFTSARKFKANPFVAVTIAGALIYPTIQELSKGGGDVTFFGIPVVLMSYTSTVIPIILA
FT                   VFVMGYIERFFNKVIHESVKNFITPLILLVTVVPLTLIVFGPFGVYAGNGIAAVLLKVF
FT                   SFSPTLAGALIAMAWQVLVIFGIHWGLVPVILNNIAVHGKDHIKPATAPAVFSQAGASI
FT                   GVMLKTKNKKLKSLAGSTAVSAVFGITEPAVYGVTLRLKKPFIAAVISAGVGGAIIGYS
FT                   QSIAIASGLPSLLTLPIFYGQGFTGFIMGISVSFVLSIVLTYLIGFKDPVDEDETPAPA
FT                   AAPTLENEHGVKAAHVKSPLKGEVIKLEEVQDKAFSSGALGKGAAIIPSEGKLFAPVSG
FT                   VVTTVFPTGHAYGLTSESGAEVLIHIGLDTVQLGGQHFTPKVVQGQTITEGELLAEFDI
FT                   EAIQASGLSVTTPVIITNSGEFSDIIETEEKQITPGQSFLHLV"
FT   gene            224495..225916
FT                   /locus_tag="BPUM_0210"
FT   CDS_pept        224495..225916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0210"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60909"
FT                   /db_xref="GOA:A8F9J2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217071.1"
FT                   /protein_id="ABV60909.1"
FT                   /translation="MRYSTLAPFPKDFFWGGSTSAYQVEGAWNEDGKGPSVIDMRASYP
FT                   EGTTDFKVASDHYHRYKEDVKMFAEMGLKAYRFSIAWTRIIPNGDGEINQKGIEFYHSL
FT                   IDELRRYDIEPIVTMYHFDLPHALQVKGGWSNRATVDAFERYAKVLFQEYGQKVKYWLT
FT                   INEQNMMILHGSALGTLDPNLENPKKELYQQNHHMLVAQAKAMTLCHQMLPEAKIGPAP
FT                   NIALIYPASPKPEDVLAAANYNAIRNWLYLDMAVYGRYNNLAWAYMKEKDILPVIEEGD
FT                   MDILKSAKPDFIAFNYYTSQTVEASKGDGNDEFARGGDQHLKSGEDGVYKGGNNPYLSK
FT                   NAFGWEIDPVGFRSTMREIYDRYQLPLIITENGLGAFDKLEEDGSIQDDYRIDYLEKHI
FT                   EQIKWAITDGVEVFGYCPWSAIDLISTHQGCSKRYGFIYVNRDEFDLKDLKRIRKKSSY
FT                   WYETLIQQNGENIGE"
FT   gene            226387..227124
FT                   /locus_tag="BPUM_0211"
FT   CDS_pept        226387..227124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60910"
FT                   /db_xref="GOA:A8F9J3"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J3"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ABV60910.1"
FT                   /translation="MFKKTLLVLITLALVISIGSPFSSEASAETHSIHSQELEALVTPT
FT                   VLQNEQANKELDELEMKMGEYIESLPFTEKEFENMTESEQNKVIDQYFNNEEFLALENR
FT                   MKQLDSKSSQSEITTQALPIFFVPIAMTVGRVALMAIRSKGARTALKYLKNRIKGFGKN
FT                   YKIKWDVRNDKGQLRSLVVVLHKGKKKTTRVFAVDNGKIPLIPKTSTWYWHFHVAPKDK
FT                   IHHALRASVPKKYKASLGETILH"
FT   gene            complement(227132..227449)
FT                   /locus_tag="BPUM_0212"
FT   CDS_pept        complement(227132..227449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60911"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008787.1"
FT                   /protein_id="ABV60911.1"
FT                   /translation="MKDRDKICHIYAQKSWHMDSYIIGNREGLIELKSAIDQALKSNVG
FT                   QAELFPSDLEDYTTYVALVDDKEELDSLIMPYIDEDNDDENLIHPVDIVTSHEEKKTPK
FT                   N"
FT   gene            227750..228166
FT                   /locus_tag="BPUM_0213"
FT   CDS_pept        227750..228166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0213"
FT                   /product="ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60912"
FT                   /db_xref="InterPro:IPR021975"
FT                   /db_xref="InterPro:IPR038611"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217208.1"
FT                   /protein_id="ABV60912.1"
FT                   /translation="MNDKQQVLDPGPFFHGTKAELKIGYLLEPQYLSNFQEKKSNHIYF
FT                   TGTLNAAKWGAELARSDAKERIYLVEPLGEFEHDPNLTDKRFPGNPTRSYRSKSPLKIV
FT                   AELGSWERHSDEEIEHMLSSLKKLSEEGKNVIYD"
FT   gene            complement(228225..230144)
FT                   /locus_tag="BPUM_0214"
FT   CDS_pept        complement(228225..230144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0214"
FT                   /product="transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60913"
FT                   /db_xref="GOA:A8F9J6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216960.1"
FT                   /protein_id="ABV60913.1"
FT                   /translation="MMMTADPRTYQLIQRLFETKGFVKLEELTASFRLSDRSIRHLIKE
FT                   ANEQLKEAGAKIKTIRGKGYTLLTSDQDAFLLWLHQQKLPARSLVPVMPEERVRFIMRK
FT                   LLLQQDYLKIDQLAEELFISRMTVSSDLKKGRELLARYGMALVSKPGFGLKIEGDELQK
FT                   RTCYADLLLEEEPALSHITEREQLHFPDISLETIRSIVLTNLHQESLLIKDIALKNLVI
FT                   HLAIAIQQTRKNQRIPASTTRTQRSPVLVRIAQKIIHQVSDTFHVTLSEDETDYLVMHL
FT                   LANQTWKEAAQHQTTVEVQQAVAVFLQHIEKMSGHRFADDNILQQDLMLHMKPLLNRIQ
FT                   YGVSLQNPLLHEIKTSYPYPFDLAVSGLNALQLVRTPNEDEAAYVALHIAASFERSQLD
FT                   TSQKKKAIIVCGSGLGTARLLEIKLKTAFQHELDIVELYSYQDYLMSTTLPCDVIITTV
FT                   PLASKGKPVIQVSAFFEQHDVQQVNEVIHLLNGHGTPSQELMAFFQERLTILNADLSGK
FT                   DEVLDALCSRLETYHLVSSSFRSSVLEREQMSSTYLGKGIAMPHPLITNEGTSCVAIAH
FT                   LKQPIDWQGNQVSLVFLLAIHKDDAAYMNQFFEQAVDLLDNPNRIHSLNQSKTFDELMN
FT                   ALFQ"
FT   gene            complement(230141..231025)
FT                   /locus_tag="BPUM_0215"
FT   CDS_pept        complement(230141..231025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0215"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60914"
FT                   /db_xref="GOA:A8F9J7"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008790.1"
FT                   /protein_id="ABV60914.1"
FT                   /translation="MRIGGIEAGGTKFVCGYGTTDGTIEHMTSFATGNPIETCQQVIDY
FT                   FTKHPVDAIGIGAFGPVDVKEHSPSYGTILETPKTAWRQFPFLSTLKQALGLPMKLDTD
FT                   VNCAALGEARFSLEAEKPASLVYITVGTGIGGGAYIEHRLIHGLLHPEMGHITVQRHPH
FT                   DSYGGCCPIHHDCLEGLASGPAIEGRYHTLAPMLPEDHPTWSLHAYYLGQMTANLLLTL
FT                   SPERIILGGGVMKQPAMLPLILEETEKRLHGYLQLPKPLNKIITKPSFDGLSGLMGAIA
FT                   LGTDALQAKGAAQ"
FT   gene            complement(231083..233746)
FT                   /locus_tag="BPUM_0216"
FT   CDS_pept        complement(231083..233746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0216"
FT                   /product="alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60915"
FT                   /db_xref="GOA:A8F9J8"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358745.1"
FT                   /protein_id="ABV60915.1"
FT                   /translation="MTVNVHVIPHTHWDREWYFTTSRSRIYLMKSVMDILDTLETDDRF
FT                   HYFMLDAQASLLDDYLKWRPEDENRIKKLVTAKRLIIGPWYTQTDQLVISGESIVRNLQ
FT                   YGIERCQQFGHVMKVGYVPDSFGQSAQMPQIYRGFGIVDTAFWRGVSDHMTNHTEFNWQ
FT                   GADGSEVFAVNLPFGYYYGGNIPEKDEDLQAFLSEKIGALQAKATTKNVYFPNGFDQAP
FT                   IRKNLPDLLEKANELDEHHYQISSLEDYIAAVKKERTSFETLQGELIHAKHMRIHKSIF
FT                   STRADLKILNNQIENYLVNVMEPILTISYSLGHDYPHDTVRDIWYLMFENAAHDSIGGC
FT                   NSDTTNQDVFFRYKQAKEIAENLVDLHMRLIAIRLQTEQEITLTLFNTLPSKRSEVIEV
FT                   ETFITERPFTLKDAHGRTLAYTVKSKTNVTDYVLAQQISLNPSKEVYMPKQVWKAVLLI
FT                   EATSLPSVGYTQVSMVFDESSESVWEQTDGHAIENTYYRITANDNGSLDITDKQTGRTF
FT                   SEQMSFEDNGDDGDSYNYSPPREDLYVSSIDLSSADIAVSRSGLQEELTVQLTLTVPYD
FT                   LEERSQQTVTTSLPITAKVALNKDEPVIRFHVDVDNHALDHRLRVLFDTGIASKVSLSD
FT                   QQFGTIERPTELTQELEWWNNEHWEEKPITIEPMQSFTALRDEAYGVALLTDCVREYQI
FT                   TGEDYTTIAYTLFRCFGKMGKENLLYRPGRASGEKIVETPDAQLQGALSFSFGMHYSKD
FT                   AVSEGHLAQLAKRYTTPVQCYERADFLNGRLIFSFRDEKEDLQSTYSLLDIETDGAILS
FT                   ALKKEEHGTGIVIRLFNPFLTRQTAASINSSSLQHGETANLGETPEGHILKAQHGSLHI
FT                   EPLTPCQVQTYIVKKK"
FT   gene            complement(233775..234893)
FT                   /locus_tag="BPUM_0217"
FT   CDS_pept        complement(233775..234893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0217"
FT                   /product="PTS fructose transporter subunit IIC"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60916"
FT                   /db_xref="GOA:A8F9J9"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9J9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008792.1"
FT                   /protein_id="ABV60916.1"
FT                   /translation="MKAKLKVIEGHLMTGISYILPVIIGASLIVGLAKLVGLGFGVSDL
FT                   NAYKDAGGILHGAYLMEQVGWTGIGLMNVLLAGFIAYSIADKSGLAAGFIGGALASSTN
FT                   AGFIGAVIAGFFAGYVALFVKRKIQIQGSAAGLVPLLILPLITVGLTGLLMSVLLGGPL
FT                   GALNTALIEWIKGMVADGTSTLALALILGAMIGFDLGGPVNKSAWMAGNALFLSGIYLP
FT                   AILVNIAIVIPPLGYGLATLIRKRNFSPTFREAGRGSLVMGIIGITEGAIPFTLVNPLK
FT                   LIPLNVVACAAGSGVAALLGVHDIMPPIGGLYGFFSVGNWWAYLIGALTGALVIGIGAN
FT                   LLVNFSEKKEPKTPEHDQKQKEEDDFDLVLEG"
FT   gene            complement(234933..235259)
FT                   /locus_tag="BPUM_0218"
FT   CDS_pept        complement(234933..235259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0218"
FT                   /product="PTS fructose transporter subunit IIB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60917"
FT                   /db_xref="GOA:A8F9K0"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008793.1"
FT                   /protein_id="ABV60917.1"
FT                   /translation="MKIVGVTSCPAGLAHTPMAAKALENAGKQLGHEIKIEQQGIMGQV
FT                   NGITAEEAKQADLCIIASNQHINDAERFSGIPTVRVEIGRALKNAEQIITKAVALVEKK
FT                   KSES"
FT   gene            complement(235256..235714)
FT                   /locus_tag="BPUM_0219"
FT   CDS_pept        complement(235256..235714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0219"
FT                   /product="PTS glucose transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60918"
FT                   /db_xref="GOA:A8F9K1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366530.1"
FT                   /protein_id="ABV60918.1"
FT                   /translation="MFQKDHVFTQVNGRSKNEILQYIAEKAEDLQITNDQAGLLSDLLT
FT                   REDEVSTGLQQGFAIPHTKSSAVQTASLLFLELEQPIEWGSFDDLPTSYLFTLLVPLEE
FT                   ANVTHLKLLSGIATSLMEPAFIEKIQPGQTANYYYEVIEQQLKEGITQ"
FT   gene            235956..238625
FT                   /locus_tag="BPUM_0220"
FT   CDS_pept        235956..238625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0220"
FT                   /product="peptidase S8"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60919"
FT                   /db_xref="GOA:A8F9K2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034084"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217254.1"
FT                   /protein_id="ABV60919.1"
FT                   /translation="MFKKQVKSCVIVLMAIILCMAALPGYEAAAASKGTNVNEAIGLKN
FT                   GEVISGTLQNEMEESWYQITPSAQEVVKDTHMKISVKSKQVLSVSVYPSKDRAMKDDTY
FT                   SRYRVDTASGETEVDFPHAWSGPYYVKVLYLGSEEDSRDEEEDAAYTIGYKGANLPPSE
FT                   PVFPEDDEFDIIIIEKKYGREILQSIRTIEDKRFNETPNGQKLSRVLQKTKPFLKSKLI
FT                   KQKNEQQKVYNHLLTLKSLLNDVEKNGAFSGHIVTEKEQQAIRSLFDMLKGASPAYLKK
FT                   ELEAVSQQIGIDQLEGKSIGYVLEKQKLVKEENVKTNKIIFKLKDGQTLQSAKKKMKSY
FT                   GIQENRVTSQSVSPLFKGMYVYDVPAGQESAGETLKAGKAVIKSTARKLSSMPNVEFAE
FT                   PVQTYRALSNDVQYGYQWPLKNSGQNSGKKGADVKFDQMNTLIGTSKMKQTLIAVVDTG
FT                   VDSRLTDLSGTVRTDLGANLIGRNKDAIDDNGHGTHVAGIIAAKADNHYSMAGLNQHTG
FT                   IIPVKVLDAYGFGDTEHIALGIKHAVDKGAKVINMSLGGYYSRVIEYAMNYAAQRNVLV
FT                   VVASGNDGVPEMGYPATSKYAMAIGASNRMDIAAEFSSFGKGLSMSAPGSDIPSLMPDG
FT                   NVSYLSGTSMATPYVAAAAGLLLSKNPTLKPNQVRNILQSTADNISFTSVDGTDDVFYD
FT                   ENEEPIVDPKIPGVDWMTGHGRLNAFAALSAVELNASVSKVEDQHQKVTGKAKAGAAIS
FT                   VYRGKTLLGTGTAGKNGTFSVKIKHQNKNKVLHIKISKGKAATTLKTVVKKGKAPAKPK
FT                   VGKVTVKSKTVKGTAGAGLTIKVKNKSKKVIKTVKTNNKGAFTAQIKPQKAKTVLYVTA
FT                   SDVRKRESKAVKVVVVKK"
FT   gene            238732..239214
FT                   /locus_tag="BPUM_0221"
FT   CDS_pept        238732..239214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60920"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217020.1"
FT                   /protein_id="ABV60920.1"
FT                   /translation="MKKIMFAFFLSLLLVFPTFAHAEETGAVPASVQVTSVTAADSGLV
FT                   NYGYGSKYRVGSYYPATFKGTLKDASGNLMPNQPVQLYFEAAIKSYAQTATGTTDGNGQ
FT                   FSLTFQVPAGAGYQSYNNAGWSTHYYDVVPVTFTSKDIKLSSNVTSVYHLAYTSRY"
FT   gene            complement(239558..240178)
FT                   /locus_tag="BPUM_0222"
FT   CDS_pept        complement(239558..240178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60921"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008797.1"
FT                   /protein_id="ABV60921.1"
FT                   /translation="MEMTITRALSELKMLDKRINRTVDEAVLGGLMIGKHIQHGFQHQE
FT                   EIEKKAKADDQSIQALIKRRNAIKSAIVVSNATTTIDVAGVSMTVAEAIERKTSIEYDI
FT                   RYLRKLKKVYTELVDKAEQTNADVKKRLDQHLETLFGKDGKTQAAANQEIVKSFLAENE
FT                   ATIIDPLHLRVKIEKLSTEIEDFQMEVDFSLSESNTLTKIQVD"
FT   gene            complement(240300..241703)
FT                   /locus_tag="BPUM_0223"
FT   CDS_pept        complement(240300..241703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0223"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60922"
FT                   /db_xref="GOA:A8F9K5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008798.1"
FT                   /protein_id="ABV60922.1"
FT                   /translation="MEQAKDQSQQYQRKMTSRHLFMLSLGGVIGTGLFLSSGYTINQAG
FT                   PAGTILAYLVGALIVYLVMLCLGELSVAMPVTGAFHTYATKYIGPGTGYTVAWLYWLTW
FT                   TVALGSEFTAAGLLMQRWFPDTSVWMWSGVFALLIFLLNAFTVKFFAESEFWFSSIKVM
FT                   AIILFIILGGAAMFGLIPLKGGEAAPFFSNFTGEGGLFPNGFLPILMTMLAVNFAFSGT
FT                   ELIGIAAGESVNPDETIPRAIRTTVLRLVLFFVGTIVVLAGLIPVEEAGVIKSPFVVVF
FT                   DRIGIPYAADFMNFVILTAILSAANSGLYASSRMLWSLSEERTLPKKLAKLTSKGIPLN
FT                   ALILSMIGGILSLLSSVIAPETVYLVLVSISGLAVVIVWMGIAASQFMFRKRFLQEGGK
FT                   LHDLSFRTPLYPVVPIAAFFLCLASVIGIAFDPNQRIALICGIPFIAICYAAYYVTAWI
FT                   QKKREEPGV"
FT   gene            complement(241750..242688)
FT                   /gene="mmuM"
FT                   /locus_tag="BPUM_0224"
FT   CDS_pept        complement(241750..242688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmuM"
FT                   /locus_tag="BPUM_0224"
FT                   /product="homocysteine methyltransferase"
FT                   /EC_number="2.1.1.10"
FT                   /note="converts homocysteine and S-adenosyl-methionine to
FT                   methionine and S-adenosyl-homocysteine or
FT                   S-methyl-methionine and homocysteine to two methionines"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60923"
FT                   /db_xref="GOA:A8F9K6"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008799.1"
FT                   /protein_id="ABV60923.1"
FT                   /translation="MNPIQSRLQAHAPLILDGALATELERKGCNLNDSLWSAKILIEQP
FT                   ELIQQVHLDYFQAGADCATTASYQTTIDGFAEKGYSKEEAIELMKRSVTLAKEARDLFW
FT                   QDEASRNGRTKPFVAGSVGPFGAYLSDGSEYKGNYGLTEQALIDFHRPRIQALVEAGAD
FT                   ILACETIPCLIEAIAIAKLLQDEFSGVSAWITFSAKDDLHISEGDLLRECVQALEPYEQ
FT                   IAAVGVNCTPPQYISSLIQEMKKGTSKPIVVYPNSGELYDPEDKVWSGDTPQHTFGECA
FT                   HQWYQDGAHIIGGCCRTTPEDITDILKLTTS"
FT   gene            243023..243854
FT                   /pseudo
FT                   /locus_tag="BPUM_0225"
FT                   /note="hypothetical protein; disrupted"
FT   gene            243952..244269
FT                   /locus_tag="BPUM_0226"
FT   CDS_pept        243952..244269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0226"
FT                   /product="PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60924"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008800.1"
FT                   /protein_id="ABV60924.1"
FT                   /translation="MNAQLKKGLLEFCVLAVLKKGDSYGYQMIKDMSHCIEISESTLYP
FT                   ILKRLEQNNYVETYSQEHNSRLRKYYRMTQSGREHMAQFLAEWDQVMAIYDFISGGQGN
FT                   E"
FT   gene            244262..244849
FT                   /locus_tag="BPUM_0227"
FT   CDS_pept        244262..244849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60925"
FT                   /db_xref="GOA:A8F9K8"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008801.1"
FT                   /protein_id="ABV60925.1"
FT                   /translation="MNKKEFLASLEKHLHRLGEKESDRFIEYYDEMIEDYQEDGYSEQE
FT                   AVHQVGQPAMIAEGILKEQGIKTVQVPTFGEKATRLSILILGFPLWGSILAAVFLLILS
FT                   MYMVIWCIPLVTGTMTLVGLLGGFWSIIGSPFIFQDGLHVVVTQIGVGIFLLGVGLLCG
FT                   MATVYLTKLFVQMTFQTTKAFMGMFKKKVVRV"
FT   gene            244846..245016
FT                   /locus_tag="BPUM_0228"
FT   CDS_pept        244846..245016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60926"
FT                   /db_xref="GOA:A8F9K9"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9K9"
FT                   /protein_id="ABV60926.1"
FT                   /translation="MNVNDLKKQCIKWGIIFTVAGGIVMTIGLALSGFDLDAYDNNDQN
FT                   NVFRTINWSKP"
FT   gene            complement(245226..246443)
FT                   /locus_tag="BPUM_0229"
FT   CDS_pept        complement(245226..246443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0229"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60927"
FT                   /db_xref="GOA:A8F9L0"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008803.1"
FT                   /protein_id="ABV60927.1"
FT                   /translation="MSSLSYPQESKKNRFLLAALLGSLTALAPLAMDMYLPALPHIARD
FT                   FEASTALSQLSLMACLIGLALGQLIAGPISDTVGRRKPLMIGLIIFIAASLLCTVVSSI
FT                   WMFILLRLIQGLAGSAGIVIARAIVRDHYEGSEMTKFFALLMLVNGVAPAAAPIVGGQM
FT                   LRFTTWQGVFVLLGILGTLMLLRSIFSLQESLPAERRQTGGFQQIVSAMKILASDRLFV
FT                   GYALSQGLVFAAMFAYISGSPFVLQELFHLSPQGFSAAFAVNSLGIITAGQEFARVAAK
FT                   IGEEKVLRIGLLIATLGGVTLFLMISIDAGLYGILIPLFFVVSSVGIVGTSAPSLAMQH
FT                   HGAHAGSAAALIGVAQMLLGACVTPLVGLAGSQTAFPMGLIIMLCELGALCCYFFFVVR
FT                   AKKRPA"
FT   gene            246656..247204
FT                   /locus_tag="BPUM_0230"
FT   CDS_pept        246656..247204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0230"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60928"
FT                   /db_xref="GOA:A8F9L1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008804.1"
FT                   /protein_id="ABV60928.1"
FT                   /translation="MEQQELIIRQAVKEDHEAIRHVLIKSYSQYEPQFTEEGWQNYSAA
FT                   LAAAVDNPNMELMLVAELEGQIVGTLQMFRSSEQAYDKPEMGITSAIVRFLGVDPDVRG
FT                   KGIAESLLRKSIELTQSWGENVLYLHTSDKMQAAIRLYERMGFERALDKEFVNQNGTHV
FT                   KSYQYVIQKEQPARSSHHS"
FT   gene            complement(247251..247454)
FT                   /locus_tag="BPUM_0231"
FT   CDS_pept        complement(247251..247454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60929"
FT                   /db_xref="GOA:A8F9L2"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008805.1"
FT                   /protein_id="ABV60929.1"
FT                   /translation="MNGITILENLTQLGQIILIFCGYALYRQLVKTKRERKLSPYERML
FT                   KFFVMFGLISWGVSYWALVLWA"
FT   gene            247569..248108
FT                   /locus_tag="BPUM_0232"
FT   CDS_pept        247569..248108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60930"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008806.1"
FT                   /protein_id="ABV60930.1"
FT                   /translation="MLISLHVDRWNEVIERKIKYDQKVVEHTCQLLDAQGQKMVLFHKI
FT                   EETFTMSADDDTLTIPKGSYTTAYYWKDRPYNMYFWRDDQGEELGSYFNMVGHTWFNGQ
FT                   LVMFEDLIVDLLVLPNGDFFVLDEDELPESLADFEQGSVRRALEAVMASLESILDQVRA
FT                   DADGNYHHSLFVPLLK"
FT   gene            complement(248148..249779)
FT                   /locus_tag="BPUM_0233"
FT   CDS_pept        complement(248148..249779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0233"
FT                   /product="peptidase S8"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60931"
FT                   /db_xref="GOA:A8F9L4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="InterPro:IPR041909"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358617.1"
FT                   /protein_id="ABV60931.1"
FT                   /translation="MQGAIALKKKIVVVMAFLLALSTALPYHSQAAAPPKETDVIIVYK
FT                   NQKGKQTAIEESEKVNAQYIHLPAVAVTADEQAVTSLKQDPNIAYVSKNIKVKLASSTM
FT                   KQTAAATGQNFLVQQSYNLQKLNVKQAIKEGVTGKNVKVAILDTGISPHEDLKVSGGKS
FT                   FVKYTTSYKDDQGHGTHVAGTIGALNNDYGTVGVASGAKLYAVKVLDKKGEGDLYSLLR
FT                   GIDWAISNKMDIMNLSLGFEDNIPILRSAVDEAYKKGLLVVAASGNDGKKNFISYPAAY
FT                   NSVIAVSATNEKDKLVSLSNTGKGIEFSAPGEKVISTYLKNEYWYATGTSQAAPHVTGM
FT                   LALLKQLHPKKTNVQLRTLLRSYTVDLGAKGKDPQFGYGRVQYIPQSSFLKTATSAVKT
FT                   AETSKKQADVNQAKTRIGRLTASKQKTALTERVKKVQGTIDIRSARAKVQTAEKSKTQG
FT                   AIKSAQTAIKKLNKGKEKTSLQNRLDKVKKQLAYQKKVTDAKQKVKKAEAKRTKKTKAA
FT                   AQTAVKQLKASKTKTSLQKRLNRIKV"
FT   gene            249947..251428
FT                   /locus_tag="BPUM_0234"
FT   CDS_pept        249947..251428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0234"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="catalyzes the hydrolysis of a monocarboxylic acid
FT                   amid to form a monocarboxylate and ammonia"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60932"
FT                   /db_xref="GOA:A8F9L5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008808.1"
FT                   /protein_id="ABV60932.2"
FT                   /translation="MNVKEYMTYDATGLAALVRNKQVTPDELVQAAFARLNEVNPELNA
FT                   LTQTRQDQVVKEMKTLHTNQPFAGVPFVLKNISQGLENEPLTAGAALLKDVKAKTDSHF
FT                   VQRLKQAGFLMVGHTNTPEFGLRNVTEPALHGPTRNPWHPDYSPGGSSGGTAAAVASGI
FT                   VPAGGASDGGGSIRIPASFTGLFGLKPTRGRTPVGPGAGRQWQGASIDFTLTKTVRDSA
FT                   ALLDLLQVIQPEAAFQTPLYAGSYQEDLVKRTSSMRIAYSVESPVGTKVSEEAKQAVQQ
FT                   TVKWLSDQGHQVEEAKPAIDGIHLMQQYYVMNSGEMSALFMSLNRSLGRPVNPEETDIV
FT                   AWVLAEAGKNVTAAAYTESLDAWDMAAAQMASFHQTYDLFVTPATAYSAPKVGELMHSK
FT                   EEITQLLRVSSLSMQAQQDLIYDMFLKSLTYTPFTQLANLTGQPSMSVPVHLTEAGMPL
FT                   GVQVTAPKGKEDWLLRLAAEMETSSIWKGTNQLIR"
FT   gene            251466..252029
FT                   /locus_tag="BPUM_0235"
FT   CDS_pept        251466..252029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0235"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60933"
FT                   /db_xref="GOA:A8F9L6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008809.1"
FT                   /protein_id="ABV60933.1"
FT                   /translation="MSTKDRIIQTAALLLRKQGYHATGLNQIIRESGTPKGSLYYYFPN
FT                   GKEELAIAAVEYISQKVINRIEESFAYSDDPYLAIECFMTNIIRGFTEQENERGIPIVL
FT                   LAAESKPEHTQLHTACKQEMIRWQKLVKEKLMNSGYEENKADELASLLHSMVIGGLSMT
FT                   TALKQTTPLEHVKCYLRHLFMRDE"
FT   gene            252110..253132
FT                   /locus_tag="BPUM_0236"
FT   CDS_pept        252110..253132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0236"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60934"
FT                   /db_xref="GOA:A8F9L7"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217252.1"
FT                   /protein_id="ABV60934.1"
FT                   /translation="MSEQPQSIKQSEGTSFYTVSGSGKLYGLENQLVHVLAEANQTNQL
FT                   FELVLITGGKGAYFPLHCHEHLFETIFVLEGKLEVILDGKKYMVTAFDYIHIPPKTIHG
FT                   YRMHSHKTRFISYTLGGKMTDVYQQIGKKLKRNEWPMTDLAFDAASFEQAEKESDLILM
FT                   HGIRQLSNTTKPSVLFHSLLPQAVQPYVLEAGEGKQYIVDGQLHELIATTETTGGGFTH
FT                   FVIEGAKGKYFPPHYHQVHTEALYCVEGKMNLQLNGEDICLMPGDFAYIPPYTVHSYEF
FT                   VSHSNKFLLLLLPGKIEQLYEQFEEAQSPSICPYFIQEGNLMIDRETSSQYDLVFIEKG
FT                   "
FT   gene            253282..254415
FT                   /locus_tag="BPUM_0237"
FT   CDS_pept        253282..254415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0237"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60935"
FT                   /db_xref="GOA:A8F9L8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008811.1"
FT                   /protein_id="ABV60935.1"
FT                   /translation="MRAVTYQGKNSIAVKKVDAPSIQDREDVIIRITSTAICGSDLHLY
FT                   QGNFPLPIGYVIGHEPMGIVEEVGPDVTAVKKGDRVVIPFTVACGQCQYCHHHLESQCD
FT                   NSNPHYDSGGLFGYSEKYGNYPGGQAEYLRVPFGNYTPFKIPDDCELEDEQLLFLSDVL
FT                   PTAYWSVEHAGVKKGDTVIVLGCGPVGLMAQQFAWQKGAERVIAVDYIDYRLRHAKQMS
FT                   GVEVFDFTEDPDMGETLKELTKGGADVVIDCVGMDGKKSPLEKIEQKLKLQGGTIGPIQ
FT                   IATKAVRKCGTVQMTGVYGGLYNMFPLGAFFARNVTLKMGQAPARGYMSKLYQKVTTGE
FT                   IDPRAIITHQLPLDDAAHAYHIFNDKKDDCIKVILKP"
FT   gene            complement(254438..254875)
FT                   /locus_tag="BPUM_0238"
FT   CDS_pept        complement(254438..254875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0238"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60936"
FT                   /db_xref="GOA:A8F9L9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9L9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217154.1"
FT                   /protein_id="ABV60936.1"
FT                   /translation="MQHFELEASLLDHALTKYLKATKQIDEENIPKNVTNVKGFILRII
FT                   YRHQSCTVKNILQEVSLSPSATTTALNHLEDEGLIIRSRNNNDRRTVWIELSESGEQIA
FT                   KQMIDNRQLLVNQLFNHLSEEDKKTFFELIEKMMDEHTLKA"
FT   gene            255137..256645
FT                   /locus_tag="BPUM_0239"
FT   CDS_pept        255137..256645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0239"
FT                   /product="acyl--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60937"
FT                   /db_xref="GOA:A8F9M0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358612.1"
FT                   /protein_id="ABV60937.1"
FT                   /translation="MNTLQALLNDRMERSSQIEAVTGGGVSYTFEEYAKRIDQLAHYLH
FT                   QKGIRKGHRVCFICQNHHHFSTIMLAAIKAGAVAVPLSWQLTSFELEGILKKAEPKALF
FT                   FDREFRDIIAAVNVSLEDCLMVESGVNAKTTQLFEDILASNDGSKLAVEVSEEDLAMIL
FT                   FTSGTTGNPKGCMVGHGRIYQFLTRRGNRGFDLKGKRYLASHPLYHMSSINHLIAAAIE
FT                   GYTLVFLHDATPKRILETIEKERITFMMAFPSAYTYMLEEMKRGSYDLSSFEIAISGGT
FT                   KVPVRLIKDYKEVGIQMMHGYGSTEAWVVSAWHPAMGEDKMGSAGKVDPDVEVKIVHPE
FT                   TDETLPAGEIGEVVMRSPFYFLGYYHQPDATEKVLKDGWFHMGDAGYLDEDGFLFITGR
FT                   YKDVILYGGDNIYPDQVEEVIDQIPGVIESAVIGVPDELYGEVPSAYIVKDDSVDFCEE
FT                   DVVNYCQERLADYKVPSIHFTQELPKNKLGKIMKKDLRELVVNA"
FT   gene            256712..258094
FT                   /locus_tag="BPUM_0240"
FT   CDS_pept        256712..258094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0240"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60938"
FT                   /db_xref="GOA:A8F9M1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358611.1"
FT                   /protein_id="ABV60938.1"
FT                   /translation="MRHILRKKHIHDLLEQSRQQKVKKTLGGLDLTLLGIGAVIGTGVM
FT                   VLTGITAAKDAGPAVIFSFAIAAIVCSLAALCYAEMASALPVFGSAYIYSYTTMGELIG
FT                   HLMGWTLLSVYMLTASAVASGWSSYFNSLLEGFGISIPHQFLAGPEQGGYMNLPAIIIA
FT                   LLIAWILSRGTKESKKFNNIMVFVKLGIIVLFIVVGGFYVQPANWQPFMPFGAEGVIAG
FT                   AAAVFFAFLGFDAISASAEEVKNPQRNLPIGIIGSLLICTIIYIVVCLIMTGMVHYTKL
FT                   NVTEAMSYVLQSVHQNSVAGIISVGAVIGLMAVIFANNYAATRIAYAMGRDGLLPKVFS
FT                   KTNKSDTPVASIWMIGGMTAVISGFIDLKDLSNLANIGALLTFAMVSLSVLILRKTHQQ
FT                   LERGFRVPFVPVLPIISMGCCLFLMLNLPGRTWLYFGVWLLIGVVMYAAYSNKHSELAK
FT                   SS"
FT   gene            258195..258560
FT                   /locus_tag="BPUM_0241"
FT   CDS_pept        258195..258560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0241"
FT                   /product="glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60939"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217104.1"
FT                   /protein_id="ABV60939.1"
FT                   /translation="MISVSPYIVVDDVKESLQYYQGIFGGDIHILNEHQDRVLHAELHL
FT                   GKSLLHFSDTFGRTPKPEHLRLIMQFDNEEELKAVYEALEADGDVLVELQDTFFGALHG
FT                   QVQDRKNGLIWVLNYMK"
FT   gene            258869..259729
FT                   /locus_tag="BPUM_0242"
FT   CDS_pept        258869..259729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0242"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60940"
FT                   /db_xref="GOA:A8F9M3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008816.1"
FT                   /protein_id="ABV60940.1"
FT                   /translation="MEQIEFQSIQTNGVTLHTAMAGPEDGPLLILLHGFPEFWYGWKNQ
FT                   IMPLAEAGYRVVVPDQRGYHLSDKPEGIESYVLDQLRDDIVGLIKTLSGNQKAIVGGHD
FT                   WGGAVAWHLASTRSQYVEKLIIVNMPHPRVMMKVLPFYPPQWKKSSYIAFFQLPNVPEV
FT                   ALQENHFQKLDEAIGLTARPHLFTKEDVSSYKLAWTQPGAMTSMLNWYRAIKKGGFEKP
FT                   ISKRILVPVRMIWGMEDKYLSRKLAKETMKICPNGQLIFVDDASHWINHEKPEVVNKLI
FT                   LEFLN"
FT   gene            complement(259769..261184)
FT                   /locus_tag="BPUM_0243"
FT   CDS_pept        complement(259769..261184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0243"
FT                   /product="sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60941"
FT                   /db_xref="GOA:A8F9M4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008817.1"
FT                   /protein_id="ABV60941.1"
FT                   /translation="MNGLLTTTNGFLWSYIIVALLIIVGLYFTFRSRFLQVRMLKEMVI
FT                   VLKEGTNKQKSGVSPFQAFAISMAARVGTGNITGIAIAIAMGGPGAIFWMWILAIIGSA
FT                   SSFVESTLAQVYKVKDASGFRGGPAYYIEKGLKKRWMGILFAVLITISFGIVFNAVQSN
FT                   TITIAFENSFGTNRLLVGVIMAIGFSIIIFGGVKTIAKMAEYIVVFLAVAYIGVALFVM
FT                   ITNITELPGVIQTIISHAFGIEQFAGGTMGAVIMEGIKRGLFSNEAGMGSAPNAAAAAV
FT                   TSHPVKQGLIQAFGVLIDTLIICTSTAFIVLFSSAYKTTKLTGIELTQASLSEHIGPWA
FT                   SGVLAIMVFLFAFSTLIGNYYYGETNIEFLKSSKAWLIGYRIAVIAMVLFGAVASVPFV
FT                   WNLADLFMGLMVIVNLIAITMLSKVAFAALKDYSRQKKEGKDPVFYKNAVPNNENIECW
FT                   DDEPASLKKNHIG"
FT   gene            complement(261215..262195)
FT                   /locus_tag="BPUM_0244"
FT   CDS_pept        complement(261215..262195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0244"
FT                   /product="glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60942"
FT                   /db_xref="GOA:A8F9M5"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008818.1"
FT                   /protein_id="ABV60942.1"
FT                   /translation="MKTAISNNTQHACQSSVDQWAEEIRPYYKNGQNAGYIPALGKVNS
FT                   SQLGISVIGPDGSSVRYGDWDVPFTLQSISKVISFIAACLGRGVPYVLDRVDVEPTGDA
FT                   FNSIYRLEMHKPGKPFNPMINAGAITVSSILPGKTSTEKLAYIFDLIENLIGKRPSVNE
FT                   EVYQSEWATAHRNRALAYYLKETNYLESDVEETLEVYLKQCSIEVTTEDIALIGLIISS
FT                   DGYHPFKQVQVIPKDIARLTKALMLTCGMYNASGNFAAFVGVPAKSGVSGGIMACVPPS
FT                   ARREFPFQTGCGIGIYGPAIDDCGNSITGVMMLKKLAKEWDLSIF"
FT   gene            262713..263999
FT                   /locus_tag="BPUM_0245"
FT   CDS_pept        262713..263999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0245"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60943"
FT                   /db_xref="GOA:A8F9M6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008819.1"
FT                   /protein_id="ABV60943.1"
FT                   /translation="MSLNQLVKKDAFILIFMVVIVPLAGELKFYPVNETFRISFGAPAF
FT                   FFCLLLLRKSRPFLPGFLTGAAIVLFRVGLDLIQHHAGFAASFYQQFPSFFFYFTYAFL
FT                   FFAVRTGRFKQRSIFIGIIGLIIELLADFVELFVQYLVFDTTMTLSKLSDMFLIAFAHS
FT                   FVVISFFNMMKLYEAQSREKQIMKQNEHMMMVISNLYEETVHLKKTLKHTEHITQESYR
FT                   LYRLLYEHEAGKEVSQELLKLAGEIHEVKKDNQRIYAGLSKLISKENMQDYMKAEELVQ
FT                   IVLRIQEKYALSLGKNISFTSDIRGIHLHDYHVFIFLSLINNLMANAVEAIEGNGMISL
FT                   VLKGSHDKIEIRIEDDGPGIPEKMRDIVFDPGYTSKFDAYGTPSTGIGLSYVKELVKEL
FT                   GGQIKIEQRETKGTAFQLILPIQNLIQRG"
FT   gene            264004..264945
FT                   /locus_tag="BPUM_0246"
FT   CDS_pept        264004..264945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0246"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60944"
FT                   /db_xref="GOA:A8F9M7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008820.1"
FT                   /protein_id="ABV60944.1"
FT                   /translation="MRFFIADDDRAIRSILGQIIEDEDLGEVVDEADDGVGLEAHSLNL
FT                   KKIDILLIDLLMPARDGIQTIRHIHPEFKGKIMMISQVEAKEMMAEAYELGIEYYIHKP
FT                   VNRIEIVSVIRKVIERIKLEKSIYDIQASLRHVLPLEPVISHHTTGTGLKKRTMKEAGE
FT                   FLLSELGIVGESGSKDLLEILIYLHETQSANSHEVNFPPLKQLFIKTAERKLDHGATDV
FT                   EVMREVKAAEQRIRRAIHHSLNHFASLGLTDFSNPKFEHYASKFFDFTDVSQRMKEMQK
FT                   TSPSAGSTGRVNTKKFVQIFYFEAKQLFEGMS"
FT   gene            265137..266222
FT                   /locus_tag="BPUM_0247"
FT   CDS_pept        265137..266222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0247"
FT                   /product="sec-c motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60945"
FT                   /db_xref="GOA:A8F9M8"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216955.1"
FT                   /protein_id="ABV60945.1"
FT                   /translation="MGKIKRNALCPCGSGKKYKHCCGQKSGGEQTSELVFKEAVQVQKD
FT                   LMNYAFSKHQRAINQFINEFSFLADMDKETQQISVFHLSVWGIFFRPLTDQKETIFQEF
FT                   LTKKAEDITRPKTKQVVQSWTDMEPSLLLLNEKTDESLYFENMVTAEKVEVDVKPDQTV
FT                   LPEKGSLVLGFPVQFEEKAEFFIQYTMFAKEFTDTLLLQVRQLVEAYEANGGTRSTFMR
FT                   ESFPDVLECMFAKQEVEESETFAQTEGDTGLTADRMDWASDVQLETAKLIEDGMKEHGD
FT                   QSLTDGALTVWKAYCDQKSPVIRKAASFAAGIEYYIHSLASDAPLSQAQIAKKYGISAS
FT                   TVSSRFKDIEKAVKEEQEATV"
FT   gene            complement(266277..267317)
FT                   /locus_tag="BPUM_0248"
FT   CDS_pept        complement(266277..267317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60946"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9M9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217135.1"
FT                   /protein_id="ABV60946.1"
FT                   /translation="MNLKKISALLMISFVMIISAACQSSAKSSNADQKSTKKAEVKVDS
FT                   YEYTLPEDSSTTLRDNELVLKVNLTITNKGDKALSLYSSDFSLYQDDAKVSDLKFYGSK
FT                   DRLDLGSLNKGKSQSGALYFLVDKGKKYQFVYQDSIKKNSDSIEISLDGNKILDTAKKL
FT                   DNPAKALSAYTDIIVFDKKNDQFADLTGDNQSDVVNKYHDMFVKDFKRTAGMYGNEVSD
FT                   RDILSMYKRIQDTMKDKTKVETSVKTISNDEAKVVAQVTGIDATNLKDKLDKQRDEFYN
FT                   GKIGSKEELYKKSLNLYASEFEKLPPVSSPTEYEVKMKRNGDGQWKIDLNDYNTSQYMS
FT                   GFIKTR"
FT   gene            267714..268643
FT                   /locus_tag="BPUM_0249"
FT   CDS_pept        267714..268643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0249"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60947"
FT                   /db_xref="GOA:A8F9N0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008823.1"
FT                   /protein_id="ABV60947.2"
FT                   /translation="MKKVTLGRTNLQVNPIGLGTNAVGGHNLFPNLSEDAGRELVETAL
FT                   DQGVNFLDSAFIYGLGRSEELIGEIIAKRGGRENLVLATKGAHKEVNGQIELDNSRDFL
FT                   REQVENSLKRLKTDYIDLYYMHFPDGRTPLEEVAGTLKELKDEGKIRAIGASNLDFEQL
FT                   QAFNRDGYLDVLQSEYSLLKREAEKDLLPYCVEHRISFIPYFPLASGLLTGKFTKDATF
FT                   DDIRAKDPLFQGEAFLQNLEKVDKLKAIAQSKNAETAHVALAWLLAQDGIDAIIPGAKR
FT                   AEQVQQNLKTNEVQLTKEEINQIDHIFS"
FT   gene            complement(268672..269637)
FT                   /locus_tag="BPUM_0250"
FT   CDS_pept        complement(268672..269637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0250"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60948"
FT                   /db_xref="GOA:A8F9N1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008824.1"
FT                   /protein_id="ABV60948.1"
FT                   /translation="MNAFYLGFRIYALIWLGLAFHAVAEAFLPQSSGVLWLLTFCVIGL
FT                   YTCFIYKRFLPHVSGYVMLGAFVLFTCAGLSLFLTQGNGWSSLLVFVIIMTADILSLKM
FT                   MQTERRLNGRLQELINAESRTNELLLELRSKHHETARHLNAFSASNEEHEIKDLIQQYV
FT                   KHFPWMKGENAYLASTLHSFFQRAEKEDIALSLDLQAPFSSLPFSKADQVSFTGNLLDN
FT                   ALDAAIEAKQAGKEGSISISTSIRSGLFLIHCENSTKGMEKHVLDHLFKNFGRSTKGGD
FT                   HQGMGTYIIHQLVEKADGTLDFTYRSPDLRLVIKIPLTMS"
FT   gene            complement(269649..270350)
FT                   /locus_tag="BPUM_0251"
FT   CDS_pept        complement(269649..270350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0251"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60949"
FT                   /db_xref="GOA:A8F9N2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358602.1"
FT                   /protein_id="ABV60949.1"
FT                   /translation="MIKVGLVDDYRVDLEKLHAIVGRMEAVEIVFVTQSAEDAYEKVKK
FT                   GDIDLLFADIEMPGMSGYELADLIHSHALNVDVVFVTGNSGYAVHAFDLNVHDYIMKPY
FT                   QADRIAKSLERYMSTKQEKSIHGRLLIKQQSDIHVLQKKDVIFVERTGRSTTIVTTTGD
FT                   IQTYQTLNELKGDLAEKDFIRSHRSFIINIHYIKNFSAYAKNSFIVSFEGTDKKAMMTK
FT                   QQLEYFKKYYF"
FT   gene            270512..271252
FT                   /locus_tag="BPUM_0252"
FT   CDS_pept        270512..271252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0252"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60950"
FT                   /db_xref="GOA:A8F9N3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008826.1"
FT                   /protein_id="ABV60950.1"
FT                   /translation="MITLSDCSCWFKDKKKVVKAMKHMTFSVKEGEVVGILGENGAGKT
FT                   TLLRAVATLLEPTHGSVTVAGFDTVKESTEVKKRIGVLFGGETGLYDRLTARENLEYFG
FT                   KLYGLDQHEIKARIEDLAKRFGMRQYMDRKVKGFSRGMKQKVAIARTLIHDPDIILFDE
FT                   PTTGLDITSSNIFRDFIHQLKQQNKTILFSSHIMEEVSQLCDSVMMIHQGELVYKGTLP
FT                   ELYTQEQSDDLNYIFMSKLARGVS"
FT   gene            271252..272427
FT                   /locus_tag="BPUM_0253"
FT   CDS_pept        271252..272427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0253"
FT                   /product="protein natB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60951"
FT                   /db_xref="GOA:A8F9N4"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216965.1"
FT                   /protein_id="ABV60951.1"
FT                   /translation="MWKTVFKKEMTDALRDRKTLLLTVLIPLLTMLGLVFFYESMIADP
FT                   GDKAYTVAINEQLPAEMNQMIKEVKNLNLETFDDPQQAVKDGEANAYLEMPKEAGDMLQ
FT                   HQKPFAIKIHGYTTDDDSVITVQMLQSLLEQYQNQVVEKRLAADQIDTSVIHPFEVQSV
FT                   DVEEGDEGENGVTAMLLSILLPMILVTSVISGALPAALDIVAGEKDRKSIEALFLTPAS
FT                   RLQILIGKWLAVSMFGILSGIVAIGMLLLSTLLFTEKLKQALNFGDQMWSIIAVMFAAL
FT                   IIFSFMVSMIELLLSVVSSSVKEAQSYMSMIITLGVLPMFFTMRAGATQLDTYYFAVPF
FT                   LNIHALCKQLMFGIIDPMAVTLTLGSSALAVVILFVIVRSLFMKEKWMLAK"
FT   gene            272566..272904
FT                   /locus_tag="BPUM_0254"
FT   CDS_pept        272566..272904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60952"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008828.1"
FT                   /protein_id="ABV60952.1"
FT                   /translation="MPDQTEDDDVLELCNIYAQQTHHFEAFILGNRKGLLELRKAIDEA
FT                   LETGSSVAHLYPSDFEGYETYVALVDDEQKFEKLMDPYVEEYAQEEDAVDPVEVIKEYE
FT                   AVKGNPSS"
FT   gene            complement(272950..274008)
FT                   /locus_tag="BPUM_0255"
FT   CDS_pept        complement(272950..274008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60953"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217128.1"
FT                   /protein_id="ABV60953.1"
FT                   /translation="MFKKKLSLFLLILCVTVVAAACSGGKEKSAAKEKDTKSLDSAEVK
FT                   VESAEYTLPPQYDTSVQDDQYVLKVNVSVKNISKEPLNVDKSNFTLYQDDSQVSTISPD
FT                   DYNEVLSSSSLNAGKVSKGGLFFVVDKEKDYQLVYNEPGSGSKKDDKTLEFDIKGKDLM
FT                   KKADTLQASAKALSSYIDVMIFGKNNDEFEKLTGDNKSTVVNQFDKSFKQGYITSSGIS
FT                   SSSAKDENLDKLLKAVKETLAEKSKVSTKTKAISGDKAVVTVTLTPIDASPLVDRLKEK
FT                   ATEFYSKNRSASYDEAQKYLLSIYPEEFKKLGPSSSEETVEVNMKKNDIDQWKLDLNDY
FT                   KTSSLVEKFIKN"
FT   gene            274547..274975
FT                   /locus_tag="BPUM_0256"
FT   CDS_pept        274547..274975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0256"
FT                   /product="cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60954"
FT                   /db_xref="GOA:A8F9N7"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007498349.1"
FT                   /protein_id="ABV60954.1"
FT                   /translation="MAVVRATSSDIDLMARLLRAEAEGEGKQGMLLVGNVGINRLRANC
FT                   SDFKGLRTIPQMIYQEHAFEAVTHGYFYQRARETEKTLARRNINGERFWPAKFSLWYFK
FT                   PPGNCPPTWYNQPFVARYKSHCFYQPTAETCENVYNTF"
FT   gene            275095..275874
FT                   /locus_tag="BPUM_0257"
FT   CDS_pept        275095..275874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0257"
FT                   /product="sugar dehydrogenase"
FT                   /EC_number="1.1.1.47"
FT                   /note="Converts glucose to D-glucono-1,5 lactone"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60955"
FT                   /db_xref="GOA:A8F9N8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008830.1"
FT                   /protein_id="ABV60955.1"
FT                   /translation="MYQDLKGKTAIVTGSSKGIGQAIALRFGQEQMNVVVNYKGDEEGA
FT                   EETVQAIQQNGGRAVKVHADVSKEDGIQAIMDTALEHFGTVDVFVNNSGFNGEEAMPHE
FT                   MTLEQWQKVIDVNITGAFLGAKAAIAYMIEHDIKGSILNISSVHQEIPRPFNVHYSTSK
FT                   GGMNMMTKTLALDYAEAGIRINAIAPGTMATESNDDLQDEQKKQKQLEKIPMRAFGEPK
FT                   EIGSAAAFLVSKEASYITGTTLFVDGGMTLYPSQIND"
FT   gene            complement(275895..276935)
FT                   /locus_tag="BPUM_0258"
FT   CDS_pept        complement(275895..276935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0258"
FT                   /product="acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60956"
FT                   /db_xref="GOA:A8F9N9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9N9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358596.1"
FT                   /protein_id="ABV60956.1"
FT                   /translation="MNKRLDWVDAAKGIGILLVVMAHVPIPDSFKQFIYSFHMPLFFLL
FT                   SGMMFRSSSRPALSFIQKKAKSLLLPYLYFSIITYVFWFTVTRFFAFKGQTDIDPFVPF
FT                   TGIFISNADEARLTHNPAIWFLTTLFLVELIFFFMHRLTKGKPAVLILLTVLCGGAGFA
FT                   STLLLNQSLPWNANVALTAVVFYSIGFLAKQWFVELKTDPTLLLCTGLLVLTAYMQSFN
FT                   SRIDMRVNDYGDLFLFYVCALLGSAAVIYLSFKFKTSPILTYLGRNSIVILVLQFAGID
FT                   IMKAFVYYGLGIDIADTAQLSWTLFYTIGTLLLMVPCISFLSRYPMLLGKPAKAAHRYE
FT                   QKTSAG"
FT   gene            complement(277145..278137)
FT                   /locus_tag="BPUM_0259"
FT   CDS_pept        complement(277145..278137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60957"
FT                   /db_xref="GOA:A8F9P0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217206.1"
FT                   /protein_id="ABV60957.1"
FT                   /translation="MPSLHILDQVAIPKGQTAQETLIHTTQLAQLAETLGYERYWFAEH
FT                   HSTRGLASTAPEILMAHIAAHTSTLRTGSGGILLPQYSPFKVAEVTRQLEALYPGRIEI
FT                   GVGKSPGGIERTRLALTDGVHKDLSQFDRQLKDLLFYLSDSLPSGHPHAGVKASPLVDA
FT                   HPPVWLLGLGENSAMQAAELGINYIFGHFIHPARGKQAFETYRSHFSPSVFSTQSHAMF
FT                   AVFVICGETDEEAERIASSTDLWLLRVEKGLDSRVPSIEEASTYHYTSQEKKKVLQNRQ
FT                   RMIVGSKATVKEQLLRLMDRYQTDDIMILNNSFDPIEKQRSFKRIAELF"
FT   gene            278550..279152
FT                   /locus_tag="BPUM_0260"
FT   CDS_pept        278550..279152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0260"
FT                   /product="stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60958"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358594.1"
FT                   /protein_id="ABV60958.1"
FT                   /translation="MAITLEKGQRIDLTKGKAGLTNILVGLGWDPVSQGGGFLGKLFGG
FT                   GGGADIDCDASVLMLKNDKFVENKDLIYFGNLKSKCGSVEHTGDNLTGEGDGDDEQVLV
FT                   NLSKVPGNVNKLVFVVNIYDALRRNQHFGMIQNAYIRIVDRSNNQELVKYNLKDEYAGK
FT                   TSLIVGELYRHENEWKFVAVGNGTNDAKLADITRNYI"
FT   gene            279173..279754
FT                   /locus_tag="BPUM_0261"
FT   CDS_pept        279173..279754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0261"
FT                   /product="chemical-damaging agent resistance protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60959"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358593.1"
FT                   /protein_id="ABV60959.1"
FT                   /translation="MGISLAKGQKIDLTKTNPGLTKVVVGLGWDVNKYDGGHDFDLDAS
FT                   VFLLDAAGKANSPSDFVFYNQTTGGGGSIVHTGDNRTGEGDGDDEQVNVDLSTVPASIE
FT                   KISFVITIHDAEARSQNFGQVSNAYVRILNAASNEELIRYDLAEDFSIETAIIVGELYR
FT                   HGGEWKFSAVGSGYQGGLARIATDFGLDIG"
FT   gene            279796..280374
FT                   /locus_tag="BPUM_0262"
FT   CDS_pept        279796..280374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0262"
FT                   /product="chemical-damaging agent resistance protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60960"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358592.1"
FT                   /protein_id="ABV60960.1"
FT                   /translation="MAIQLSKGQRVDLTKTNPGLTKVMIGLGWDTNKYSGGAEFDLDAS
FT                   AFLVDANNRCQQDTDFVFYNNLQHPSGSVTHTGDNRTGEGDGDDEQILVDFSKIPANID
FT                   RIGITVTIHDAEARSQNFGQVSNAFVRVVSEEGGEELIRFDLGEDFSIETAVVVCELYR
FT                   HGSDWKFNAIGSGFSGGLAALCQNYGLEV"
FT   gene            280516..281295
FT                   /locus_tag="BPUM_0263"
FT   CDS_pept        280516..281295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60961"
FT                   /db_xref="GOA:A8F9P4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008834.1"
FT                   /protein_id="ABV60961.1"
FT                   /translation="MDILKHMLDTYASFFDWHMWAEVLTNPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEKQRKKALTYGLIGAYFFRFLFIGVGMLLIKFWWIKVLGAAYLAW
FT                   LVIKHFWLGDGDDEAKELKKEGWMIRVFGVFWATVISVEIMDLAFSVDSILAAFAVSEE
FT                   VWILLLGGMLGILMMRTVAQLFLVLIDRIPELENTAFILIGIIAIKMGLSAAHIEIPHL
FT                   AFFAIIILAFIGTFIVHKINKKKHQDVTNEAAASKEE"
FT   gene            281390..282580
FT                   /locus_tag="BPUM_0264"
FT   CDS_pept        281390..282580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0264"
FT                   /product="citrate lyase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60962"
FT                   /db_xref="GOA:A8F9P5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217235.1"
FT                   /protein_id="ABV60962.1"
FT                   /translation="MRYFRFLSEARQHDLFFKRPGAMHSLTPRHVLAHALGSTLYMPAT
FT                   REDIADMLLSQKYEALCSVVFCLEDAIGDQEVDMAEQNLVAQLTSLKEKVTHAPETAEH
FT                   LPLIFIRVRSPKQLLKMADLLGSSLQLLTGFVFPKCSVHNAKEYLDSLKQASAQTQTIL
FT                   YGMPILETPDLLEKETRYTVLSELKQILLNDEEYILNIRIGATDLCGLYGIRRDRDTTI
FT                   YEIHLIADLITDIINYFGRSFVISGAVWEHFGPVRKEQKPFIRALSHKSGESSSSEFDD
FT                   VQGLLKETKLDVANGIHGKTVIHPTHLKPVQSMYVVTKEEYMDALSILEHADGTIGVMK
FT                   STFSNKMNETKPHYRWAEHILMKSDIYGVFHENRSYIDILTEAEAAYAEHLGTYGS"
FT   gene            282570..283901
FT                   /locus_tag="BPUM_0265"
FT   CDS_pept        282570..283901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60963"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008836.1"
FT                   /protein_id="ABV60963.1"
FT                   /translation="MEVELDLKEGALDLEKEHLFDMAARVNKKRAFLFVSKVLGKHIPV
FT                   HPVKPLLVSGLLAMAYAKEQTGKTSPHQDLLVEALKTDDHAVLSKAYEALKKEKLSVGK
FT                   QPIVIGFAETATALGHGVYDVLEGASYIHTTREQLLDLDPSLVFEEEHSHATDQLCYAD
FT                   VSLLRTARPIVLVDDEVTTGRTNINIIRDLHAKHPRHSYTILSILDWRTEEHEKAMCEL
FT                   EKELGIHITSLSLLKGQMVFRGKTLDEPAYSYEIAEQKDLPNLSFHSLQSFFQQVPYAR
FT                   SHATNSAGHSPYIHETGRFGLNAANTAAIDQAAAEAGLKLKKERKGKQTLCLGTGELMY
FT                   VPMRVAAHMGEGVLFHSTTRSPIHPVEKDGYAVQNGFTFVSPEDARIQHYVYNIPKGQY
FT                   DDVFLFFEKKVSQEALLPLVHLFAERHVKHVHIVTLSDEVKVNG"
FT   gene            283894..285003
FT                   /locus_tag="BPUM_0266"
FT   CDS_pept        283894..285003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60964"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008837.1"
FT                   /protein_id="ABV60964.1"
FT                   /translation="MANVYTKMGSYPEQDVTFLLKDLSSIEMEKSTEERERSIQSGAHY
FT                   SEMLPIEYKPTESYMDLFYESLKESKEKVAEAVAVVAEQIVKRRGFQTVLCSLARAGTP
FT                   IGVLIKRYIRKTYGLELPHYSISIIRDRGIDENALHYMLKEHPGYEIAFIDGWTGKGAI
FT                   SRELQQAVIDFERKYGIRLSSELAVLADPGYCTQVYGTREDFLIPSACLNSTVSGLVSR
FT                   TVLNNRWINADDFHGAKYYEELLDEDVSNLYVDTIEEAFSSLEPNLEEKAETILTQGIP
FT                   ADWRGMASIEAIGQEFQIENTHLIKPGVGETTRVLLRRIPWKILIQPGSQEKLKHILLL
FT                   AEDRGVPVIEYANMSYTCCGLIRPLEQTS"
FT   gene            285000..285815
FT                   /locus_tag="BPUM_0267"
FT   CDS_pept        285000..285815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0267"
FT                   /product="hydrolase (had superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60965"
FT                   /db_xref="GOA:A8F9P8"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008838.1"
FT                   /protein_id="ABV60965.1"
FT                   /translation="MKTSAFASDLDRTLIYSHRVLDHYEYDGDYDLVEMLDERPLSYMS
FT                   VETKKSLKMIHQLGWFIPVTTRTTAQYERITFFQQELKPEYAVTTNGGCILHHGKPLED
FT                   WQVIVDERLKACMSVREMLRAISELPVAAWVKRTRTAEGRFLYLIMKDEYLSRIPLAEL
FT                   KQWGEERGWQVSLQGRKLYFIPAPLNKWDAVAFLKERLALEYVYGAGDSLLDAGLIRQA
FT                   DMGFAPRHGEVLDFDPLLEPTVASGMAAADEITAFVKKQMTTAKKPSIR"
FT   gene            285886..287502
FT                   /locus_tag="BPUM_0268"
FT   CDS_pept        285886..287502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60966"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9P9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008342125.1"
FT                   /protein_id="ABV60966.1"
FT                   /translation="MSYKEIIVNQTRAEQEAWKNVLKKPLPERDGYVKDEHTLSLPRLA
FT                   ARVLGTPHDATDYFIYLHELYETDGIHILSETLNRHIEPEHFQALQRIHLINQEEKGLS
FT                   VNRFVAFLDGEQLIVRHPNPVMNRHIRLSLIKVFEHFKQLHEGGFQHPDFRRVLLDVVK
FT                   FSNNHLGPWLKEVNIEEKMPAVIWYGEANKSQLYFLYYVMLIGCDVVLFHPEGEDSFRE
FT                   LDPEEKLTFIDQYPGTTKLEPFPTEKPERKSTVAYRSTRELEEVLHTEDSMLYKPWQFR
FT                   DHTPHSITLKTTYDELFLIAKERSFIRPNFQADRDTIQIPNLFAKMMGVTRDKREYWDR
FT                   IHTLMEWKETKTIRHFPFTKEVTSNYQFHYQHALSSAGEIDPELLMKSNVWQFSHLYEG
FT                   TQRAIAEAISRICQHPKLLKEGNETELDVRIYLFKQVLHIGQELIELIQTFDYAQTVPK
FT                   VILYHTEYNGELTRSDAAALIFLNEMGVDLFVYHPAGYQCIERYIDDQLFDTHWLDEMV
FT                   MNQEFKEPSIVRKLFQSIKNR"
FT   gene            287517..288611
FT                   /locus_tag="BPUM_0269"
FT   CDS_pept        287517..288611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60967"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007498324.1"
FT                   /protein_id="ABV60967.1"
FT                   /translation="MTNTNGNDIISIDKEEISIEKADDIRVQLRNEPEVQNIARQIDAK
FT                   NQLELLEYGKQPAVEISKFSDRILSMMRSTSVTDSGTMLTQLGKIMDRFDKNDFDEPKG
FT                   GLLSKIFKRGGSMIEKIFSKYQTLGAEIEKINVEISKYKDEMTKSTVTLEEMYEHNIQY
FT                   YMELEKYVVAGQMKIEELKQLVPSYEEKAASGNQLAQMELDTLRNGIQALEERVYDLDM
FT                   ARMVALQTAPQIRLLQRGNTKLIGKINSAFIITIPIFKNGIIQAVTAKRQKLVADSMSE
FT                   LDRRTNEMLKRNAENISSQSVEIAKLSGRPSIDIETIESSFNTIVQGMKETKQIEEENK
FT                   RLREDGTKRMLELQDNIKRAALES"
FT   gene            289012..290277
FT                   /locus_tag="BPUM_0270"
FT   CDS_pept        289012..290277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0270"
FT                   /product="glycine/betaine ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60968"
FT                   /db_xref="GOA:A8F9Q1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008342124.1"
FT                   /protein_id="ABV60968.1"
FT                   /translation="MNSEERNIKIKINNVSKIFGKNAKKASQMLEKGKTKREILKETGA
FT                   TVGVNRANFDVYDGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGEIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQNFALFPHRTILENTEYGLELQGVDKEERRSKALESLKLVGLEGFE
FT                   EQYPNQLSGGMQQRVGLARALANDPDILLMDEAFSALDPLIRKDMQDELLELHTSVGKT
FT                   IIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVERFVEDVDLSKVLTA
FT                   GHIMKRAETIQIDKGARVALTLMKNLGISSIYAVDKKKHLLGVISAQAAKKAAETNTSL
FT                   ETVLDKEFTTVLESTYLTEIFDAVSDANIPIAVVDEKNRMKGIVVRGALIGALSGNDEY
FT                   INMSSNKLEEIKTQEPSAQEVE"
FT   gene            290288..291133
FT                   /locus_tag="BPUM_0271"
FT   CDS_pept        290288..291133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0271"
FT                   /product="glycine/betaine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60969"
FT                   /db_xref="GOA:A8F9Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008360348.1"
FT                   /protein_id="ABV60969.1"
FT                   /translation="MSDLPRIPFADYIDQFVDWLTLTFGGFFDGITNGLAGTVNGIVAA
FT                   LGVIPSIILTLIFAGIAWWISTRGVALFTLIGFLLIDYLGYWHPMLQTLALVLTAVVIS
FT                   IVIGVPIGIWASQKETVRKIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASVIFS
FT                   MPPTIRMTILGIKQVPSDLIEATEAFGSTTFQRLFKVQLPLATKTILAGINQSIMLALS
FT                   MVVIAAMVGAPGLGSEVYSAVTQLKTGIGFEAGIAIVIVAITLDRITQNIKTKKTRGNA
FT                   "
FT   gene            291133..292014
FT                   /locus_tag="BPUM_0272"
FT   CDS_pept        291133..292014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0272"
FT                   /product="glycine/betaine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60970"
FT                   /db_xref="GOA:A8F9Q3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008342122.1"
FT                   /protein_id="ABV60970.1"
FT                   /translation="MWKKSLYIGMTALLVFLLAACGAKSDSNASAAQQVNKTIIGIDPG
FT                   SGIMALTDQAKKDYGLEDWTVVSASSAAMTATLKKSYDRKKPIIITGWNPHWMFSRYDL
FT                   KYLDDPKKSYGEAEEIHTISRKGFAKDEPDAAKMLGQFKWSQDDMGEVMIDIQDGINPK
FT                   DAAVKYVKKHKDQVAKWTKGVKKSNGAKVNLAYVAWDSEIASTNVAAEVLRELGFKVTL
FT                   TQVEAGPMWTAIATGSADASLSAWLPNTHKTYAAKFKGKYDDLGTSMKGLRMGLVVPTY
FT                   MKNVNSIEDLKK"
FT   gene            292054..292878
FT                   /locus_tag="BPUM_0273"
FT   CDS_pept        292054..292878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0273"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60971"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008843.1"
FT                   /protein_id="ABV60971.1"
FT                   /translation="MKKQSAQKAAAFFLYIRKVNELSMRVKPIMIFLHGGGVSSWMWEE
FT                   QIQTFKEAYECYTPDLIGHGTRADEQSFSMRESALEVVSLIKEHAQGRQVILVGFSLGA
FT                   QIAVEVLSKEPDIVDIAVINSALVKPLPWLYLMVRPLLPLTYPLLKKDWFIELQAEKMG
FT                   LPKDVLNHYMADSKSLQKKTLLTMFQENLHYKLPDTFQQAKARILVTVGEKEKGIMKRS
FT                   AKKITNSHPQAAGVMVPAIGHTFTFEKKELFMDMVQCFIEERALPVELKEIK"
FT   gene            293003..293725
FT                   /locus_tag="BPUM_0274"
FT   CDS_pept        293003..293725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0274"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60972"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008844.1"
FT                   /protein_id="ABV60972.1"
FT                   /translation="MSKNYIIFGASQGLGDAFVKGLPSSGDTVWIVSRSEPSSLKLDDG
FT                   VHRIWLKIDLSSQSHIPQMIEALGNKTIDVLIYNVGLWEKRGFEDDYSFDHDQPEDIAH
FT                   LINVNVTSTITYIQALLPNVRKSENGKIIVVGSTAGLDHTNLPQVSFVASKFGLRGIVN
FT                   ALREHVRKDKISVTCINPGELAAEVPYEDGAEKAIALYDETRIPVQDIVELARCVIHLS
FT                   RVSCVKEINVPAMSDLNA"
FT   gene            complement(293971..295098)
FT                   /locus_tag="BPUM_0275"
FT   CDS_pept        complement(293971..295098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0275"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60973"
FT                   /db_xref="GOA:A8F9Q6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008845.1"
FT                   /protein_id="ABV60973.1"
FT                   /translation="MTTLTNDMQQTVKDIFEHLHAHPEISWEETNTTAYLEDLLKKIGC
FT                   QTRTFDDCTGVIGEIGEGSPVVAVRADIDALWQEVDGEFQANHSCGHDAHMTMALGTFM
FT                   ALKEKELPNGTIRFIFQPAEEKGGGALKMIEEGVLADVDYLYGVHVRPIQETLNGRCAP
FT                   AILHGSSNHYIGTIIGEEAHGARPHLGINVIEVASTLVQRLAHIHVDPRVAHSVKMTNL
FT                   HAGGGSSNIIPGKASFTLDVRAQTNEVMDELEKEIERAVHSVADAFGASISLSTDHRLP
FT                   AATLNEEAVQMMSQAIEKVLGKEQLDPPLVTTGGEDFHFYAAKLPHIKSTMLGLGCDLE
FT                   PGLHHPYMTFDRSAIFTGIEILTEAVYQTLQQHSS"
FT   gene            295252..296682
FT                   /locus_tag="BPUM_0276"
FT   CDS_pept        295252..296682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60974"
FT                   /db_xref="GOA:A8F9Q7"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366562.1"
FT                   /protein_id="ABV60974.1"
FT                   /translation="MKTAAVSPPEKQKRKLQMPDAYVLLFIIALICTIATYFVPAGEFD
FT                   RKTSGEITTAVPGSYHRIDQSPVSPVGFFTAIQEGMVGSSSIIFLILFTGGTIAILEKT
FT                   GAINGMIHHVISRFQTKQLLFICIVGGLFSVLGTTGIVVNSVIGFIPIGIIVARSLKWD
FT                   AVAGAAVIYIGCYAGFNATILSPSPLGLSQTIAELPIFSGIGLRVIIYLCFLISSIVYI
FT                   YLYTRRLKNKEKGSLLGDQWFPAKGLGGSDAESVDKPAFTGRHKLILAVCGLSLGGFLY
FT                   GALQLGWTDKEMAGVFIFMAIAAGLLGGLAANDIAKTFIVGCQSLVYGALIVGMARCIS
FT                   VILENGKLLDTVVNGLASMLTGFSPIAGAIGMYIASALLHFLISSGSGEAVVFIPILAP
FT                   LADLMGITRQVAVEAVMLGEGVVNCINPTSGVLMAVLAASGIPYVKWLRFMVPLALIWF
FT                   VIGLVFICIGVMINWGPY"
FT   gene            296897..297844
FT                   /locus_tag="BPUM_0277"
FT   CDS_pept        296897..297844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0277"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60975"
FT                   /db_xref="GOA:A8F9Q8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9Q8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217251.1"
FT                   /protein_id="ABV60975.1"
FT                   /translation="MTNEKVNKVALIGAGFVGSSYAFTLINQVITDELVVIDLNQDKAM
FT                   GDVMDLNHGKAFAPHPVNTWYGDYEDCKDADIVCICAGANQKPGETRLDLVEKNLNIFK
FT                   GIVDNVMKSGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDTARFRYMLSEY
FT                   FDAAAHNVHAYIIGEHGDTELAVWSHANIGSVPITELMKKNDQYKQEDLDEMMENVRHA
FT                   AYQIIEKKGATYYGVAMSLARITRAILHNENSILTVSTYLDGEYGADDVYIGVPALVNR
FT                   NGATEVIELALNDTEKEQFAHSVNVLKEILAPHF"
FT   gene            297884..299506
FT                   /locus_tag="BPUM_0278"
FT   CDS_pept        297884..299506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0278"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60976"
FT                   /db_xref="GOA:A8F9Q9"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Q9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216990.1"
FT                   /protein_id="ABV60976.1"
FT                   /translation="MWQQIYNPFGNEFVSALVAMLPILFFLLALTVFKLKGVLAACFTL
FT                   IVSFVTAVFFFHMPIEKALSAVLLGISNGLWPIGYIVIMAVWLYKIAVKSGKFDVIRSS
FT                   IAGISQDQRLQLLLIGFSFNAFLEGAAGFGVPIAISAALLTELGFKPLKAAMLCLIANA
FT                   ASGAFGAVGIPVITGAQMGNMTPLALSQTLVFTIPFISFCIPFLLILIVDGFKGIKETL
FT                   PALLVVSGSYAILQAVTMVTMGPELANIISALASMGILALFLRKWQPKHIYREEGAPAV
FT                   EQKQTYRGVEVLKAWSPFYILTAVITVWSLPAFKALFAVGGPLNWTTILVKMPFLHQQI
FT                   VKLPPIAQTATPIDAIFKIDVISATGTAILIAVMLTGLFSRHITLKEGAACLKASVKEL
FT                   WVPVLTICFVMGFANLANFAGLSSAIGLALAKTGDLFPLVSPVLGWIGVFITGSVVSNN
FT                   ALFGNLQAVTASQIGSQAGLLIGANTTGGVMAKLISPQSIAIATAAVGETGKESELFQK
FT                   TVKYSFILLGIVCVWTFILAQFV"
FT   gene            complement(299753..300742)
FT                   /locus_tag="BPUM_0279"
FT   CDS_pept        complement(299753..300742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0279"
FT                   /product="NTD biosynthesis operon regulator NtdR"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60977"
FT                   /db_xref="GOA:A8F9R0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358581.1"
FT                   /protein_id="ABV60977.1"
FT                   /translation="MCTIYEIAKRCGVSTTTVSRVLNHHPYVSEEKRQLILQVMKEMEY
FT                   TPSSAARTLRSHQTKTIAVSVPAVDHPFFAQLIKGISKEALDQGYKAIVLQTFYQESLE
FT                   LEGLQLLKRREVDGVILGALENPWEKIEPFLTNGPIVMANEYHQTADIPIIGYDEREAA
FT                   YKAVDYLIQSGRKSIGFCFDTESSEAQKQRKQGYLDALSAHGLPLHDDWLFGEAFTIED
FT                   GFRLMDIIHDMKNAPDAIFTGNDQVAAGLIKQAISYGYHIPKDLAVIGYDNQDICEVTA
FT                   PTITTIDIPIVELGQRSVQQMIELLLDQKPLQREHIQLPTRLVTREST"
FT   gene            300852..302177
FT                   /locus_tag="BPUM_0280"
FT   CDS_pept        300852..302177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0280"
FT                   /product="NTD biosynthesis operon protein NtdA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60978"
FT                   /db_xref="GOA:A8F9R1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358580.1"
FT                   /protein_id="ABV60978.1"
FT                   /translation="MQILTKISGKSKDYLPLLDMINQGVQVKSDSVEKHLANEKLVTFL
FT                   EQDIGRTGLEKILFHYKQNKEKKIPFLPVDKLISEDEIDDIMQVLKEVLSSGRFTSGPY
FT                   IPAFEKQLAEYLGKKYVIATSSGTDALMISLISAGVHPGEEVILPANSFAATENAVLAI
FT                   GAVPVYADIDPDTYCMAPSEIEKHITDQTACILPVHLYGKQADMKAISAIAKKHGLKII
FT                   EDGCQAIGSTGLGAYGDGLVLSFNPYKNLGVCGKAGAIATNDEALAEKCMEISYHGFEV
FT                   GKKNVKRSDYGFNSKIDNLQAAIGLERMKYLGLQNFKRFYLAKRYIDQLQTLEDEGYLK
FT                   LPKLTDDHVWHLFPIRVLKGERDELAAKLLEMGIETDVYYPILSHQHQTNLVSQKYKRT
FT                   TLPHTEKAAQQLLHLPLYPGMPLQDQEKVIEGVHHVIKSSIQ"
FT   gene            302152..303018
FT                   /locus_tag="BPUM_0281"
FT   CDS_pept        302152..303018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0281"
FT                   /product="HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60979"
FT                   /db_xref="GOA:A8F9R2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358579.1"
FT                   /protein_id="ABV60979.1"
FT                   /translation="MLSSLPFNKKLLNQPKNPKWIVFCDFDETYYSHEMTEEQREDVKR
FT                   LEAFVAEKSEAGQLMLGWVTGSSLDSVTSKMEKGGFHQFPHFIASNLGTEIVYTSDAHF
FT                   GQPDAEWMKRLDAQGFSDEKIEDILETIREKGIHLRPQTQLGSSGYKKNFYYQEQDERT
FT                   DLHHLSFIQTLAKERGVAVNINKCNPLAGDPADCYDVDFLPVGTGKDEIVSFMLNQYDL
FT                   SKDQGFAFGDSGNDLRMLQSVTHGFLVQNATAEAKRHHHQICHHGYAKGIYETLKTVMY
FT                   KHEEAHS"
FT   gene            303015..304061
FT                   /locus_tag="BPUM_0282"
FT   CDS_pept        303015..304061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0282"
FT                   /product="NTD biosynthesis operon oxidoreductase NtdC"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60980"
FT                   /db_xref="GOA:A8F9R3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003216957.1"
FT                   /protein_id="ABV60980.1"
FT                   /translation="MKKIGIVGAGNIAKAHARALSTIKGAELSGVYDLHESVAQGFIKQ
FT                   YGGRVYSSIETLADASDGLIIASPNFCHKDHALQALRAGQPILCEKPMAVSLKEAKEMV
FT                   ETAKQFQVQASMGFNYRYLSFVNILKNLIANGELGRILTVRTHFKKNSALRRKTFSWRD
FT                   SSESLRTSGALGDLGIHLIDMLWYLFGSEMKKESLNTKMLTHVKEKEEKKVQVDDHTEI
FT                   FGQMENQVFFHLVTSKSTQPEECGFSVEVVGHDKVFKYHTNMKNEYEISDGLCVERHQM
FT                   PQTLLTDPPNEFYGWSDTFRDQLMHWVNTDPYPSHMKVADFVDGYRAQAALNTCFEREE
FT                   AVESARAY"
FT   gene            304116..305303
FT                   /locus_tag="BPUM_0283"
FT   CDS_pept        304116..305303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0283"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60981"
FT                   /db_xref="GOA:A8F9R4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008853.1"
FT                   /protein_id="ABV60981.1"
FT                   /translation="MKKVFYFGCVFYFFIGTIHVFFGSLTPYLLASYDKGPGELSSLIF
FT                   FQFIGFLTGVLLSPILVRKKGYGAVLTMGLLLMIGSLLLGLLVPGWSTLVLAGFFLGSG
FT                   AGSLETTAGAYVISMANSAKRISIMEVFFGLGALLFPLVILLTVNEQTWHYVFLFQVGA
FT                   LTFFLMLWIAFMNKLPRGQMISPSNGVKKPSLLVDRNNRIIVVIMICFAFFYAGIETNF
FT                   ANFLPSIMLEKGGDNWGLFAVSTFWTAIVIGRTVIARKADHLHPLRFLKLSAALMILLL
FT                   VIFALTTHITAQLLLIFFIGLCAAGMFPIALTASALMIENAIDEATSYFIAAASLGGAC
FT                   LSFLIGFSLEWAGAASAIFVFAFLAVLLFAAAIQMNRVKKKETVLPKQSALKADQ"
FT   gene            305416..306045
FT                   /locus_tag="BPUM_0284"
FT   CDS_pept        305416..306045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0284"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60982"
FT                   /db_xref="GOA:A8F9R5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358576.1"
FT                   /protein_id="ABV60982.1"
FT                   /translation="MAVFFGYIFLGLSLSAPVGPVNAAQIDRGIKSGFWHAWIFGVGAM
FT                   AADIVYMLLIYFGVAQLLTAPLVKTFLWLFGFFVLTYTGIESLRKINLQESPKKDGGNT
FT                   SIGQSFMTGFFISLSNPLSILFWLGIYGSILANTIEKYGASQMLMYSMAIFIGMLIWDF
FT                   SMALLASSFRRYLSERVLHGLSVLAGLSLLGFGVYFGYQGIMALIG"
FT   gene            306164..306547
FT                   /locus_tag="BPUM_0285"
FT   CDS_pept        306164..306547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60983"
FT                   /db_xref="GOA:A8F9R6"
FT                   /db_xref="InterPro:IPR031374"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008855.1"
FT                   /protein_id="ABV60983.2"
FT                   /translation="MRMFLPVFNYVCMLILSVITATFVYTLLFIPAEAGFGYVEMTSLL
FT                   MLIAYVVFATPIQLVLHRHPKRFRGRDLLVYFLAAWMVCSALALWIDYGLVVFISYKVY
FT                   LFSFCSALIYWVLNSVFLMKNRS"
FT   gene            306728..307486
FT                   /locus_tag="BPUM_0286"
FT   CDS_pept        306728..307486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60984"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008856.1"
FT                   /protein_id="ABV60984.1"
FT                   /translation="MAQLYAKSCLDQNLRSLEEWKQDAFTLFGEMVGDEADTFPCVPGR
FT                   QGFFLDHLRYGFVGDPRKEEAVEELAQLLREYQSCAKETGQYASFICFFETPQDLKESS
FT                   IEEFEQQFWSLLQRLHQKDEVPWPEDIPLDTHHHEWEYCFHGEAYFILCSTPAHKLRKS
FT                   RHFPYVLMAFQPRWVFEKLNGSTKFGQKMSQLVRKRLKAYDEVGVHPSLKWYGDPTNHE
FT                   WKQYFLPDEEAEKPASAKCPFTALKNMMKL"
FT   gene            complement(307481..308833)
FT                   /locus_tag="BPUM_0287"
FT   CDS_pept        complement(307481..308833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0287"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60985"
FT                   /db_xref="GOA:A8F9R8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003217176.1"
FT                   /protein_id="ABV60985.1"
FT                   /translation="MSLKQKGVAHALKEEQTLSWWQLSLIGVGCTIGTGFFLGSSIAIT
FT                   KSGFSVCISFLLAAVGTYLVFKHLAAMTADNPDKGSFCSYARKAYGRWAGFSNGWVYWF
FT                   AEMLITGSQLTAISLFTRHWFPSVPLWVFSAIYSALALLVIIIGLSSFQKTENVLAVLK
FT                   TAAIFLFMILAVLVLFGILTDHKPTLHLPNKDHEWMPLGALGLWNGLIYAFYAFGGIEV
FT                   MGLMAVHLKDPKDAAKSGRVMLIILAVIYIVSIGLALLLVPVTAFNENSSPFITSLDPF
FT                   HLSIFLHIFNGIFIIAGFSTLVASLYAVTTLLGTMSEHQDAPACFKQKDPSHVGWPSII
FT                   LTAAGLIVSILLALFLSKHIYEHLTTAAGLTLLYTWVFILFSSKKLSKPSTRQTCEMFL
FT                   ALLLIGAAISGTLTEASGRPGFFISLGIIAVIAVMVLFMRKKWKQQDQTAS"
FT   gene            308913..309509
FT                   /locus_tag="BPUM_0288"
FT   CDS_pept        308913..309509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0288"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60986"
FT                   /db_xref="GOA:A8F9R9"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9R9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008362123.1"
FT                   /protein_id="ABV60986.1"
FT                   /translation="MNGEYVILPKGRLGFRLGKGQCMRVVDVEGQQVADVMAYHEKDFY
FT                   EKFDQGATMDSLFSSKVKKGDKLYSNLYKPMFTVIEDTVECHDLYMPACRQEMYQLLYG
FT                   RTHLEVMHTCYDNLRNAFEPFGIPKEDMYYPFNAFMNTVIDEKGKLSVELPKSLPGDYI
FT                   RLRAEMDLIVAVSACPADIGKCNGASCTSIRVEID"
FT   gene            309708..310529
FT                   /locus_tag="BPUM_0289"
FT   CDS_pept        309708..310529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0289"
FT                   /product="NAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60987"
FT                   /db_xref="GOA:A8F9S0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9S0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007498287.1"
FT                   /protein_id="ABV60987.1"
FT                   /translation="MSLQKKISQELHVQPSIDPKQEIEKRVGFLKDYLKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAASELRQEGKEDAVFIAVRLPHGVQQDEGDAQLALSFIQPDKS
FT                   WKYDIAPAVTAFSEQYQKDTGGPLSDFNKGNVKARMRMIAQYAVGGEEGLLVIGTDHAA
FT                   EAVTGFFTKYGDGGADVLPLTGLTKRQGRTLLEALQAPERLYLKKPTADLLDDKPQQTD
FT                   ETELGITYNEIDDYLEGKPVSEQAVEAIEKRYVQSEHKRQVPASMFDDWWK"
FT   gene            310664..311221
FT                   /locus_tag="BPUM_0290"
FT   CDS_pept        310664..311221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0290"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60988"
FT                   /db_xref="GOA:A8F9S1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9S1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F9S1.1"
FT                   /protein_id="ABV60988.1"
FT                   /translation="MKINREIPVRQRNIVLIGFMGVGKTTIGQLVAKKLYRDFIDVDQE
FT                   IEKKYNMTIPEMFQQKGEAFFRQAEKDYIVDLCEHTQLKIVSLGGGAFKQEEIKRACLK
FT                   HCTVLFLDLSWENWKQRLDILIENRPVLHNRTLDEMKELFEERREIYSLHNSRVETDHL
FT                   EAEEVANYIVDTLKLGWDLYSK"
FT   gene            311583..312530
FT                   /locus_tag="BPUM_0291"
FT   CDS_pept        311583..312530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0291"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60989"
FT                   /db_xref="GOA:A8F9S2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213849.1"
FT                   /protein_id="ABV60989.1"
FT                   /translation="MKNKEKWSGVFPAVLIPFKDDYSIDEPAFRKLVRWVADHKGINGI
FT                   VVNGHTGEIMTLLPHERAEAVRIAADELKGEVPVISGVSAEGTIEAIQHAKAVEEAGGE
FT                   GILLMPPHSWLRFGMQPESPVQFFKDVAEAIDISIIVHQYPTWTKTSYTTSQLLEMSEI
FT                   ENVVSFKIGQRDMAQYEVDVRALKKHAPDVSLLTCHDEYLLPTLVQGIDGALVGFGCFV
FT                   PDLIAELVKCVEEKDLVAANKVYDRIFELKHAVYKMDEPSSTSHLRMKEAMYQRGLISS
FT                   SLARKPVLPLTDEEKEEIRQGLQSVGLLKENVGR"
FT   gene            312608..313615
FT                   /locus_tag="BPUM_0292"
FT   CDS_pept        312608..313615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0292"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60990"
FT                   /db_xref="GOA:A8F9S3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358562.1"
FT                   /protein_id="ABV60990.1"
FT                   /translation="MSVSIKDVALKAGVSIASVSRVLSGKPGVGAQTAERIKQVIDELG
FT                   YRPNLGARGLVKRKTGNIAVVVPRGSYILNNPFFSTILDGIAKELDETEFNMLMSFTSV
FT                   QQQRLLETQAVDGAILFSPRNEELSMDWLKSLAIPIIVVGSYLEDSPFPCVRPDDEEGV
FT                   CQSVTALFEKGHRTIGLVNGPMSSMHSVRYYNGYERTLKHLGLTMNKELVFELDEFDGG
FT                   KVVEVVSQFLQGNQHMTGVVCSSDFLAMGVMKAADHANVSIPHDLSVVGADDVPIASFL
FT                   TPSLSSVHVDLVGMGRKAVSLLTQVLDGDQLEEMEHIFPMYYIDRGTTGTPKKK"
FT   gene            313736..315112
FT                   /locus_tag="BPUM_0293"
FT   CDS_pept        313736..315112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60991"
FT                   /db_xref="GOA:A8F9S4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214203.1"
FT                   /protein_id="ABV60991.1"
FT                   /translation="MTLEVSGNSNSHDGQVVDRASQLLTRMESVPFSRWHLKPRIIMGS
FT                   ATFFDAFDALSLAFVLPVLIGMWSLSPAQIGLLIGSGYIGQAIGAIFFGWLAERRGRVF
FT                   SAKWTVLLMSVMSIACVFSGNFMALFIFRFIQGIGVGGEVPVAASYINELSRAQGRGRF
FT                   FMLYEMIFPLGLMISAQIGAFVVPSFGWKWMFLIGGIGGLIVFVFFFMLRESPRWLISK
FT                   GRFDEAERIIEEIEASTDKRMPVAKQVSSSTEKGDWKELFSTFYRKRTLIVWGLWFSAY
FT                   FVSNGLNNWLPSLYNTVYNLPVGDSLRAASLTNILQTVGVFACAFLIDKVGRKRWATIA
FT                   FIVTGALLTALWISGASSPESVIYLGSAAYGMMGTITVLLYLYTPEIYPTRMRVIGTAF
FT                   ATAWLRLASAIAPIMIGFILEVSGVSTIFILFASVTVVGAILAFKMIETREKVLEDIAP
FT                   "
FT   gene            complement(315328..316100)
FT                   /pseudo
FT                   /locus_tag="BPUM_0294"
FT                   /note="methyltransferase; disrupted"
FT   gene            316219..317124
FT                   /locus_tag="BPUM_0295"
FT   CDS_pept        316219..317124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0295"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60992"
FT                   /db_xref="GOA:A8F9S5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008862.1"
FT                   /protein_id="ABV60992.2"
FT                   /translation="MMEYVMEVYRQKSFTKAAEELHIAQPSLSQQIKKLEEELDTPLFI
FT                   RKYGQVTPTPQGSRFIKRAESILKEKDDLLREMGEAAYEVGKELNIGAPAVTGGYVLPS
FT                   LLKTFCQTYPHVHVRLIEESPRELEKLLLAGQLDLAILSMPVEHESLKTKHMLTEPLLL
FT                   AVPPSAQPWLQAELNDIIHQRDQKGTVPFRLLEDASFIMLKEGYGFRQVVTELCHHHGF
FT                   QPKITFETSHIQTAQALVKNGLGVTVVPKMVAQEERNEVTYLKIDSSPTRTLVFAYVEE
FT                   RYLTKAAQALMDLYQNQENT"
FT   gene            complement(317170..317955)
FT                   /locus_tag="BPUM_0296"
FT   CDS_pept        complement(317170..317955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0296"
FT                   /product="nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60993"
FT                   /db_xref="GOA:A8F9S6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214317.1"
FT                   /protein_id="ABV60993.1"
FT                   /translation="MKIALVQMDVQIGEPDVNFQKAEAFLEEAIRQQPDLIILPEMWNT
FT                   GYALEQADQLADVNGERTKQLFSSFAHKHQVILIAGSVLNKRTEDEKITNTMYIFNRQG
FT                   ELLVDYDKIHLFRLMDEHNYLTAGDQLCLFDYDEDVKIGAMICYDLRFPQLSRTLVNKG
FT                   AKVLINTAQWPSARVDHWRSLLIARAIENQSFMIAVNRTGTSRDTEFPGHSMVIDPLGR
FT                   ILLETNHEEDIYYGDIDLQLVDEVRQQIPVMTDQRLDIY"
FT   gene            318193..319149
FT                   /locus_tag="BPUM_0297"
FT   CDS_pept        318193..319149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0297"
FT                   /product="cephalosporin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60994"
FT                   /db_xref="GOA:A8F9S7"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008864.1"
FT                   /protein_id="ABV60994.1"
FT                   /translation="MQLFDLPLDDLKKYKPKKTARPDFSDFWKASLEELNQVEAELALE
FT                   PYDYPVKGVKVYRLTYQSFGHSRIEGWYAVPDQAGLHPALVHFHGYNASYDGGIHDIVN
FT                   WALHGYATFGMLVRGQGGSEDKTVTPGGQALGWMTKGILSKETYYYRGVYLDAVRALDV
FT                   IQSFPEVDEHRIGVVGGSQGGALAVAAAALSDIPKVVVADYPYLSNFERAVDVALEQPY
FT                   LEINSYFRRNSDPAVEEKAFETLSYFDLINLAGWVNQPTLMAIGLIDQITPPSTVFAVY
FT                   NHLETDKDLKVYRYFGHEYISAFQTEKLAFLQKHLTN"
FT   gene            complement(319388..319702)
FT                   /locus_tag="BPUM_0298"
FT   CDS_pept        complement(319388..319702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60995"
FT                   /db_xref="GOA:A8F9S8"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008865.1"
FT                   /protein_id="ABV60995.1"
FT                   /translation="MSISRIMKWITGIFEACLAIPVIGGLFVISNGYSPLMVMLILHII
FT                   TLVLSKRDQGPMIGSIIGIVTSCLAWIPILGFILHIITALALIITALVPDEKTRQNTSY
FT                   "
FT   gene            319796..320566
FT                   /locus_tag="BPUM_0299"
FT   CDS_pept        319796..320566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60996"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9S9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008866.1"
FT                   /protein_id="ABV60996.1"
FT                   /translation="MRERIKEELKIIEETYDVKICLAVESGSRAWGFPSTDSDYDVRFL
FT                   YVPRKEWYWAMEEHRDVIERPIDDVLDISGWELRKALRLFNKSNPSIMEWLSSDIIYAE
FT                   SFSLAKKLRELKDRAFYPAALMYHYLNMARRNESRHLRGEQVRIKKYFYVLRPLLACEW
FT                   IERYRTVPPMDFHELLKDLVEEGPLLTEIHELLKRKMDGEEMDVENRLAHVHPFIDKEL
FT                   VRFDELVKSYNQPKDNLMQELNELLQSTLDEVWT"
FT   gene            320727..321644
FT                   /locus_tag="BPUM_0300"
FT   CDS_pept        320727..321644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0300"
FT                   /product="proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60997"
FT                   /db_xref="GOA:A8F9T0"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008867.1"
FT                   /protein_id="ABV60997.1"
FT                   /translation="MESVTRNFFLFLSKSSLLNHIARNWGSAVASKKIIGGKDFESAIS
FT                   VIKRLNDQGMAVTVDHLGEFVTKAEIANERTDECIQTIQRIAEAKLNSHVSLKMTSLGL
FT                   DIDDDLVYRNMKRILDTAEKHRIMVTIDMEDEQRCQKTLDIFKEMKSQYEYVSTVLQAY
FT                   LYRTEKDLDDLNELQPFLRLVKGAYKESAEVAYPNKKDVDQNYKKLIEKQLLTGNYTAI
FT                   ATHDDQMIEFTKNIVKKHNIPTSQFEFQMLYGMRSETQQALVKEGYQMRVYTPYGREWY
FT                   GYYMRRLAERPANIAFALKGMTKK"
FT   gene            321668..323215
FT                   /locus_tag="BPUM_0301"
FT   CDS_pept        321668..323215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0301"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /note="catalyzes the conversion of 1-proline-5-carboxylate
FT                   dehydrogenase to L-glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60998"
FT                   /db_xref="GOA:A8F9T1"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9T1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F9T1.1"
FT                   /protein_id="ABV60998.1"
FT                   /translation="MTTPYKHEPFTDFSQEENRKAFEQALGKVTETLGQTYPLVINGER
FT                   IETKDQIVSINPAKKDEVVGTVSKAGKEEAEQAVQAAAKAFETWRYTSPEERASVIFRA
FT                   AANIRRKKHEYSALLVKEAGKPWNEADADTAEAIDFLEYYARQMLELAKGKPVNSREGE
FT                   HNQYVYTPTGVTLVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAARFVEELE
FT                   QAGLPKGVVNFVPGSGAEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLK
FT                   RVIAEMGGKDTVVVDEDADVELAANAIFTSAFGFSGQKCSAGSRAVVHEKLYDQVIERV
FT                   KEITETKTTANPLSADVYMGPVIDQASFDKITDYIEVGKQEGRLVTGGTSDDTEGYFIH
FT                   PTVFADLEPTSRLMQEEIFGPVLAFSKVSSFDEALEVANNTEYGLTGAVITNNRDHINR
FT                   AKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
FT   gene            323342..324574
FT                   /locus_tag="BPUM_0302"
FT   CDS_pept        323342..324574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV60999"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359480.1"
FT                   /protein_id="ABV60999.1"
FT                   /translation="MEEILEKLHTFFDVDKLIAFISGYLKKPVILESTECQLLAYNSYS
FT                   IQQFDPVNQQTIFSKECPGSVVDWLKKTGVIERLHKESKPFYVSGHDELGFNRRVAVSA
FT                   KHKQEVVGFIWVQDIEDSLSQEELQFLHEASFQVGKVIYKNKKQLEKKEGKIEEFFKKV
FT                   MDDHFYTEEELKWEAENLSIPLPAVFTVMVVHAADNKSETAEDVKDVIRTYLQLEDKVN
FT                   HVYSVQADIVVILGSLSDRHSPKATAADVIAHLQSKAHAHPSPLYIGMGREYRDVMKMS
FT                   TSRFEAIEVVKAVKIVGGQELIPYDYENLGVFRFLDSIYSHQKKKNDFNPDLLRLKEKD
FT                   RDSQTSFLKTLEVYLLNNCKLKPAAEQLFIHQNTLNYRMKQIFEMTSIDLSHFSQRCEL
FT                   FIELMLMKKDQ"
FT   gene            324696..325994
FT                   /locus_tag="BPUM_0303"
FT   CDS_pept        324696..325994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0303"
FT                   /product="arsenic transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61000"
FT                   /db_xref="GOA:A8F9T3"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214227.1"
FT                   /protein_id="ABV61000.1"
FT                   /translation="MGAVTLAILIFILTLVLVIWQPGRLTIGWSACGGAILALAFGVVH
FT                   LGDVWEVTQIVWNATFAFIGIIMISLILDEIGFFEWAALHMAKAAKGNGVRMFIYLTLL
FT                   GAVVAAFFANDGAALILTPIVLSVVRALNLDERMILPFVMASGFIADTTSLPFVISNLV
FT                   NIVSADYFHIGFLEYTANMFVPNLVSLGASMLVLYVFYRKLIPKTYDLSQAKEPASAIR
FT                   DIRMFRLSWYVLGCLLVGYFGGELIGIPVSIIVGGIALVFLWLARRSPQVATKRVIKEA
FT                   PWSIVFFSIGMYVVVYGLKNVGLTEILAAWIEQGASHGLLAGTMFMGVLAAVLSSVMNN
FT                   LPTVLIDAIAIGHTDTAGVMRDGLIYANVIGSNLGPKMTPIGSLATLLWLHVLKKKGVH
FT                   ISWGAYMKAGIILTIPTLILTLLGLYVWLWLIH"
FT   gene            complement(326042..326719)
FT                   /locus_tag="BPUM_0304"
FT   CDS_pept        complement(326042..326719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0304"
FT                   /product="cysteine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61001"
FT                   /db_xref="GOA:A8F9T4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359484.1"
FT                   /protein_id="ABV61001.1"
FT                   /translation="MGDIHLEYIFNPALAKASFPFVMKGIWLTLLISFVSMFFGTILGF
FT                   FIALARMANTWMLWLPARLYISFMRGVPILVILFILYFGFPYIGIEFTAVTAAIIGFSF
FT                   NSAAYIAEINRAALSSVPSGQVEAAKSLGLSYWQTMRGVILPQSVRIALPPLANIMLDL
FT                   IKASSLAAMITVPELFQQAKIVGGREFDYMTMYILVALIYWGICSVVSLLQDFLEKRYA
FT                   KYL"
FT   gene            complement(326732..327604)
FT                   /locus_tag="BPUM_0305"
FT   CDS_pept        complement(326732..327604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0305"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61002"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008872.1"
FT                   /protein_id="ABV61002.1"
FT                   /translation="MSRFYHRKSIWVMLVVSAFILVLSACSQSGSSQSGDSKWDKIQKK
FT                   GKIVVATSGTLYPTSYHDTANGKDQLTGYEVEVVKEAFKRLDVKVEFKEMGYDGMLSAI
FT                   NSGQVDAAANDIDITDDRKDKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGA
FT                   ATTIYMDVARKYGAKEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPKLNIT
FT                   IHPDLKYMPNEQGFVMKKDNTELQKELNGVLKDMKKDGTMKKISEKFFNHADVSKKIDA
FT                   DVEDVDISK"
FT   gene            327785..328114
FT                   /locus_tag="BPUM_0306"
FT   CDS_pept        327785..328114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0306"
FT                   /product="sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61003"
FT                   /db_xref="InterPro:IPR024485"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008873.1"
FT                   /protein_id="ABV61003.1"
FT                   /translation="MKRISGLFILSVMLLSGFYMETAHGETPQMEKRPVTHQVKLTTEQ
FT                   QKQIETLEQQILSKRKEVIEKYVQYGVLTKEQGTHITKRMDEHYNHLKNNGFVPLLKKP
FT                   QHHRP"
FT   gene            complement(328162..328926)
FT                   /locus_tag="BPUM_0307"
FT   CDS_pept        complement(328162..328926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61004"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008874.1"
FT                   /protein_id="ABV61004.1"
FT                   /translation="MKITLIRNATLYLEYGQTTFFIDPFLAAKGTYPPFPHTANQHLNN
FT                   PIVDLPVNIDLDNMLHPDAVLLTHLHVDHFDDEAKQKIAQDQPIYTQSENDKKEVEEAG
FT                   FEHVTCIEDEIDISGVHILRTGGQHGTGEIAKRMGQVSGFVFSHPDEPTLYIAGDTIWC
FT                   DEPKEVINTCKPDVIVVNSGAAQFLEGDPITMTKENILDVHHSHPTAQIVACHLEAVNH
FT                   CLLTRASLQAYIQEHQAEKAIFVPKDGESLTF"
FT   gene            329042..329458
FT                   /locus_tag="BPUM_0308"
FT   CDS_pept        329042..329458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0308"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61005"
FT                   /db_xref="GOA:A8F9T8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008875.1"
FT                   /protein_id="ABV61005.1"
FT                   /translation="MLDQTDMNILKELSKNSRLTMKALGEKVHLTGQAVANRVLKLEEE
FT                   GVIEAYTISIDWRTQKTIQTFMQLYTRSHHHEPLLSFLDRQEEIKNLFKISGEGCYMAE
FT                   GHFSSHDELDLFLTELTIYANYKLSIAVKRLIHQ"
FT   gene            329488..330294
FT                   /locus_tag="BPUM_0309"
FT   CDS_pept        329488..330294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0309"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61006"
FT                   /db_xref="GOA:A8F9T9"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9T9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214338.1"
FT                   /protein_id="ABV61006.1"
FT                   /translation="MKKLIENQAEPVTKETIKADLVQLGVKKGMILCVHSSLSSIGWVN
FT                   GGAVALIQALMETVTEEGTLIMPAQTLELSDPADWIDPPVPFSWWKSIKDTMPAFDPAY
FT                   SIPTAMGKVAEAFWKYPGVARSNHPHFSFTAWGKKKHELLKHHALSFGLGEHSPLARMY
FT                   DVQAQVLLIGTSFESLTAFHLAEYRIPQQDLMTRGAPILENGWRVWKEYQDIITREELF
FT                   EQIGQDFLKSGGTHHHGQIGLASSYLLPVRESVDFAEKWLDLYDQS"
FT   gene            complement(330296..330682)
FT                   /locus_tag="BPUM_0310"
FT   CDS_pept        complement(330296..330682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0310"
FT                   /product="DNA-entry nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61007"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="InterPro:IPR038691"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213827.1"
FT                   /protein_id="ABV61007.1"
FT                   /translation="MNNLNQAYSLSISYHQITVYTGSKTPPVIDWSDDDILQGFAMGDQ
FT                   GVSFEGINNGKASVTVTLNNDISPASADRTITIPFTHASDQVYITSVMAQVLSFPIPKG
FT                   DYQLTCYTTQQPDEDLYHIHFQTV"
FT   gene            complement(330803..332500)
FT                   /locus_tag="BPUM_0311"
FT   CDS_pept        complement(330803..332500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0311"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61008"
FT                   /db_xref="GOA:A8F9U1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358550.1"
FT                   /protein_id="ABV61008.1"
FT                   /translation="MKKKGKLRLGAKILLIFLSVIIIFSAIVGYVVNREMTENIKHMAT
FT                   EKAKGDLKLGYAYLDEKVAGSWQIKDGKLYKGNTQINDHDTLVDHLAKYTDDTITIFQG
FT                   NTRVATNVMLNGKRAVGTQVSPEVKATVLDQGENYYGTANVAGKDYQTAYMPIKNDAGE
FT                   TIGIFYTGANQGMISQMLQSFYIQFFIVLLLSLIVAVIIISIFTKRIQTRLKRMASAIK
FT                   SAGEGNLTINVTDTTGDELSDLADHFNKMREKLNHTILNVMNTSELVATSSEQLSASAE
FT                   ETSAASEKITHSIQEVAHSSEEQSAQMTTSEHTMIQVSNELANITDNAGQMASRSQYAQ
FT                   EMALKGVQNIGEVNSQMTSIAKSIEENGTAIQALETRSAEIDHISHVITDIANQTNLLA
FT                   LNAAIEAARAGEHGKGFAVVADEVRKLAEESQASSNMISHLISEIQKEMTYSTSAIKRV
FT                   REEAAQGTVLISHTEESFIDIQQSMREMADGIKHLSSASQKIAAYTNDAKQSFATITEG
FT                   VKLTSEHSQQVAGLTEEQFAAMEEVTASSEALAHLAGDLKTMVSQFHI"
FT   gene            complement(332628..333056)
FT                   /locus_tag="BPUM_0312"
FT   CDS_pept        complement(332628..333056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0312"
FT                   /product="sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61009"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214307.1"
FT                   /protein_id="ABV61009.1"
FT                   /translation="MKLLKIILLLLLIVVGVATGYIQLEQSKQETTNSSYDKTIHFPSD
FT                   RYPETAKHIEEAIDEGHSSVCTIDREHSDEQREQSLQGTPTKRGYDRDEWPMAMCKEGG
FT                   TGASVKYISPSDNRGAGSWVGHQLSDDPDGTRIQFIID"
FT   gene            333059..333454
FT                   /locus_tag="BPUM_0313"
FT   CDS_pept        333059..333454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61010"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358549.1"
FT                   /protein_id="ABV61010.1"
FT                   /translation="MLALFLVCVFCKQKYSRITYQFLLVLKKRLLKFEKRFLSVFLLFT
FT                   CVKIHKNFNFSVHKKIILYQNGFITAFWANFKNLTRRNFKKIKLTRPICFNNMESNIKK
FT                   CRNLSKYHSIYIVGGKYKWRMSLIGSA"
FT   gene            333424..335493
FT                   /locus_tag="BPUM_0314"
FT   CDS_pept        333424..335493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0314"
FT                   /product="hydantoin utilization protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61011"
FT                   /db_xref="GOA:A8F9U4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359500.1"
FT                   /protein_id="ABV61011.1"
FT                   /translation="MADVSYRLGIDIGGTFTDLSLMNEATGALTELKTPTVTDDPAQGI
FT                   INGLKLLKDRGVDLSKIQYLVHGMTIGLNTLLQRKGADLALFVTEGFQDILSLQRLRLP
FT                   IPYDFNSRLPEPLIPRKHVYPISERLIHDGTIKKPLHLQQLDHAVQQVISKGLAGIVIS
FT                   FLHSYQNPVHELQAKAYIKHHYPQLEVLTSSELWPQMREYERTVMSVVNLYIQPKVKQY
FT                   LQTLKSRLKEEGVPISPYITQSNGGLMDAESAADSPVKTLFSGPAAGVIGAARIAASAN
FT                   ESNLITFDVGGTSADISIIQNGQPTMAQSNQLSGFPIILPSVAMYSIGAGGGSVAWIDQ
FT                   GGLLKAGPESVGSHPGPASYGKGTKAALTDAFLICGYLNQERFAGGHLQLQLSAAEKAF
FT                   QPIANQLNKTVEEAADQLIQVAVANMYTELSNVMEQQGFDPRDFSLLAFGGAGPVVANF
FT                   LAREIHAKNVVVPPSPGTLCALGALTADFIHDAVLSKKICLQDYSIDQLKQDYEVLSRK
FT                   AIDWFSQQNIQHIKQTSILLLADARYQGQAFEIELPLSAEWLKQEQDIHQLVEAFHKLH
FT                   QRQYGHRDDQANIEFTHLRVRVIGETPPLPLTPAHESSGQSLKPHEFRRIFIEEKEYEA
FT                   AIYHRNTLSVGSVMNGPAIIEQDDTTTLILPNWAGSIDPSGNLVISREAALHEN"
FT   gene            335483..337468
FT                   /locus_tag="BPUM_0315"
FT   CDS_pept        335483..337468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0315"
FT                   /product="hydantoin utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61012"
FT                   /db_xref="GOA:A8F9U5"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213841.1"
FT                   /protein_id="ABV61012.1"
FT                   /translation="MRTDPAKLEMMRSYFNAIASGMGHVIERTSFTTFVKESADFATAL
FT                   ATPSGDFFVYPKTVGVTIFLGLSLKKAIEESGPMQPGDIIITNDPYTTDGLATHLPDVH
FT                   IIKPIFVDGEIVSYAWSFVHVSDVGGLVPSSISPTATDVHQEGLRIPPVKIYEDGKENQ
FT                   VVRTFLRANSRAGHLNDGDINAMIAAVNTAEIRLKEMIGKFGINEVKQGMMDLLKQAEV
FT                   RAGKVIEAIPDGTSEFADYLDDDMISDVPIRLKIKLTVKGKRLTLDFSECDPQVKTAFN
FT                   LVTNGQKHSFLYQGLINYIISQDPFIPINGGITYPIEVISPKGTLVHPEYPASVGIRHS
FT                   ITMRLYNVVLGAIGKLLPEAVPAAGAGQSAIVVLSVPDNQTGGRKMSVVEPLGGGGGAQ
FT                   NGTDGVDGIDHSSGFLKNTPIESLEQHIDIHVHRYELLPNTGGAGENRGGHAIGLEFEM
FT                   LKPESMVTARGMERMKFQPWGLMSGRAGAIGEVKLVTARGEKQDQPKIDVLRLEKGDIV
FT                   QLTSPSGGGWGNPFAREKEKVLHEVEAGLLSEERALQQYGVKVYVDQNEWKIDEEQTNQ
FT                   LREKGNHPAHMMWDVGEHREAYEKVWTDEASSELAVLLRSYPANERTHYKHAVHQYFSH
FT                   RNEPLTKKDIIQALRHLDGQKGGNES"
FT   gene            337465..338550
FT                   /locus_tag="BPUM_0316"
FT   CDS_pept        337465..338550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0316"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61013"
FT                   /db_xref="GOA:A8F9U6"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008883.1"
FT                   /protein_id="ABV61013.1"
FT                   /translation="MRRRLITIFAGVLSMILLLSACGGNGQDQGKQQQTVIVGVYGGDW
FT                   EKNIKPILEKFEKDTGIKVQTVSGADSEWFTKLKASNGKNPPYDLLILQPDTIQRGIAA
FT                   NVLAPIDEGKAPNVKKLYRSVQKKLTVDGKQYAAGFSMGQLGIAYRKDLVKQEPNSWTD
FT                   LWSSQLKGKVAISSPTYSAGLQFFSALVHAQGGTESNPKDIDKAFKSLSQLKGHVAAFP
FT                   DNPGSIQTLLERGDVAAVPYWDGRVFALEEEGMDIGFSYPKEGAVAAVASWALTKGSQH
FT                   EEAAYKLLNYLSGKEAQEAFSEKSYYGMSNSDVKYGDKIKGKVKVGENYYSKLTWVDYE
FT                   TATSELGNWTNRWNEVLGGGK"
FT   gene            338559..339650
FT                   /locus_tag="BPUM_0317"
FT   CDS_pept        338559..339650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0317"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61014"
FT                   /db_xref="GOA:A8F9U7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359507.1"
FT                   /protein_id="ABV61014.1"
FT                   /translation="MSGIHLEHISQHFGEQIALNDVSLTVNEGEFFSLLGPSGCGKSTL
FT                   LNIIGGFLEPTKGVVYIGDQDVTNLPPYQRKTGMVFQSYALFPHLTVFDNVAYGLKVQK
FT                   KKKAEIKEKVMDSLSLVQLEAFAKRMPHQLSGGQQQRVAIARALAIQPSVLLLDEPLSN
FT                   LDAKLRKNMQTELRNIQRNVGITTILVTHDQEEALSLSDRVGILGEGKIQQIGTPLEVY
FT                   RQPNNRFVAEFIGQVNLFEAVYDEASAAFIVPHLIQSNGQQVQLKAAAHYEKKEKHLLM
FT                   LRPERINISSERGDIQSNHVSGVLTDVSYIGHSLRLVVGLDSGEMIVHASDAAFPELPK
FT                   AGEAIHINWQPEDIVFLDSKVHT"
FT   gene            339650..340519
FT                   /locus_tag="BPUM_0318"
FT   CDS_pept        339650..340519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0318"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61015"
FT                   /db_xref="GOA:A8F9U8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214329.1"
FT                   /protein_id="ABV61015.2"
FT                   /translation="MRINKRNQRFHWFMLLPACLFLVVFLLAPLVMMFVLSFRDVDSMM
FT                   NTLQTYSFSQYIHVFTTDAYVKAIGSTVWVALQTTVICLLMAYPAAYVLVKAPHPRLRA
FT                   FFYILLVSPLLTSVVIRTFAWIVLLSQNGLINGMLLDLHVIEKPLSMLWNMNAVIIAYV
FT                   QVMLPFAVLPIATSLTDMDRHLRPASMSLGAGRIRTFFHVTFPLTIPGMVTGAIIVFSL
FT                   AAGSYITPLLVGGRMQPLLPLSIYQQVMQVYNLPLAAAMSFTLLVCVLIVVSLLSYLLK
FT                   RWEARMHA"
FT   gene            340512..341315
FT                   /locus_tag="BPUM_03875"
FT   CDS_pept        340512..341315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_03875"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_03875"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35532"
FT                   /db_xref="GOA:A0A0U2VM20"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2VM20"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214190.1"
FT                   /protein_id="ALS35532.1"
FT                   /translation="MRKKSFGDRLLSILIWTAGSLVYLFLTIPVLVIVLSAFSPNAFPE
FT                   FPPTSFSVRWFQEVVSNPEWMESLRISVMLLFIVTPLTVLLGTMASYALARLSFKGKEA
FT                   IQAFILSPLMIPQVVLGIAMLYLFTAMGFTGSLWALVIGHVIIGFPYVVRTVGVSVSNL
FT                   DPRLELASMNLGAGPIRTFFRVTLPLIKPGIIAGGVFSAVTSFGEISISLFVSSPQTIT
FT                   IPVRTFNYIEQTFDPSVNAISVIFIIISIIALLIIEKTIGLSKVM"
FT   gene            341924..352630
FT                   /locus_tag="BPUM_0319"
FT   CDS_pept        341924..352630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0319"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61016"
FT                   /db_xref="GOA:A8F9U9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9U9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214217.1"
FT                   /protein_id="ABV61016.2"
FT                   /translation="MNTVYYPLTHAQKRVFYTERFYPGTSISNLGGFARLRSVSGLDPS
FT                   LVVDVLQMYIRQTDSLRLRLVYRHEQEEPVQYIKPYEEQPIRLEKGWSEEEVRAWANEQ
FT                   IREPMPLIDSPLIEFTVFQISDQECWLFCKAHHIVADGISIILMGNRIIDLYQDMLHGV
FT                   DISPVEEISFVDHITSEQSYETSKRFQKDQAFWNEQFANIPDFASLKPHKGYEMSLHAE
FT                   RFSGDIPDSLKEKLRAFCEEQKVSMLSMFMSTVYTYLHRFSGMEDVVLGTFMGNRTNAK
FT                   EKKMIGMFVSTIPMRASVQGSQSFLDFVKQVMADQMKILRHQKYPYNLLMNDLREREGF
FT                   TGRLFDISLEYQVMQWQKKENLSFITEPIFSGSGMNDISIHVKDRWDTDTLTIDLDYRT
FT                   DVFTEEEISQMFKRFLIILEAAVSQPDQLIGKLPLLPPDEQKELLQLSEVKSFEKPAVK
FT                   PVHHMFDETANKYAERTAVVAENGAFTYGELYQKAEKLARFLQMKGVSRDVPVAVLMDR
FT                   KAEAMVAIFGILKAGGAYVPIDPALPEERIQYIVEDSGASIVLTEETFVSTYHALSEKM
FT                   VVLQQIALDDERLPQLVDESVPEDLAYMIYTSGTTGKPKGVMIEHLQLHHLVHALHHEI
FT                   YEEASELQMALLAPFHFDASVKQIFTALLFGHTLHIIPRETTRNGVQLAAYYRKHQIEA
FT                   ADGTPAHVQLLLAAELEGLSLLHMLVGGEALPAKAAHSLIEAIRMSEPDFTLWNVYGPT
FT                   ETCVDAAVHRLELSELRESSEQQRYVSIGKPLGHHRLYILNEHDQLQIQGAAGELCIAG
FT                   IGVGRGYVKQSELTEKVFTADPFSPGERMYRTGDLVRWLPDGTIDYLGRMDDQVKIRGY
FT                   RIEVGEIEAVMEQVVGVDQAVVLVVEEADGEKALSAYYQSRQEGVSVDMLQAAIKHQLP
FT                   AYMMPLYFKELDAFPLTVSGKVDRRALAALKGDKAVQAVYAAPRNELETKLVRLWEEIL
FT                   GQEKIGVYDSFFERGGHSLKAMTVLTHVQRDFHVEVPLSILFEQQNVAALAAYIEQAET
FT                   SSETVIPKAPAFDHYPLSPPQQRVYMVSQLEQSTAYHMPAVVRLKGTLQQEKLTEAFET
FT                   LITRHDMLRTSFHTLKGVPRQRVAPSVSFQIEQLTGGTMEENMKQFVRPFDLECAPLLR
FT                   IGLKSLHDQEHLLFFDMHHLISDGLSIDLVLRELSDAYEGSVKDPLKLQYQDYAVWQEQ
FT                   QDFQKEEAFWLQEFSGDLPALQLLTDYQRPAVQSFAGDRVIKEIDGTLKGQLQDLAAKH
FT                   HTTLYTVLLSAYYTLLAKYTGQKEFVVGTPASGRVHADLDDMIGMFVQTLALRSEVDPN
FT                   ATMSQLIEQVKEKTMHAFEHQQYPFERLLEKLNVPRDFSRHPLFDTVFTLMPDHGSAQH
FT                   IGEMQVEIEETNFHIAKFDLTLQAMESDQGLSFVLDYSTALFKRSTAEQILHHYMYLLK
FT                   QMVQAPEGAIRSYRLLTEQETEAQLNLWNPLPTPYPTEETIVTQFEAQVQAHGHKPALQ
FT                   CEGVILSYQELNDRVNQLAHYLREHGFERGMKAALFFERSNEMVLSVLAVLKAGGVYVP
FT                   IDPDFPDERVKHFLTDSGTQFLLTHQVLRQRSVLASFEGTIIETEDQAIDQQSDSNIKI
FT                   RLSPEDLANLTYTSGTTGKPKGNMVTHRNILRTVKQSNYLAIHQEDTVMSLSNYVFDAF
FT                   MFDVFGALLNGAKLIVLPKDHILNMNELSGAIEKEKVSILMITTALFHLLIDMKKDSLK
FT                   NIRKVLFGGERASVPHVMTALETVGEGTLVHMYGPSESTIFTTYYPVNYIEEQALSIPI
FT                   GKPVSQTAVYIVDEFGQLQPPGVAGELCVAGDGLVKGYYGQQELTSEKFVENPFRPGEV
FT                   MYKTGDLARWLSNGEIEFIGRIDHQVKIRGQRIELGEIEHQLLRHPQLKEAVVIAAPND
FT                   TLCAYFTAEGSVSLTDLREQAGRELPVYMMPSFFMQLDELPLTNNGKLDRRALPVPDLS
FT                   EQGVNEYIPPQTETERVVARIWEEVLEVPRIGRHDHFFECGGHSLRGMKMLNKLYEEMH
FT                   VELTLKSLFEFPTLEAFAFAVDQADQTEIKRVEVAEEATYYPVTSAQKRLFVLEKMTDA
FT                   EQSYHMPAALKLEGAFDEKRFKKAIEQLVQRHEAFRTSFDFVQNEPVQRIEPNISVAIE
FT                   TIEGNGRDIQELMNDFIRPFDIEKAPLFKVGLVSASVNVHYLLIDMHHIISDGASVGIL
FT                   IEELSALYRGDKLEELPVQYKDYAVWSKSETFSAQIEAEEAFWLKQLEGELPVLALPED
FT                   LPRPKVQTFSGDRVSFTINGPLKTKLDELVRALNSTTYTVLLTCYSTLLSKLSRQEDII
FT                   IGSPIVGRTHPDIQSVIGMFVNTLALRTQPAGHLTAAEFASNVHQLVLEANDHQLYPFE
FT                   ELVDQVQTVRDTSRHPIFDVVFSMENADIRDLKMDGLQVVPEPFEENIAKFDLTLTGNE
FT                   SVDHIELVFDFNTSIFQQSSIEKWKEFFLHLLEQMVSAPDQLLDQMQLLSPKQQQKLLS
FT                   EWSGPVLDVPSDQTVHALIEAKAFEAPNQKAATFCGTSWTYEELNSRANTVASRLISNG
FT                   IKRGDRVGILTRPSLDMTAAVLGVLKTGAAFVPIDADYPDQRIAYMLEDCGAEVLLMQK
FT                   GLTAPTSFTGHVLLIEDAIEGEAQEIQVHVKPTDLAYMIYTSGTTGQPKGVMVEHQSLV
FT                   NLAFWHNDAFQVTNADRTAKYAGFGFDASIWEMFPTWIAGAELHIIDEAIRLDMIKLNT
FT                   YFNDENITIAFLPTQLCEQFMSMDNHSLRYLLTGGDKLKQVKPVPYQLVNNYGPTENTV
FT                   VATSGIIDPNQGTLPIGTAIANTRFYIMGSLYDLSPPGVPGELVIAGKGLARGYWNLPE
FT                   ETEKRFVPDPFYSGERMYLTGDLVKWTEDGELIYLGRKDHQVNIRGFRIELSEIEAQLL
FT                   ALSDVKEAVVTTIKDASEQDALAAYVITDEETIDLKESLKRTLPDYMIPSWIIKLDQLP
FT                   MTANGKVDLKALPAPDMEAGQTAYEAPRDEVETLLCGIWEDVLGVSQVGIHDHFFFLGG
FT                   DSIKGIQMASRLTQAGWKLDMKLLFQYPTIAELRPYIEEADQLTVDQSPVEGEVIFTPI
FT                   QRWFFERNFTSQHHWNQSIMLQAPNGLDETIVQKVLEQLMIHHDALRMVYPLEEGRLIQ
FT                   RHRKIEENLVAVDVVEVQGELWEQIQQVEKLANEVQASISLAEGPLVKPAIFRTDQGDH
FT                   LLLAVHHLVIDGVSWRIFLEDFMALYEQSKRGEILTLPEKTHSFQEYAQKLTEYAMSDE
FT                   LLSERAYWKKVLAHSVTPLQKDHVTEDQRMLHTQTIRFTLSEEETRSLLTDVHEAYQTD
FT                   INDILLTALGLSMKEWTGEDRHFIHLEGHGREDILPAVNVSRTIGWFTSMYPVLLDMSH
FT                   ADDLSYQIKYLKEELRHIPNKGIGYGILKYLTPDKMKDAISFDLAPDISFNYLGQFDEQ
FT                   ITGELSRSTWDSGKSLSPESEKPHALDIVGFVEQAKLHVTISYHHLEFEERTMEQFKDL
FT                   LEKNVKTLISHCVSQEETQMTPSDVGDEDLTMDELEKLMDIF"
FT   gene            352651..363339
FT                   /locus_tag="BPUM_0320"
FT   CDS_pept        352651..363339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0320"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61017"
FT                   /db_xref="GOA:A8F9V0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008887.1"
FT                   /protein_id="ABV61017.1"
FT                   /translation="MSKQKIQKVYPLTPMQEGMLYHAMLDPNSSSYFTQLELGISGEFD
FT                   HAVFEKSLNELIQTYDILRTAFVYQQLQKPRQVVLAERHLDVYREDLSHLNHQEQQKAL
FT                   DQYKKQVRKQGFHLTNDLLLKVAVFQLNETNWHLIWSNHHIVMDGWSMGVLMKKLFHYY
FT                   ESYRNGRTPDRSQGKPYADYIQWLGKQNKQEAERYWEERLDGAVQHQGLLEQKDANGQY
FT                   DHQEWKFTWDTQTVQAIQNVARQCQVTAPNLFQAVWSVLLGTYHATDDVTFGTVVSGRP
FT                   PSVSGIERMAGLFINTIPVRVTVDQKQTFKQLFQKVQQHALEAENYDFMPLYDIQQKTA
FT                   AGGQLFDHLVGFENYPLDQELSGDTMSARLGFSIDVKDGFEQTNFDLNVLVYPGETWTL
FT                   KIKYNAIAFEEKVIENISKHLTNLMKQIIQNPDARLHDVTCITEEEKQQIKAWNQTDRD
FT                   YPKHLSIPELFNERVKAQPDHLALVEGDRTFTYEELGEEIHRLAGSLIEKGVQPGDAVA
FT                   VYMNRSADAVIAILAVLHAGAAYVPIDPSQPEERIRWMLEDSGATILLHADSPPPVDEQ
FT                   IKTVHVTSKPHHLHMDVSVRTSPSHLAYIMYTSGSTGQPKGVQIEHQHIVRLACSQDKL
FT                   GLTKSDRMAHTGAVSFDAITLEIFNTLLGGATLYPVDRDTLLDIHRFEQFIQTHQITKL
FT                   FLTTGLFNQLAQQRPQMFKGLTTLITGGDVINVKSAELVKQHHPALVLLNAYGPTENTT
FT                   ISTIYEVRGDETGPIPIGQPINHSSAYILDDDQRLQPIGAPGELYVGGDGVARGYLHRP
FT                   DLTNQVFLADPFKPSGRLYRTGDLARYGADGQIEFLGRTDDQVKIRGFRIELGEIETML
FT                   QQKTGIDDAVVLVHSFSSDEKEITAYFTGTMTEEEVRNLFNQELPAYMVPHHVMKLDAF
FT                   TLTSNGKVDRKALPKPDEAHQEKKEIIPPDTETEKALAQIWEELLGKTVGVDEHFFMAG
FT                   GHSLKAMMMSAKIQEVLQKEVPIQVIFEKPTIRSLAVYIDQNGQEEMMHPILPAEQSDE
FT                   YPVSPAQRRLYILQTLEPDSTNYHIPIVLTLEGTLEYQRLKSAFDQLIQTHEILRTSFH
FT                   MNGEDIVQRVNDWTAFDLPVHHIKEEEAEAFLSENQSPFDLTVAPLLRAQLLKISENRH
FT                   LLVLEAHHLITDGSSMKTFIQDLAKAYDGEALTERAIHYKDYAVWQLSEEETEKQKEHE
FT                   AYWLKQFEGDLPVLELPTDYSRPAERDFSGERFMFGCDQETTQRIHDLLQKTDTTMYMF
FT                   LLSAFQVLLAAYSGQEDIIVGSPVAGRTHPDIQDMPGMFINTVAMRGKPAQTKTFLKLL
FT                   EEIKETSVDAFAHQSYPLEELIARLPLDRDTTRSPLFSVSFNMQNMEVPALKLGDLHIS
FT                   PYAIQHHSVKFDLSLEAFEREGALKLSFDYAAALFKEETVRRFGTHLLAIIREAVQHPE
FT                   EQIGLLPILDQHEQIERLEKKDEVQTNRHEPFHVQFSRQAKETPDAIAVMDEQRKLTYR
FT                   ELEDMSNALGSELKVRGVEKEKTVALILDRSVYVIVSMLGVMKAGGAFVPIDPAFPAER
FT                   INYTLEDSGAQVIVTNESLVSSYQHLKSIQVVQVEKAVRQSRTLDLPEASSDQLAYVIY
FT                   TSGTTGKPKGVQLTHRNLSHYVNWLTNEVTLQECDRTALLSSYAYDLGYTSIFPVLKAG
FT                   GTLYVPREDVYKDPVRLMRFIDEQELTYIKMTPSLFHMMADSKDHAFNALRLVILGGEP
FT                   VVSEDVETFMEQHPCVAVMNHYGPTETTIGTVTKLITKQELGALKDRSVIGQPIAHTRA
FT                   LVLNRQQRLVPYGAPGELYISGEGVSIGYLNQPELTAERFLENPYFPEELMYRTGDLVR
FT                   QHANGDIEFLERIDDQVKIRGYRIEKQEIEHAARARLSIHEVYVKVLHMSRLPELALYY
FT                   TAPEPIGTLTFREKLAETLPDYMIPTYFVKVDHIPLTQNGKVDAKSLPLPHEAHMKRAM
FT                   HVAPETALEQTLCDIWSEVLGVEQIGVHDHFFELGGHSLKGMVLISKMQAKLNKHVPLK
FT                   VLFEKPTIRAMAAYLEKVVSSDMTSIQPAEKQDFYPVSSAQKRMYVLQQLHSEAVTYHM
FT                   PAVLMMEGSLDVKQLEEALGALIERHESLRTAFVEIDGVPVQKVYRRVPFTLEVVEVEN
FT                   GHEQPVIDAFITPFSLHQAPLMRAKVAKLSDEKYVFMMDMHHIIADGVTRSLLIQELAE
FT                   LYEKKTLPPVQLHYKDYAVWQQEEKQRALLEKQRQYWLEQYAERPEDLALPLDFPRPHV
FT                   QSFEGDRVDRWLSPEKVQTIKALMAEKGVSMNMVMQTAFAIFLSKLTGQTDIVIGAVTA
FT                   GRMHTAIERVPGMFVNTLALRQEVQLEETTAQLLEKMKDRSLSAYEHQDFPFEELVAQL
FT                   DLPKDTSRNPLFSVMLTTDDRDMTLPNLNGLKLSQKQQETVHAKFDVTLGIFEEKDQVG
FT                   VRFEYATALFKKKTIQRWSRYFEQIIDEMLAKLNEPISSLSILTENEKQELINEWSGPV
FT                   LNVPSDQTVHELIKAKAFEAPNQKAATFCGTSWTYEELNSRANTVASRLISNGIKRGDR
FT                   VGILTRPSLDMTAAVLGVLKAGAAFVPIDADYPDQRIAYMLEDCGAEVLLMQKGLTAPT
FT                   SFTGHVLLIEDAIEGEAQEIQVHVKPTDLAYMIYTSGTTGQPKGVMVEHQSLVNLAFWH
FT                   NDAFQVTNADRTAKYAGFGFDASIWEMFPTWIAGAELHIIDEAIRLDMIKLNTYFNDEN
FT                   ITIAFLPTQLCEQFMSMDNHSLRYLLTGGDKLKQVKPVPYQLVNNYGPTENTVVATSGI
FT                   IDPNQGTLPIGTAIANTRFYIMGSLYDLSPPGVPGELVIAGKGLARGYWNLPEETEKRF
FT                   VPDPFYSGERMYLTGDLVKWTEDGELIYLGRKDHQVNIRGFRIELSEIEAQLLALSDVK
FT                   EAVVTTIKDASEQDALAAYVITDEETIDLKESLKRTLPDYMIPSWIIKLDQLPMTANGK
FT                   VDLKALPAPDMEAGQTAYEAPRDEVETLLCGIWEDVLGVSQVGIHDHFFFLGGDSIKGI
FT                   QMASRLTQAGWKLDMKLLFQYPTIAELRPYIEEADQLTADQSSIEGEVMLTPIQRWFFE
FT                   RTFTNQHHWNLSMMLHAPNGFDLSMTEQVMQKLLSHHDALRMVYRQENGSILQYNQREL
FT                   TEPIAMISHDVSKEPDVKKTISTYANEYQRQLNLETGPLMKVICFRAKDGDHLLIVTHH
FT                   LVIDGVSCRILLEDFMSLYQQAAQGQTLVLPPKTHSFKEWAEAIERYAQSKPLKSQSEY
FT                   WNEIDRTPMTTLPVDHEVTKRKVAQTKAVQMQLSESETEHLLTDIHLPYTTEMNDILLC
FT                   ALGLAVQEWTGESHVHVQLEGHGREDILSGLDVSRTIGWFTSMYPVVLKAKPDQSIAEA
FT                   IKGTKEMLRRVPNKGIGYGILKYLTESSGQHVQPEISLNYLGQIDQEVTTELFGPSAYD
FT                   MGRQASPDSEAVYKLNLSGLVQHNRFMLSCSYCSDEYEEETIQQFMALLKEKIQCIMTH
FT                   CLAQQEREFTPSDFSAGDLEMDEMDDIFDMLEEKLT"
FT   gene            363384..367217
FT                   /locus_tag="BPUM_0321"
FT   CDS_pept        363384..367217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0321"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61018"
FT                   /db_xref="GOA:A8F9V1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008888.1"
FT                   /protein_id="ABV61018.1"
FT                   /translation="MSSFKRDQVQDMYYLSPMQEGMLFHTLHHQEKGFYVEQMDMNVKG
FT                   TLRHDLLEKSMNVIVERYDIFRTVFLHEKVKRPVQVVLKKRPFTLDVVDMQDLSEDEQL
FT                   VRIETFKQQDQLRGFDLSKDALMRATVFQTSPTSYRWIWSYHHILLDGWCFGLVVQELF
FT                   AMYHALLHDIPYKLEPVKPYKEYIQWLEKQDKQASLQYWQQSLAGFDVQSTFKEQRKQT
FT                   NEHELGEMEWSMSKEETAALSALAFQQNATLSSVLQSVWSILLSRYQRSNDVLFGTVVS
FT                   GRPADLAGVDKMVGLFINVIPRRIQLTDDMTFRTLLSETQQQSLAAEPHQYIPIYDIQA
FT                   ETGHQPLIDHIVVFENVPTAKKDEQEARLGFTVENMNVYEKSNYDLNLLASPGEQLQLK
FT                   LAFNKKAFDSQFVQRLKEQLSLLMSEAIKHPDQSVHTLTLVTKQEKQLILEEWNASELE
FT                   HDQLYLSKWFEHNVRKQPNAVALSAGEHTMTYAELNEQANRLARHMQKNGVTHQTVIAI
FT                   IADRTSELIVSLLAVLKAGAIYVPIDPDYPESRIQYMLKDSGATHLLTHSSFISQVKAL
FT                   AFDGTYLFADDQEISLMSSENLPLEAGLHDTAYIMYTSGTTGQPKGIMTTHSNIARVVK
FT                   NTNYLTISETDTLLSLSNSVFDGFTFDVYGALLNGAKLVLPKKETILNMGELTGLIKRE
FT                   NISVMFVPTALFNLLVDENTDWMRSVRKVLFGGERASVQHVRKAFAVMGKGRLINVYGP
FT                   TESTVFATYYPVDEALPMDMRSIPIGKPLNQTGAYILSQHRQLQPIGMVGELCLSGKGL
FT                   AKGYLNRPDLTKQAFITHPFAARERLYCTGDLAYFRADGLIEYAGRVDDQVKIRGHRIE
FT                   LTEIEAHLLMHPGVKQAALIADQHNTQHTRLLAYMTCEEEWKDKLDVIKSGLKEKLPAY
FT                   MQPHELIRLEKMPLTPNGKVDKRQLPKPEVPQGNHHLKLPVNEVEQKLIVMWQEVLERE
FT                   NISTDDHFFEIGGHSLKAMSLLSKVSKEFDVQVPIHLMFETPTIEAISRYIQQQDQEAA
FT                   GYLVFNESQTPTVFALPPLPGYGFIYQEAAKTLDDVRLIAFDFIEADHRITQYVQHIQH
FT                   LQPEGPLTLMGYSGGCYLAFELVQSLEQAGRTVEKVIMIDSYMKIGESDLEGRSIDDDI
FT                   AAIVHQSKQSELAQAELIQDELAQKTRAYYETFVKGVNQGEIQADIDFIQSEENIAIPE
FT                   WMDHWEAATTGAYRQYQGYGQHADMFKNKECAARNAQLINEIVHHKNRETVL"
FT   gene            367281..377411
FT                   /locus_tag="BPUM_0322"
FT   CDS_pept        367281..377411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0322"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61019"
FT                   /db_xref="GOA:A8F9V2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214194.1"
FT                   /protein_id="ABV61019.1"
FT                   /translation="MKPSIINQSNVHESMDTILQDVQKTILQTNEIDRFAVFSREKTIR
FT                   PRPYHLSHLFLDHHMEQEAAVEWKQTQMASPALVDMPPAISYGGDIDVRAGAQTLQDAL
FT                   TEAAKTTNGLTYIINSENELTQSYSQLKEDAERVLTGLRALGLKPGDPVFFQFSSNHAM
FT                   VTAFWACVLGGFVPTLVSAAPTYREMNASVKKLHHAWSLLEHPLILTDDSLIDEVQGLA
FT                   LLWHTDQLRVAAVEPMLTLERDLEAHPVMPEDSVFFILTSGSTGMPKCVEHSHRSVLAN
FT                   VKGTVAANGFTQDDVSLDWMPLDHIGGIVMFHLVNVYTGCEQIRARTDDFIAQPLRWLD
FT                   WMDRYRATKTWAPNFAFAMINDYEKDFSSGSWDLSAMTCMINGAEAVVPKTIHRFLHLL
FT                   APHGLKGDVIRPAFGMSEISSAVVFSFAIERGNENSGVLTFEETSLTEQLRPAEARETG
FT                   TVSFTELGKPIPGITIRIVNHEHELLPEDHIGSVQIKGPTTMKGYYKNDEANQEVFQTE
FT                   GWFHTGDLGFLHEGRLTLTGREKDMIIINGKNYHNYEIEAMAEEVPGVETSFVAACSVR
FT                   MEASASDELILFFTPKLYEPAYIMRASQYMKTHIATKMGLYASRIIPVQKHAFPKTSSG
FT                   KIERAQLKTRWQEGEFDEIIKELDIRLENEHTLPNWSYQKKWTPVPLHKTEKQTAGDTV
FT                   IFADALGLADQLKYLSNNEQTYITVEPGQAFTQLTHTHFIIHPNRPSDYEQLFETLRSY
FT                   GVSVKQIIHLWNYTNKEDTLQAALAKEAQKMGSMSALYTTKAMAAYEEPVEITFVSAHA
FT                   MNLPEDQTHHVEKATTAGLMTAVQHEWPFIKVRCLDFSLTESADHSHASAIMTELTQDT
FT                   SYQVAAYREGVRYIPLLTPLHLEREQKRKTPPFESSGLYVLTGGLGGIGRMLSEHLLTS
FT                   YQAHLVLLGRKAREALTADQQDVLTSLEKQAETRGGTVHYEEVDLTDAKALEALISRQE
FT                   VAHEKRLHGVIHFAGIIQEELLADMTSVSLHAMYEAKVYGTIALHEAASKRQNVLFLSS
FT                   SSARTLKGGMTVGAYCAANEFVEQFARYQKLTSTVKPYCFSFSMWDETGMSEGSMIKGI
FT                   LKERGYLPIMKRAGLQTMLACLMTDAPLIYMGLDRSKQDIQEMLHAEDRTEKAVYVFFK
FT                   TDKTKAIEERLYQSIYTSLQSHLSGEYSVHLFPEEYWKESEDGMPDEAYFKALIEESGQ
FT                   DAEGRAPQTETEKRLASIWSELLDVSNVSCGDHFFLLGGHSLKATQMLSAVRQRMGFDV
FT                   PLAVLFEHTRLGELASWIDSHAKVDEAVQMRKIAKSQEIPMSYAQQRQWFLYQLQPDLP
FT                   IYNNTISFRMNGFLDVKVLQRSLQQMVQRHESIRTSFTMSGDEPVQIIHEHMTLPELEV
FT                   VDLSDLTSQEEKEQKAAEWAKREANTPFRLEHDPLFRAKLIRLSERDHLLLMSIHHIVS
FT                   DGWSVGIAARELSEWYTAMIDRREPDLLPLPIQYADYALWQKEYLTGETLEKQLSYWKE
FT                   QFAVPVEDLVLPYDYPRPAVQSYKGKTKKYDLSKSLSDQLAELSKKTDSTLYMTLLTAF
FT                   STLLHRLSSQDEFVIGSVIAGRNRTEMEHLIGFFVNTLALRIDHSGNPAFTELLERVKD
FT                   TTMGAYAHQDVPFEMVVDELDIVREAGKQPLFQVMFVLQNLPLEASPMGEATSVLAIED
FT                   NDTAKFDLSLFVFEGAEGLQLKLEYDVDLFSDDTMDRFLRYYEQLLECICEHPSQPIKQ
FT                   MNYLPEKEKHQLLYEWGGKTDQPAGSLLITERFEAQVRKSPEAIALEFGGVQWTYRVLQ
FT                   EKVDRLAASLQQRGVTPHEPVGLLIDRSPEMVLGVLAIVKAGGAYVPIDPEYPDARIDY
FT                   MLRDTGIQLLLTKNEWLKKVSISQTELICLDEGYEEFLSEAELIPAALKPDGLAYINYT
FT                   SGSTGQPKGVLIPHQAVIRLVCETDYVTLDEHTRILQMASFSFDAFTYEIWGALLNGGR
FT                   LILTHRHTVLSMDTLADTLTSYKITTGFLTVPLFNRLTEEHPEALSGFDALLVGGDALS
FT                   AAHIRKALPYLPEGLLNGYGPTENTTFSCVHHIRSLDEEQTTVPIGRPIAYSQAYVLDD
FT                   QLQPVPQGVIGEIYVGGTGLALGYLGDEEKTSQSFISHPFHKGARLYKTGDMGRWLPNG
FT                   IIDCLGRIDHQVKIRGHRVECGEIEATMLSVEDIIECAVIPHQHESGHKRLIGYFVQKG
FT                   TWTQQDLRRKLKDRLPDYMVPSLFIELEELPLTPNGKVDQKRLPPPVWRQEEAEKPTDQ
FT                   ALSKEERVLKKVWTQLLGTPSIGVHDNYFELGGDSIIVIQMVARLAQEGYIIQPRDVFE
FT                   KQTISQLAHAMKKADVSVSYDQSPVTGDARLLPIQSWFFEQSMTNQDYWNLSAHIKFKQ
FT                   SIQPEQLTQVLSKLVDHHDMLRAIYTKDVDGTWIQTIRAPGIIPCVTFFDLTDVSHEEA
FT                   LEQIRMETSACQGTLSLERGEVIKAILFQTSDCTSELFIAAHHLVMDGISWRIIQEDIL
FT                   NGLKQVAAGQEIMLAKKTASYQQWAEALDQYAQTDQLLEQVPFWEKIIDQEEEGSPFQT
FT                   PALFNIEEHAEILTVQLTKDQTDILLRHASQAYRTEVNDLLLSGLVQAIGRPLLITLEG
FT                   HGREDLFEQMDLSRTVGWFTSSYPIFIPFFQTDVERQIKDVKETLRAVPQKGIGYGLLQ
FT                   YMTASRLLKTVAPQVSFNYLGQLDQIDGEANLYIADERNGHVHDPKAERQHLIDVYGYV
FT                   ISGQLQMNFMINRELLQEEEVRQLPERFKEKMEDILTHCVEAKGGFTPSDFPMVQLTQK
FT                   QIDELPDNVVDVYPLSPMQQGMLFHALLDQASQAYFGQVHMTLEGLTDGEAYEKAWNLL
FT                   VERHSILRTRFAWEGLKEPVQLIQSEGSLHLTQHDVCHLNEMEQKKTIEQYLKTDRSKD
FT                   FELENAAEPLIRIALFHRDEKTCTFVFSFHHILIDGWSLFGLIEESFSIYRSLVDEREM
FT                   NLPAVRPYKDFIDWLQKQDQEKAQEFWKHYMSGVEEATPLPGDGEQASDEGAGIDQISI
FT                   KLTPEMQHKLEKMTGTQKVTMSTLIQAAWGLLLHLHSGSEDVVFGVTVSGRPADLKEVE
FT                   SMTGLFINTLPLRLPITPDRTIAELLTQTQETVFHMREFEYTVLPDIQQMTQISNGESL
FT                   FRSIVVFENYPIESVEPYGVRILDIASHEETNYDLTLVAVPGDTLELRVTYRFNQYKEK
FT                   QIQSLMQQLIHTLEAMTEQVETPLSSFTIVTNEEKGRMITDWAKNAQVSVLYPDQEEVY
FT                   SGVHDPSCETEIYVLSEEHQLMPVGFPGDIFIGAEDIKALCGELADWMETHKIQHPFKH
FT                   QTGEYLYPTGDVGVWTEKNKIQILDWV"
FT   gene            377425..385620
FT                   /locus_tag="BPUM_0323"
FT   CDS_pept        377425..385620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0323"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61020"
FT                   /db_xref="GOA:A8F9V3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214490.1"
FT                   /protein_id="ABV61020.1"
FT                   /translation="MLMSRRKGLAANHIVRINGKRIDLKALEQVMMLHFPLKECAFIPK
FT                   KNEEGSLSLVLFAQAKDPSLTREDLMTGVLHPDEVPAALVLLPSLPRTESGAVDTEALL
FT                   SIDIIDEESLRKIEDRTKAIDGVEEAAALIESQTEKQTLYHLDDLFPNRQRAQENVSIS
FT                   KDDAGETKQASVHEKPPALVYGGDVIKNQGTPVTLTEVLIRSAFMSPDRGVTYIKEGGR
FT                   TLTQTYPELLTNAERVLSGLRKAGLTNGDQVLLQLKDHQDFITAFWGCILGGIIPTPVS
FT                   VPPVYDETNQAVNKLKGVFQLQNEPFIITNEASAEDIAGLREAFEAKNMPVLTIETLLS
FT                   CEPDEQHYEPEPDEPVLQLLSSGSTGVPKCIRHNHQSILSRIISFEQTNGFTHEDVSLN
FT                   WMPLDHVGGIVMFHVHDVYFGCQQISPSIDQFIERPMVWLDWIETYGVTRTWAPNFAFA
FT                   MMNEYEDDIRKGSWDLSTLTYIMNAAEAVVPKVTQRFMHMMGQHGLSRHAMVPAYGMSE
FT                   TSSAIVQSKKFMRHGDQDGQLTIDQTSLTSEIQYVAQDHPHKMTFTEVGAPIPSVWIRI
FT                   VDEHHHVLPEDQVGRLQVKSPTIMMGYDQNEEANQEVFAENGWFHTGDLGFIHEGRLVL
FT                   TGREKDIIVINGANYLNYEIEAVVEEVDGVEVTFAASYGIYNPESSNDTLAIFFVTQKD
FT                   SLEEQVTMIQQIREAIIRKIGIEPDHIIPVKKDQFPKTESGKIQRAQLGAALKEGVFRD
FT                   IERALDLASENEQTLPDWFFKRTWAKEHIGPTHPAADHILVFEDEKGLYQSLYVQFEQR
FT                   NQPYVSVKKGHEFLRLSKGMYQMNPRIKGDYVRLVAALEADELKTGRILHLWNVTDKEA
FT                   IVEPAQFTEMHARSNQSILYLYQAWRQENKEPVRLVVVTKGGQFVNAEDDLHVEKTSLV
FT                   GLLKTIPKEWEGAEVSHIDIEAEQVEQDAKYMADELMAIHIKAEVAYRKGYRLVPKLEK
FT                   VDMMNVSQTEGFLEYEGLYLLTGGLGGIGFELSKQMLQFGLKLVLIGRTSLEDNIEKKE
FT                   AFSQLKDLGDVIYVQADVTDLADVERTIYKAEKHFGQSIRGVLHLAGAGNVSEHFQQAD
FT                   KYTLAHTSEEDFTNELSGKADGAFVLQEAFKHDPAVPLVFFGSVNGFFGGTTFGAYSAA
FT                   NSFLDGLAHTLTFKEGRRAISLNFSMWDNLGLSKGHTGAALTVRKGFQLIGKKQGLHSF
FT                   CLGARLNEAHLFIGLDGANPEIAAYVQPAQIPTFEKKLLYKAMPGKEVHVEEIANITKD
FT                   GWDIQQVQEMSKKQDGSIDHEALKLNHHKNGQSFEKQLPETETEQVLATIWEDILDVDR
FT                   VYKEDQFFDLGGHSLKATQTISRINHEFSIKAPLKILFESKHLAHLAQMVDDIKGAPVV
FT                   QEAKIPKLEKRTSYELSHAQKRIWFLSTLEKSHHYNILGAWKLTGQLHIQALTKAIGLL
FT                   TKRHEALRATFQSLGGKPVQLIREDLPPSVTVANFSLFNEKTRTRRLKQLIQQEANRMY
FT                   DLERGPLAQWTIVDMGNEECYLLCAQHHIISDAWSLSLLIQELEVAYDGLLVDEAPQLP
FT                   ALEIEWTDYVHWENEQVTHHQTDQSYWLKTLQGELPVLELPFDRPRPPVQTFNGATEQI
FT                   VLEDTLIRRLQALSKQQGTTLFMTMLSAYYVLLHKLSGQTDIIIGSPIAGRDAEQSEKL
FT                   VGMFVNTLALRQDISTAATFADVMENVKEMTLKAFEHQRYPFDKLVDDLSLDRDLSRSP
FT                   IFQVAMGYVTDSLNINLKGLTSEHVMVHHTVSKFDLTLHVFEQGEKLSIHVEYNTDLFD
FT                   QETIHRYMNYYLRLLDGMTAQPERTFSDYCLMDKAEQAAMIIGKNQTATPYPKRTIQEL
FT                   FEEQVQRDPHRIALSYLEESMTYQELDEKATKLAAYLQSKGVGPGSLVPMLFDRSFDMI
FT                   VSVLGIVKSGAAYVPMSPEYPDARIRLIVRDTQSDVIITQSHLIERLGDFTGTKIDMDK
FT                   PLLETDAGYQREQSIIGEDQLAYVNYTSGSTGTPKGVMLPHAGVVRLVRETNYMKLGPD
FT                   DKMLQLSNYAFDAFTFELWGMLLNGGQLILIPKYAALNMDELSRLIKAHEVTANCLPTA
FT                   LFNRLVEHDPTSVAGYRTLLVGGEAMSSEHARKALPHMKGVLINAYGPTENTTLATTHQ
FT                   VTHVPEGARSVPIGVPVSNSTVVILDDALNPVPAGVKGEIYIGGTGLAKGYLHDPGRTQ
FT                   ERFIDNPFPELEGERLYRSGDLGTWRSDGTIEYLGRKDNLVKIRGYRIECGEIETALLK
FT                   HPQVKECTVIAKTYGSSKRLAAYLVTDGENPTPGWKAFLQESLPGYMIPSYFIVMDEIP
FT                   VTTNGKVDQKALPDPAETISLSQRDDKPVTETQEQIVTAFKEVLGVKQVGIHDSFFDLG
FT                   GDSIMSIQAVAKLKEQGIRVDPKWIFMHPAPAQLAAHVDAMPEAAEHVERSPKDYVIEL
FT                   KKGDPAEPRIFFAPPAGGTVMGYIDVAKLMTHQGAVYAVQSPGLYEDEEPQFFHYTELV
FT                   SIFVEAIETFYRPGVDYLAGHSMGGHLAYGMNQRLCHAGKAPKGLIILDTVPVLRDEAD
FT                   QALHADMNEEEVKMLALVLGMGNLVGVQPEALQGLSFQEVKQRILKEAEKDEVVHQFMN
FT                   DQYLDKYLQMQTHNTIMSQAIELEKEPFNVPFYIVQSSDHAIDFQKKFSDWEAYTKGSC
FT                   SYYHIKGDHVTMMKRPQADELARILQTMIKG"
FT   gene            385627..386367
FT                   /locus_tag="BPUM_0324"
FT   CDS_pept        385627..386367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0324"
FT                   /product="thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61021"
FT                   /db_xref="GOA:A8F9V4"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008891.1"
FT                   /protein_id="ABV61021.1"
FT                   /translation="MNHLFKTFEKKSDLIQLICFPFAGGYSASYRPLFEQLKGTAEVTA
FT                   AEPPGHGTNLMPLETSIDRLAELYKEGLMGNLNRPFILFGHSMGGLVVYRLTQLLEREG
FT                   VYPVAVVISAIQPPQTKRQILTHLSNEAFVQHIAEMGGIPKELLENKPMMDYFTPSLRA
FT                   DYQALETFQHKDQSIIETPVYLFNGTQDEKCMQDANGWLPWAKTIERINFEGGHMYINT
FT                   HLESFAEQMRLVIDLAGKQQFIKH"
FT   gene            complement(386403..387317)
FT                   /locus_tag="BPUM_0325"
FT   CDS_pept        complement(386403..387317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0325"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61022"
FT                   /db_xref="GOA:A8F9V5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008892.1"
FT                   /protein_id="ABV61022.1"
FT                   /translation="MDISKQKAYAAAIGYATIIGFSFLFVKIALESANPIDLLAHRFTV
FT                   SFAAALLLFPFLRKKIRLSIQWRDLLYIVPFSLLYPVLFFAFQVWGLMYTSSSEAGIIQ
FT                   ATIPILTMVLAAWFLKERATWIQVLFTILSVCGVMLLFVMKGIDVKHSHMIGYVLILLS
FT                   ALSSSAYSVFARVITRRFHVIELTFVMTFFGFIFFNAAALIRHSVNGTTLQFFSPFTQP
FT                   SFVWSMLFLGILSSLLTAYLSNYALSQLEAAKVSIFNNLSAFITVAAGVLILHETIDWY
FT                   HLIGGVLVIGGVIGGNVVKKRNS"
FT   gene            387448..388785
FT                   /locus_tag="BPUM_0326"
FT   CDS_pept        387448..388785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0326"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61023"
FT                   /db_xref="GOA:A8F9V6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008893.1"
FT                   /protein_id="ABV61023.1"
FT                   /translation="MRKYDQLVLSLKEKMTSGEYHAGMKIPSIRHLAAQYALSKSTVIK
FT                   ALDTLEREHLLYSVERSGYYVVKTKQLSGKEDSTWIDFASSAPDPVVFPYVDFQHCINQ
FT                   AIDLYQNDLFIYGTTNGLPSLLPVISKRLMDYQVFANPEQIVMTSGIQLALSILSTIPF
FT                   PNGKQTILVEQPGYHLYLQYLEKNQLPVMGIQRTEKGIDLQELERIFREEEIRFFYTMP
FT                   RFQNPLGTSLSKQEKRAIAALAEKYDVYIVEDDYIADLEFDAKRDPIYSYDQAGKVIYL
FT                   KSFSKIIFPGLRTGAVVLPEELISPFSEHKRLIDIDSSMLSQAALEIYLKSGMFERHRE
FT                   RMQTTYRNRSKQLVTCLKSDQIAYQLGEEEPATHTHVRIDRSIPMNQLIQQLKKASVSI
FT                   QSIDRHYLSTYQKDPILHLNIWHVKEEQITRGVDLLKTAFQQIGRY"
FT   gene            complement(388782..389474)
FT                   /locus_tag="BPUM_0327"
FT   CDS_pept        complement(388782..389474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0327"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61024"
FT                   /db_xref="GOA:A8F9V7"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008894.1"
FT                   /protein_id="ABV61024.1"
FT                   /translation="MKIFAIQLQHLDDIHARKQIDQLKPFVSAEKRAAAERFRFLVDAR
FT                   RTLLGEVLVRQVIHDMYDLPFDQIVFETEGNGKPVVRHIPSFHFNLSHSGDWVVCAIDD
FT                   APVGIDIEEIKPIDLAIAKRFFSADEYKDLLSQSAERQEAYFFHLWSMKEAFIKLTGKG
FT                   LSYGLSSFTARLSEDGQATLTLPDHEAPCFVQTYSLDPAYQMAVCTRKPSAAERVEILS
FT                   CHDVLARL"
FT   gene            complement(389564..390154)
FT                   /locus_tag="BPUM_0328"
FT   CDS_pept        complement(389564..390154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61025"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008895.1"
FT                   /protein_id="ABV61025.1"
FT                   /translation="MQLFHYHYWTPFVEETEQAYRSLGFEVKARFTKDGSFHPPLTWDD
FT                   FREEQPTFRIVEMRKGQINITFGYSKKVLFDHIGFLVSDEEYGELLSQVKELNWPVQEG
FT                   ERRTFLSTPLRLRFELQRRTDVIETGNDTLQAMTIAVPDLSQTSKVGQLLSSLNQPIHW
FT                   QKGERLSLLHVIMTDCNGLDTKDPNGVHILKQT"
FT   gene            complement(390239..390883)
FT                   /locus_tag="BPUM_0329"
FT   CDS_pept        complement(390239..390883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61026"
FT                   /db_xref="GOA:A8F9V9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9V9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214121.1"
FT                   /protein_id="ABV61026.1"
FT                   /translation="MKREHLLRWFFYFVGLIVLAFGLSLTVKGKILGIGPWDAFHYGLF
FT                   QHFGLTIGQWSIIIGALIVTLTSVFTKSFPKIGALLNMVLIGMFIDFFNAVLPAPHGYL
FT                   PALYVFITGVVVSGYGVGIYVSANLGAGPRDSLMLLISAKTGLNVQWVRNGIELTVLLF
FT                   AWMLGGPIGVGTILTAIFTGLVLRFSLPQSTRLLELLITKTAEKPVQTLIR"
FT   gene            complement(390970..391068)
FT                   /locus_tag="BPUM_0330"
FT   CDS_pept        complement(390970..391068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61027"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W0"
FT                   /protein_id="ABV61027.1"
FT                   /translation="MIGSLCQKKQAKSLAACFDVLAFTIRKKSFLK"
FT   gene            391427..395473
FT                   /pseudo
FT                   /locus_tag="BPUM_0331"
FT                   /note="cell surface protein; disrupted"
FT   gene            395480..396040
FT                   /locus_tag="BPUM_0332"
FT   CDS_pept        395480..396040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61028"
FT                   /db_xref="GOA:A8F9W1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR041999"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214376.1"
FT                   /protein_id="ABV61028.1"
FT                   /translation="MVQKIISATLITAGICLVMIGYMTIVDGQRQVDQSFQSAQAAIQQ
FT                   KGDTDSPFVPKAGETIGLLHIPKLNAELPIVEGTDAEDLAKGVGHYHESYLPNEQGQIV
FT                   LSGHRDTVFRRTGELVKGDQLVIELSYGRFTYEIEKTKIVKKDDQSIITLQQEKEELIL
FT                   TTCYPFSFIGPAPNRYIIYGKRV"
FT   gene            396146..396430
FT                   /locus_tag="BPUM_0333"
FT   CDS_pept        396146..396430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0333"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61029"
FT                   /db_xref="GOA:A8F9W2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214268.1"
FT                   /protein_id="ABV61029.2"
FT                   /translation="MLNQDYVRYIDNVGRVVLPTDIRKRLKIHPRDFMEIYREEDQIVI
FT                   KPYWQDKPCIVTGEVTGSNKVLSGGVVISPEGARLLLQDLLALRLQKEI"
FT   gene            397035..397421
FT                   /locus_tag="BPUM_0334"
FT   CDS_pept        397035..397421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61030"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_010494924.1"
FT                   /protein_id="ABV61030.1"
FT                   /translation="MKRKSFVLSVIAFAGLIGSSVLPSNASATEYLGWDEDIGVVQQGF
FT                   ATLAASKPQSHKGYRELNDRMNRHRAVGITKWKGKKHYTTARYEKRWPLSGVITSSGRV
FT                   WGTGKTIAKSGWCQGGKAKTYWGN"
FT   gene            397576..398433
FT                   /locus_tag="BPUM_0335"
FT   CDS_pept        397576..398433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61031"
FT                   /db_xref="GOA:A8F9W4"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002139577.1"
FT                   /protein_id="ABV61031.2"
FT                   /translation="MYSNISVYVEISTKDPFNWNNFDDQKEYTIFKEASDGDTKVRGFF
FT                   SKDPIEEPPILEGRFFNSSDFYNHKKVAVVGKVIKDREYFLYKGEKYRIIGRMGLEKPT
FT                   PLDQQTLINIDALEESKEESKNYYVIDDYSSMKNMKNQLQKMLGKKTAINIKDKEEKGL
FT                   NRVMGTDKQNQFVFYILLCIVGLTSTFISVYWIHRKTMLITIQQLIGFQQRKILKSLIF
FT                   QYLAASQLFYLLGLFTGKLVFPFSDEQTNIIILSYIIATTFGLGTFLVAFKNKSYENII
FT                   KRLR"
FT   gene            398439..399725
FT                   /locus_tag="BPUM_0336"
FT   CDS_pept        398439..399725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61032"
FT                   /db_xref="GOA:A8F9W5"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_001226569.1"
FT                   /protein_id="ABV61032.1"
FT                   /translation="MLLLKECWESLVSKKTIAFLVILELIVLSFFMTILFLNYQKSETH
FT                   AKSFMRPFENQNVYQIDDELRDEKEDAFLSSPSNVDKLRVLYKKFDSAKKFQFINVTQQ
FT                   PVGILNFNGPQSLLAGFEENSIIEPYESETDHQMYETIKAVQMNKQAMKLLDIKLSEGE
FT                   LLPDKAFDYKENKDIPVLLGSSYQGLYNIGDKITVEYLFKKLDVHVIGFLEKNTYTTIG
FT                   QDSQVYLDRYMVLPMMHFDQIERKDKEFYDFQWKVLLHSINGFIVTPKDSLAITKEVNQ
FT                   LGKEANFTDFAILGANTTGIVVLSSMMEQNQQILILLTVTLSLFSLVTIYFVLRTKLKL
FT                   NMKKYAIYLISGLTMKHIFAFIFSEVLLLSLTSFGLTALGVSFILGALDPFYYIGGIVF
FT                   SLVFSLIITAPIYFRFRKMPIQMLLKGRE"
FT   gene            399726..400400
FT                   /locus_tag="BPUM_0337"
FT   CDS_pept        399726..400400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0337"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61033"
FT                   /db_xref="GOA:A8F9W6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008903.1"
FT                   /protein_id="ABV61033.1"
FT                   /translation="MDLITFKNMSKEFNSGKQTNRVLTDVNLTIKENELVMITGRSGSG
FT                   KTTLLNIIAGLDKPTSGSYFYRNHDLTNKNYKQLADFRQNKIGIILQNYPLVDEKNVFE
FT                   NVKIPLWNSDLSKEKQEQHIIEMLRYVGLENKAKAYPKELSGGEAQRVATARALINDPD
FT                   CILADEPTGSLDEESEQIIFDLLTDLHRVGKTIIIVTHNKDLAKQGERQINISNGVFHS
FT                   VR"
FT   gene            complement(400581..401324)
FT                   /locus_tag="BPUM_0338"
FT   CDS_pept        complement(400581..401324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0338"
FT                   /product="polar amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61034"
FT                   /db_xref="GOA:A8F9W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214030.1"
FT                   /protein_id="ABV61034.1"
FT                   /translation="MLTVKGLNKSFGENEILKSIDFTINKGQVVAILGPSGSGKTTMLR
FT                   CLNALEIPNAGSFTFDDFSIDFSKKNKQADLLKLRRKSGMVFQDYHLFPHRTVLENVME
FT                   GPVQVQRRPKEEVRKEAIQLLQKVGLEDKKDLYPFQLSGGQKQRVGIARALAIQPELML
FT                   FDEPTSALDPELVGEVLKVMKDLAKEGWTMAVVTHEIKFAQEVADEVIFIDGGVIVEQG
FT                   PPEEIFKRPKEERTKQFLNRILNPV"
FT   gene            complement(401337..402029)
FT                   /locus_tag="BPUM_0339"
FT   CDS_pept        complement(401337..402029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0339"
FT                   /product="cysteine ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61035"
FT                   /db_xref="GOA:A8F9W8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213873.1"
FT                   /protein_id="ABV61035.1"
FT                   /translation="MLQSNTLGVVIPWDLLQQSFWPMVMQGIYYTIPLAIIAFIIGIFI
FT                   ALVTALARMSKIKALRWIFSIYVSAVRGTPLFVQLFIIFYFFPTFNITLDPYPSAIIAF
FT                   SLNVGAYASEIIRASVLSVPKGQWEAGYSIGMTHRKTLVRVILPQAVRVSIPPLSNSFI
FT                   SLVKDTSLASQILVAEMFRKSQEIAAANLDQILFIYMEAALIYWVFCFILSLVQHQIEK
FT                   RLDRYVAR"
FT   gene            complement(402016..402831)
FT                   /locus_tag="BPUM_0340"
FT   CDS_pept        complement(402016..402831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0340"
FT                   /product="L-cystine-binding protein TcyA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61036"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9W9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213831.1"
FT                   /protein_id="ABV61036.1"
FT                   /translation="MKKMFFAIMLGACVALITACGSGASDNANKQSGSKESGDLWKSIQ
FT                   DKGVLTIGTEGTYAPFTFHDKKTDKLTGYDVEVITEVAKRLDLKPEFKETQWDSMFAGL
FT                   NSKRFDVVANQVGKTGRENQYEFSDKYTTSQAIVVTKSDNNDIKKLSDVKGKKAAQSLT
FT                   SNYNKLATDAGAKIEGVEGLAQSIQLIQQGRADLTFNDKLAVLNYLKTSGNKNLKVAFE
FT                   TGDPQETYFAFRKGSGEVVDKVNGALKEMKKDGTLAKISKKWFGEDVTK"
FT   gene            403200..403811
FT                   /locus_tag="BPUM_0341"
FT   CDS_pept        403200..403811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0341"
FT                   /product="dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61037"
FT                   /db_xref="GOA:A8F9X0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008906.1"
FT                   /protein_id="ABV61037.2"
FT                   /translation="MHISKQKPVMILIHEIYGINDHMKSVIYHFDKVGFEVYCPHLLGK
FT                   VKNFPYVSENEAYDYFMNKVDFDESVKIVLNVAKELKTKNALRDIFLIGFSVGATIAWR
FT                   CSQYDKLFTGVIGFYGSRIRDYVHLAPACKTLLFFPKIEASFNPLEIAEILKKKDNLCV
FT                   RIVEGKHGFADPYSTAFHAESKNSCFQEIDDFIKMCLLEE"
FT   gene            404165..405555
FT                   /pseudo
FT                   /locus_tag="BPUM_0342"
FT                   /note="amino acid permease; disrupted"
FT   gene            complement(405600..407093)
FT                   /locus_tag="BPUM_0343"
FT   CDS_pept        complement(405600..407093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0343"
FT                   /product="peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61038"
FT                   /db_xref="GOA:A8F9X1"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008907.1"
FT                   /protein_id="ABV61038.1"
FT                   /translation="MSTIDHDKIVKSVPQKGFFGHPKGLYTLFFTEFWERFSYYGMRAL
FT                   LIYYMYTEVTKGGLGFDQTTANSIMSVYGALVYMSGIIGGWLADRVFGSSSTVFYGGVF
FT                   IMLGHVILALPSGATALFISMGLIIIGTGLLKPNVSNIVGDLYSKTDPRRDSGFSIFYM
FT                   GINMGGFIAPLIVGTLGQKVNFHLGFSLAAVGMLVGLITFVITKKPNLGLAGTYVTNPL
FT                   SATERKNFKIFGTLITIVLAVFAVIGIQTGALTINLFTWFVSALGVLIPIVYFIVMYFS
FT                   KKTSPVEQSRVLAYIPLFLAAVMFWAIQEQGSNILATYADQRTNLNFLGMTLASSWFQS
FT                   LNPIFIVLLSPVFAWLWIRLGKKQPSTPIKFSLGLLFAGLSFIIMIIPAYMSGPNTLVS
FT                   PLWLVLSFFLVVIGELCLSPVGLSATTKLAPAAFSAQTMSLWFLSNAMAQAINAQVVKL
FT                   FDKVPETVYFGIIGLLAIVLCGVMLLLTPVIKKAMKGIH"
FT   gene            407357..409141
FT                   /locus_tag="BPUM_0344"
FT   CDS_pept        407357..409141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0344"
FT                   /product="uronase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61039"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008908.1"
FT                   /protein_id="ABV61039.2"
FT                   /translation="MGELNESDLKKPVVNVQDFGVVADGKTDCTAKLNECLEWTKAQGY
FT                   SHVWLPSGTYVIDAVYRGDRFFPFRGAGIRVPSHMTIEMAPDAVIKVIPNDSWGYAAFY
FT                   IGKVQHVTIRGGRIEGDRHEHVYKSLPPERKTHEWGFGICIEGASDVEVNRVQIKNCTG
FT                   DGIIVSPHGLLSQVETYSPASSIHISGCHVTDSRRNNISITGCDGVIVEDCLLERAGVN
FT                   GVEPRMGIDIEGYGENAVNMEEPLNIQIRNNIVRGGAASSIYNFNGYGVIIEGNHTDSS
FT                   ISYGFATETIIANNLIRAVGGGVTKAGITSLGVSLGQTENNVIIIGNMIEGFEKGIDVR
FT                   GDSVHITGNKISLFEDAALSVYMANRILIEGNHIESGTNTGLRSAALRIYQSDSVVFSN
FT                   NTIYSVIDGAMVRGTNILIQHNQFKEFSRGIWVQEGEAGINGNHFIQEGHQELGSSYTI
FT                   SVTGNAKAFIWHNRFKHYQNYAVYSNTTGPLEIKDNSFEESSLYVVMYIKNGSPQIGDN
FT                   RFYLNRSFGQPTAIFIDQAASARVLRNNIINLSPQKAIAVRTISSTHSVIAHNMLERSQ
FT                   LATHTTDRIIGNIEIDTP"
FT   gene            409342..410667
FT                   /locus_tag="BPUM_0345"
FT   CDS_pept        409342..410667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0345"
FT                   /product="nitrilotriacetate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61040"
FT                   /db_xref="GOA:A8F9X3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008909.1"
FT                   /protein_id="ABV61040.1"
FT                   /translation="MSQPKRKLKLGVFIAGTGHHVASWRHPNAVSDAAMNLDYFKQLAK
FT                   KAEEGKLDLLFLADSLSINQTSHPNVLTRFEPLTLLSSIAESTSSIGLAATASTTYSEP
FT                   FHIARQFASLDHLSGGRAAWNVVTSSIEETAKNFSGEEHLAHHKRYERAEEFVEVVKGL
FT                   WDSWEEDALVRNKETGEFFESSKLHELQHKGEFFSVRGPLNVSRTPQGQPVIIQAGSSE
FT                   DGQKLAAKTAELIFTAQNDLEKAKEFYQSLKEKVEDAGRAREDVSIMPGIFPIIADTEE
FT                   EAKAKYEELQELIVPEIGLSILQNYLGGIDLSQYPLDGPLPEIDPSTSNAVKSRFDLVM
FT                   NMARKDHLTIRQLYQSVAGSRGHNIFIGTPQQLADVMETWINEEAADGFNVMPPLLPEG
FT                   LDMFVDRVVPILQERGLFKTEYTGQTLRENLGLAQPKNRYTT"
FT   gene            410685..411188
FT                   /locus_tag="BPUM_0346"
FT   CDS_pept        410685..411188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0346"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61041"
FT                   /db_xref="GOA:A8F9X4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008347271.1"
FT                   /protein_id="ABV61041.1"
FT                   /translation="MGYTFRLATEADIEALLELTTRAYEPIRELGIQFQAAHADFALVQ
FT                   KNVQKNLCYVMEENGELLSTLSLRMPWGEQPGPFGVPHIWWFASEPSAKKGTGSILLDW
FT                   VETEVLRDTLKVPYVSLGTADKHPWLIDMYERKGYVRAGEKDLGKGHITIYLKKQLRSD
FT                   ITQP"
FT   gene            411211..412005
FT                   /locus_tag="BPUM_0347"
FT   CDS_pept        411211..412005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0347"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61042"
FT                   /db_xref="GOA:A8F9X5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007498164.1"
FT                   /protein_id="ABV61042.1"
FT                   /translation="MKNKKWLVILFAAMLAVLAACGGNNQSEGKDEKVLKVGATGQSYP
FT                   FAYKDNGKLVGFDVEVTEAIAKKLGYKLDWQLSEFSGLMGQLTSGKLDTVSNQVAVTDE
FT                   RKQTFNFTDTYAYAGTQIIVKKDNNDIKGLDDLKGKTVAAVLGSNHAKNLESKDPDKKI
FT                   NIKTYETQDGVLNEVANGRVDAYVNGRSVLLAQIEKTGLPLKIVGNPIVYEEVGYPFAK
FT                   DKKHDKLREEFNKAIKELREDGTLKKLSEKYFKDDVTVPIKK"
FT   gene            412030..412704
FT                   /locus_tag="BPUM_0348"
FT   CDS_pept        412030..412704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0348"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61043"
FT                   /db_xref="GOA:A8F9X6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214174.1"
FT                   /protein_id="ABV61043.1"
FT                   /translation="MNKIDWQYMVTVFPTLIQYLPITIFMAIVSMVFAIIIGVVFALIT
FT                   KNRIPVLYQFAKLYISFFRAVPTLVQLFLIYFGLPQLFPAMTSMDALTAVIIGLSIKNS
FT                   AYLAEIFRAALNSVDEGQLEACLSVGMTRWQSYVRIIFPQAIRNAIPATGNTFIGLLKE
FT                   TSLAFTIGVAEMFAQGKMIASANYKYFETYLAVGIVYWVMTIIYSFLQDLFERKISKPY
FT                   RN"
FT   gene            412717..413463
FT                   /locus_tag="BPUM_0349"
FT   CDS_pept        412717..413463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0349"
FT                   /product="amino acid ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61044"
FT                   /db_xref="GOA:A8F9X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214010.1"
FT                   /protein_id="ABV61044.1"
FT                   /translation="MIKLTNLKKSFGDLVVLDGINLDVQKGQVVAIIGPSGSGKSTLLR
FT                   CLNLLEIPDEGTIEIGDAKLDASKYTRKEAHHLRQQTAMVFQNYNLFKNKTALQNITES
FT                   LLVTKKMTKQQANEIGMKLLKQVGLEQKADSYPVTLSGGQQQRIGIARALAVDPHAILL
FT                   DEPTSALDPELVSGVLQVIKSIAIQETTMIIVTHEMAFAREVADHVIFMADGHIIEQGT
FT                   PTELFDETKNERTKRFIQKEAAAEEA"
FT   gene            413497..414654
FT                   /locus_tag="BPUM_0350"
FT   CDS_pept        413497..414654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0350"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61045"
FT                   /db_xref="GOA:A8F9X8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358527.1"
FT                   /protein_id="ABV61045.1"
FT                   /translation="MKSIGNEALNKRLINIRRALHEHPELAFEEYETTKKLRSWLEEEG
FT                   ITVLDFPALQTGVVCEIKGEQEGPTIVLRADIDALPIEEASGEPFSSKVPGKMHACGHD
FT                   FHTASIFGATLLLKERKHEIKGTVRILFQPAEEVAQGAKHVIEAGVLDGVDAIFGMHNK
FT                   PNLPVGTIGVREKALMASVDRFEIDIKGTGGHAGIPNHTVDPIAISGQITSALQQIVSR
FT                   RISSLHHAVVSITRIQGGTSWNVIPDRVEMEGTVRTFEPEVRAMIPELMKQIVRGIAEG
FT                   FGAKGEVKWHPYLPSVLNDDRLTKVVKETASALDLTVVQAEQSPGGEDFALYQEHIPGF
FT                   FVWMGTSGTEEWHHPAFTLNEGALPVAAAFFAELAVRALESRSWN"
FT   gene            414645..415979
FT                   /locus_tag="BPUM_0351"
FT   CDS_pept        414645..415979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61046"
FT                   /db_xref="GOA:A8F9X9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9X9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008914.1"
FT                   /protein_id="ABV61046.1"
FT                   /translation="MELTKQLAEAVLSADPLQDHRAVEMARHGLLDAAAAALAAKEDEG
FT                   IQKLMALVEQEGGEAQIPVIGQGKKVSRQSAAMLNGYLIHALDYDDVHSDVRGHPSAVI
FT                   IPALLSQLSDGKGFGDRFLAAYITGVEVMARLGESIGKAHYERGWHNTGTLGAIAAVCA
FT                   IGYLKKVSQEELMKAIGFAGAQSAGMRKQFGSDMKPLQAGLAARTAVWSMDLACSGFGG
FT                   SESILDGTLGFFSLYGDEERAESRLLDGYGTTWRIVSPGLWFKVYPFCSAAHHAADAIL
FT                   YLMKEHPFSPEQVKQVDVLFPPGGDAALIERTPSTGEEGRFSVEYVIALAAFGQTLALD
FT                   AFTKKPISSQIRTWMKRVKRGYDQTIEPHPYAVPKGRFTIVKITLSDGTTISKRVDIPR
FT                   GAPGHALSKEDIMQKLNSVTDASYAKQILQAVEDGNDSSYKQMLA"
FT   gene            complement(416299..417654)
FT                   /locus_tag="BPUM_0352"
FT   CDS_pept        complement(416299..417654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0352"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61047"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012011763.1"
FT                   /protein_id="ABV61047.1"
FT                   /translation="MLSKREEERRNQLEVVALDELVPEDHLVRKIEQAIDFDFIYDLVK
FT                   DHYSSDNGRPSVDPVVLIKMVLIQYLFGIRSMRQTIKEIETNVAYRWFIGYGFSEKIPH
FT                   FSTFGKNYVRRFHDTDLFEQIFYRILREAMKKGLVDPSIAFIDSTHVKANANKKKLEKK
FT                   IVRVETRSYQNQLHEEINIDREEHGKKPLPLQNKEETKEIKVSTTDPESGYYVKDEREK
FT                   SFAYSFHTACDSKGFILGSLVTGGNVHDSRMLDSLVSKVTEKVGKPNVVAVDAGYKTPY
FT                   IAKFLMDQEIRPVMPYTRPRTKAGYLKKNEYVYDAYFDCYICPNGQILSYRTTTREGYK
FT                   QYVSDSEVCESCSFLDNCTQSQNHTKQIHRHIWQDYLDEADNLRLTEINKSIYAKRKET
FT                   IERVFADAKEKHGMRWTKLRGLKKVSMQAMLTFAAMNLKKLANWTWKVPCPA"
FT   gene            417945..418628
FT                   /locus_tag="BPUM_0353"
FT   CDS_pept        417945..418628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0353"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61048"
FT                   /db_xref="GOA:A8F9Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008916.1"
FT                   /protein_id="ABV61048.1"
FT                   /translation="MKILMIEDNQSVCTMTEMFFQREGFQAEFVHDGQDGLNRFKQEDD
FT                   WDLLILDIMLPSMDGLTICQKVRQISDVPIIMLTAKETESDQVLGFDLGADDYVTKPFS
FT                   PLTLMARIKAVKRRFTQTTIQKEDERLATAHFLLDKKTREVFLDGEPIENLTPKEYDLL
FT                   CFFIQHPRQVFSREQLLEQIWGYQFYGDERTVDVHIKRLRQKIGDGPKPFLYTVWGVGY
FT                   KFDED"
FT   gene            418618..420045
FT                   /locus_tag="BPUM_0354"
FT   CDS_pept        418618..420045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0354"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61049"
FT                   /db_xref="GOA:A8F9Y2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008917.1"
FT                   /protein_id="ABV61049.1"
FT                   /translation="MKIKYFYQLLMSHLGLLLIAIIIISTLMSHFVKDIAYQNKVDEMK
FT                   SYGNEILQNFQQLPKAEMNFRLRPFEDILSTRQIRFFVFDEKGNVLTQQQEMPPHEALL
FT                   TKDLWTKLAKGEDIIVKRSDSRRLDQEASLVALPVIEDGKLKGGVVLIAPIQGAEELIA
FT                   QMNRYLYIIVFVALTITFILSLFLSKFHVNRIKKLREATEKIAHGDYNIHLENKHLDEI
FT                   GTLGEDFNMMANRLQRSREEIDRLEKRRRQFIADVSHELKTPLTTIRGLVEWLNTADVP
FT                   AEEKEKCYALITDETKRMLRLVNENMDYEKIRSNQITLQKFHYPLIDTFEVIKEQLNRM
FT                   AEEKNNQLIVEVNPDQKVYADYDRLIQILVNITKNAIQFTEGGRIVLRGKEEDGETIIE
FT                   VEDTGVGIAPEEVKHIWERFYKADISRTTTPYGEYGLGLSIVKQLVDLHEGQIDLKSEK
FT                   YKGTTFTIRLPLSQQKG"
FT   gene            complement(420074..420919)
FT                   /locus_tag="BPUM_0355"
FT   CDS_pept        complement(420074..420919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0355"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61050"
FT                   /db_xref="GOA:A8F9Y3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008918.1"
FT                   /protein_id="ABV61050.1"
FT                   /translation="MPRQQLLKQFRNFHDASTSILNMMSQFTNVNTLFIAKNDQTTNQI
FT                   VKVLNHDEQLLDEGEEIPYEKTFCKLAVDHQATLVIPDISSDDRSKSLEVTKRLQGGSF
FT                   IGVPIDFTDGTNYGTICGLDSRPQQFTDEHVHMFETMASLLSYVLELDRANRQIQQLSV
FT                   PIVPVVDGVAVLPLLGDIEETRAQHILETILQESYRLSLSHLVIDVSGTKRLNEQSIQY
FT                   LVSYAQTLRLLGISAVLTGIKQDLALSAIQSNISFKDITIRKDLPQALAHIGLTFTKTE
FT                   "
FT   gene            complement(421084..422460)
FT                   /locus_tag="BPUM_0356"
FT   CDS_pept        complement(421084..422460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0356"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="catalyzes the formation of 4-phospho-L-aspartate
FT                   from L-aspartate and ATP; lysine and threonine sensitive"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61051"
FT                   /db_xref="GOA:A8F9Y4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008919.1"
FT                   /protein_id="ABV61051.1"
FT                   /translation="MKVVKFGGSSLASGKQLQKVFDIVTADPARKAVVVSAPGKRHSTD
FT                   TKVTDLLISCGEQYLRLGEAHDLQEAVIERYASIADELGLSHDVIDTIRQDLDSLLQAD
FT                   TSHPERYLDAIKASGEDNNAKLIAAYFRYQGVEAHYVNPKEAGLFVSDEPGQAQVLPES
FT                   YDHLYKLRERSGIIIFPGFFGFSLSGDIVTFSRSGSDITGSILANGLKADVYENFTDVD
FT                   AVYAVNPTIVHEPKEITELTYREMRELSYAGFSVFHDEALIPAFRAGIPVQIKNTNNPS
FT                   AKGTKIVNQRDHTNGPVVGIASDSGFCSIYISKYLMNREVGFGRKVLQTLEEYGLTYEH
FT                   VPSGIDDMNIILRQDQLEEQHIEQELLDRLKLVLDADEVVLEPNLSLIMIVGEAMRHNV
FT                   GTTARAAKALSKAKVNIEMINQGSSEVSMMFGVKAAQEKEAVQALYEEFFSMSTVPVSL
FT                   "
FT   gene            complement(422633..424066)
FT                   /locus_tag="BPUM_0357"
FT   CDS_pept        complement(422633..424066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0357"
FT                   /product="multidrug MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61052"
FT                   /db_xref="GOA:A8F9Y5"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358520.1"
FT                   /protein_id="ABV61052.1"
FT                   /translation="MNQSTTSYNRSVIVGIFLVGAFVAILNQTLLIPAIPHIMEEFNID
FT                   VSKGQWLTTAFMLTNGILIPITAFLIEKFSSRSLVLTALSIFTAGTILASFATNFPVLL
FT                   AARIVQAAGAGILMPLMQTIFLTIFPKEKRGQAMGMVGLVISFAPALGPTLGGWIVDSF
FT                   SWKFLFYIVLPIGIIDLILAFFLMKNVTQQRETRIDVLSVILSSFGFGGLLYGFSSVGT
FT                   YGWTSATVLISLIVGAVSLFFFILRQSNLTRPMLEFGVFKFAIFSLTTFLGMLVFALLI
FT                   GTETILPLYTQNVRGLSALDTGLILLPGALFMGLLSPIIGRIFDKVGGKGLALGGFTIL
FT                   TVTTLPFMLLTLDSSIALITVAYTLRLIGVGMIMMPLTTAGINSLPPHLIPHGTAMNNT
FT                   MRQMGGSIGTAVLVSIMSSSAANAELASPLKSAVHGMNTSFFISGLIAVLGLVLSFFLK
FT                   EKRNSKVMKQELSSSSSSS"
FT   gene            complement(424083..424982)
FT                   /locus_tag="BPUM_0358"
FT   CDS_pept        complement(424083..424982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0358"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61053"
FT                   /db_xref="GOA:A8F9Y6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008921.1"
FT                   /protein_id="ABV61053.1"
FT                   /translation="MVLPIRKGLMKMNEKQEEILRVSKKLFSQKGYMSVSMQSIADACK
FT                   ISKASIYKLFDSKEALLLELIKYNQCKMREISQIIHSETTLSKKEKFTKKIKLELEEFK
FT                   ENHKFLNMLSFEAFSQHSPIVIKHLRETRTIIMQRHRDIILSTYGESVAPYVWDLVIVL
FT                   NGLMREFILMLAIERKNIQLENAAEMIIGVMDRVSKKPCSIEPVLTDELMDSYLLSTQD
FT                   EYDEEKLVISYLTKIKQELHTLSNGEEKDDLLSAFELLSEELSKDQPRTFLISSLLDYL
FT                   GKNSVLSQNVSQLKSIIL"
FT   gene            complement(425088..425462)
FT                   /locus_tag="BPUM_0359"
FT   CDS_pept        complement(425088..425462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61054"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008922.1"
FT                   /protein_id="ABV61054.1"
FT                   /translation="MTRTIWTCLFMLLLATSLCACQSVQQFESKRPSAEEVLALDEQAD
FT                   LFQWGKTVYEANVDWTHQLTVTKDQQLGVIQKTAAKHFHHGTATHLKKGTAIYSVKERN
FT                   DLLIAELNGQIIIYAAHAEG"
FT   gene            425575..425886
FT                   /locus_tag="BPUM_0360"
FT   CDS_pept        425575..425886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0360"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61055"
FT                   /db_xref="GOA:A8F9Y8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008923.1"
FT                   /protein_id="ABV61055.1"
FT                   /translation="MNNPTHPTQEDMRLISVLHALADPIRLEIVRCLAEAGERTCGTYE
FT                   MNIAKSTLSHHFKVLREAGIVKVRIDGKHRYYSLRKEDIETAFPGLMSSILAVDKERW"
FT   gene            complement(425917..427341)
FT                   /locus_tag="BPUM_0361"
FT   CDS_pept        complement(425917..427341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0361"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61056"
FT                   /db_xref="GOA:A8F9Y9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Y9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214112.1"
FT                   /protein_id="ABV61056.1"
FT                   /translation="MLTIQLDQTGANGFIYHQIYTKIKGEILNRNLQPHDQLPSKRELA
FT                   DTLNVSVNSVNGAYQQLLAEGYLYSVERKGFFVESLETFHESGQLKPSSLPADLKEEPI
FT                   ARDDWYSFSHISVDTANFPFKSWLKSEQKAISLHQEAFGELPHPQGVYELRETIARLIG
FT                   LARGVKCYPEQLILSAGTQSLIHSLSSILPADKVYGLENPGYRRLYQMLKSNHHQIETI
FT                   GIDPKGVRMSDIQKKEPNVLIITPSHQFPTGVIMPISRRIQLLNWAADQQDRYIIEDDY
FT                   DSEFKYGTDSIPALQSLDRYDKVIYMGTFSKSLLPGLRISYMVLPQHLLRRYKEEQHFF
FT                   IQTANLFTQYTLLHFIKDGAYQRHIKRMNGLYEEKRKQLIEELDTVFAENVRIIGENAG
FT                   LHFIAEFRSNRTQHEILQRAKERKLKMYGMDRFTLDEQLPGHQEGFVPLVLGFSHMRPE
FT                   DIEPAVKRLYEAIYGK"
FT   gene            427450..428766
FT                   /locus_tag="BPUM_0362"
FT   CDS_pept        427450..428766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0362"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61057"
FT                   /db_xref="GOA:A8F9Z0"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008925.1"
FT                   /protein_id="ABV61057.1"
FT                   /translation="MSQTTTNRFSTEEWQGKRDQYVARGVSNGNRHLAAKGKGAELFDI
FT                   DGKRFIDFAGAIGTLNVGHSHPKVVEAVKAQADSLIHPGFNVMMYESYIELAEKLCHLT
FT                   PGDHDKKAIFLNSGAEAVENAVKIARKYTKRQAVVSFTRGFHGRTNMTMSMTSKVKPYK
FT                   FGFGPFASEVYQAPYPYYYQKPEGLSDAAYDEYIIDQFNQFFVATVAPETVACVVMEPV
FT                   QGEGGFIVPSKRFVQHVASFCQQHGIVFVADEIQTGFARTGKYFAIEHFDVVPDLITVS
FT                   KSLAAGLPLSGVVGRKELLDAADPGELGGTYAGSPLGCVAALAVLDIIETEQLNQRSEH
FT                   IGQVIEDKANHWRTKYPFIGEVRRLGAMAAIEIVEDQTTRTPDKKTAAAIASYGNEHGL
FT                   LLLTAGINGNIIRFLTPLVITDELLQEGLGIIEDAFKAR"
FT   gene            428788..430176
FT                   /locus_tag="BPUM_0363"
FT   CDS_pept        428788..430176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0363"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61058"
FT                   /db_xref="GOA:A8F9Z1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357049.1"
FT                   /protein_id="ABV61058.1"
FT                   /translation="MQKQQMAKTMSQSDVLFLSIGAMLGWGWVVLSGDWILTAGFLGSV
FT                   IAFVIGGILVIFIGLTYAELSSAIPETGGGLVFVQRAFGIKSAFVSAWGVLFGYVSVIT
FT                   FEAVALPTVIDYVIPTQHVGFLWNIGGWDVYFTWVLIGSGGALFLTALNYIGAKPAAIF
FT                   QSVFTVAIILTGFLLLGGATFNGNLANLEPMFKGGVGGLMAVLVMIPFLFVGFDVIPQV
FT                   AAEINAPKKIIGRILIISIVSAVVFYLLIVFGVAAGLSKGQLEASSLATADAMVQLLGH
FT                   QAFGTVLVIGGVAGIVTSWNAFIIGASRILYAMAERGMISKWFAYIHPKYKTPTNAILF
FT                   LGALAFFAPLLGRPALVWIVNAGGVGIIVGYLIVSIAFMKLRKAEPELERPYRIKYWRT
FT                   TGVLAIGLSLLFLSFYFPGMPASLSWPAEWILLLGWALIGYILYVMNPRTKETVEHDKR
FT                   TQSV"
FT   gene            430151..431545
FT                   /gene="gabD"
FT                   /locus_tag="BPUM_0364"
FT   CDS_pept        430151..431545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BPUM_0364"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="catalyzes the formation of succinate from succinate
FT                   semialdehyde; NADP dependent"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61059"
FT                   /db_xref="GOA:A8F9Z2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358511.1"
FT                   /protein_id="ABV61059.1"
FT                   /translation="MTNELKVYNPATGEEIASVAQHTKEQIEDAISRSHQAFKAWAKTS
FT                   AHERANIIRKWFDLMIEHKERLAKIITKENGKPYQEALGEIVYAAGYIEWYAEEAKRIY
FT                   GRTIPSHTTNKRLFVTKQPVGPVAAITPWNFPAAMITRKAAPALAAGCTFIVKPAEDTP
FT                   LTAIELVKLGHEAGIPEDALQWVIGDGKEVGEIFTDSPLIRKITFTGSTPVGKHLIKNS
FT                   ASTVKHVSMELGGHAPLIVDKDANLELAVKQAMASKFRNAGQTCVCANRLIVHEDIHEA
FT                   FAQVFSKEVEKLKVGNGFEEGTSIGPIINKRGFDKIVSQIQDAVDKGAKILVGGDTHFD
FT                   DDKSYYFVQPTVLTHVDPSMNIMHEETFGPVAPITTFKTLDEAIELANDTPFGLAAYFF
FT                   TENYRNGLYISENLDYGIIGWNDGGPSAVQAPFGGMKESGIGREGGIEGIEPYLETKYV
FT                   SIGLDE"
FT   gene            complement(431779..432375)
FT                   /locus_tag="BPUM_0365"
FT   CDS_pept        complement(431779..432375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0365"
FT                   /product="NAD(P)H dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61060"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008928.1"
FT                   /protein_id="ABV61060.1"
FT                   /translation="MNHLIIFAHPQQSLNQTLLDLVVSTLLNNGHKVTVRDVYALGFSP
FT                   ELSIWEKAAIKQGDVPMAIQTEQKLIQQADVLTFIFPIWWTGLPAMLKGYVERVFSEGF
FT                   AYQINEHGAIENLLRHKKGVIINTHDAPRAFLDSNLIFSASHRMTADTEVFNYIGIEPV
FT                   ERLLFSSMEQAPADYIHEILKETKETVEQLFPPAV"
FT   gene            432391..432546
FT                   /locus_tag="BPUM_0366"
FT   CDS_pept        432391..432546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61061"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z4"
FT                   /protein_id="ABV61061.1"
FT                   /translation="MVMCLIMACALILFNPIMVIIGWENGLVFKVKRNKAIVSMKTIAY
FT                   ESIIFF"
FT   gene            complement(432533..433147)
FT                   /locus_tag="BPUM_0367"
FT   CDS_pept        complement(432533..433147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61062"
FT                   /db_xref="GOA:A8F9Z5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358509.1"
FT                   /protein_id="ABV61062.1"
FT                   /translation="MKKYVKALLPMLLASFLLAIPVSAHVTVKPDTSATNAWETYTLKV
FT                   PSESDSPTTKVVITMPKGVEFQQYEPVPGWKTSTEEKDGKVTRVTWEATGKGVLAGQFQ
FT                   QFVFVAKNPEKAGEAAWDAYQYYKDGTVVEWTGDKEADKPHSITNIVASNTVTDSHGQE
FT                   KPKEEKASETASNSSSPLVLGLSIAALVLALIALGLAFRKK"
FT   gene            complement(433164..434798)
FT                   /locus_tag="BPUM_0368"
FT   CDS_pept        complement(433164..434798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0368"
FT                   /product="copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61063"
FT                   /db_xref="GOA:A8F9Z6"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357055.1"
FT                   /protein_id="ABV61063.1"
FT                   /translation="MLKHSKWLLLLIITFAFFIPKEAFAHAYVVSSNPAANEELEKQPP
FT                   SVSITFSEGIESGFHAIKVLNAKGDRVDQGDTVIKDQKIMEAALKKDLPKGIYTIQWNA
FT                   VSADGHSVSGMIPFSIGKADGGFDQLDQGQPNESIDVASTIDKAFLYTSFSLFLGTILF
FT                   GLLWFRAAISPILAKRMRRLLTLSLIMMGGALVFQLPIQTKSAADVSFLGAFQPSLLQE
FT                   TIASTSGGSLWMMLMVSFVLLTIWSIVAMKKGDFTSFQVWLFPLLLFAVLLWLKAQIGH
FT                   PAATDNKILTTSLDFIHLVSASIWVGGLTAIVLLLLKKLPNGDQPLIRNTLKAFHPWAL
FT                   LSVGLIVFSGFVNAIFILQSFDALFESAYGRTFLIKLGLFILMGLLGLVHYLMLRWEKK
FT                   QKRNVSLRAEWMIGIAILLLTAVFTNIPSPPPPAPEPFFGANQVEHRDIVSMSITPNAP
FT                   GKNTFEVAFTKKDGQTITDIQSVSAKIHKVALFGEEKPSEFQLKRLKNGHYSAENLLLN
FT                   EKGTWKIEIHALTGSFENIDTTFIRRN"
FT   gene            435305..436747
FT                   /locus_tag="BPUM_0369"
FT   CDS_pept        435305..436747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0369"
FT                   /product="PTS mannitol transporter subunit IIBC"
FT                   /note="CmtA with CmtB possibly forms the mannitol-like
FT                   permease component of the cryptic mannitol
FT                   phosphotransferase system, which phosphorylates and
FT                   transports various carbohydrates and polyhydric alcohols in
FT                   Escherichia coli; cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61064"
FT                   /db_xref="GOA:A8F9Z7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213904.1"
FT                   /protein_id="ABV61064.1"
FT                   /translation="MQEKSGFRVKVQRFGSYLSGMIMPNIGAFIAWGLITALFIPSGYL
FT                   PNEQLATLVGPMINYLLPLLIGYTGGKLVYDHRGGVLGATATIGVIVGSDIPMFLGAMI
FT                   MGPLGGYLIKKIDQLFKDRIKSGFEMLVNNFTAGILGAILVAIAFYAIGPVVLGLNKAL
FT                   AAGVDIIVNAHLLPLASIFIEPAKVLFLNNAINQGILGPLGVEQAAKTGQSVLFLLETN
FT                   PGPGLGVLLAYMFFGRGNAKQSAPGAIVIQFLGGIHEIYFPYILMKPKLILAVIAGGAS
FT                   GVLTFTLLNAGLKAVPSPGSIIALMLMSPKGGHLAVLAGVVVATVVSFLVASVILKASK
FT                   AVDEDLTAATEKMQDMKGKKSAAAAALTAQKEGAEANEQAASPSDVIPDDVNKIIFACD
FT                   AGMGSSAMGASILKNKVKKAELDIDVTNTSISNIPNDADVVFTHKDLTDRAKAKLPGAV
FT                   HISVDNFLNSPKYDELIEKLKK"
FT   gene            436844..437278
FT                   /locus_tag="BPUM_0370"
FT   CDS_pept        436844..437278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0370"
FT                   /product="PTS mannitol transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61065"
FT                   /db_xref="GOA:A8F9Z8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A8F9Z8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008357059.1"
FT                   /protein_id="ABV61065.1"
FT                   /translation="MKQVLSKDNIFLNEQAGSKEEAIKKAGEVLVANGYVTSDYVDKMF
FT                   ERENISSTFMGNGIAIPHGTEDAKAAVLHSGISIIQIPDGVEYGEGNIAKVVFGIAGKN
FT                   NEHLDILSQIAIVCSEEENVERIIHAKDQDELIAIFNEVN"
FT   gene            437280..438401
FT                   /locus_tag="BPUM_0371"
FT   CDS_pept        437280..438401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0371"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61066"
FT                   /db_xref="GOA:A8F9Z9"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8F9Z9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8F9Z9.1"
FT                   /protein_id="ABV61066.1"
FT                   /translation="MKALHFGAGNIGRGFIGSLLKTSGFELVFTDVNEAVINELNARGE
FT                   YTVELAAPGQKQEIVGPVTAINSAQDPAALTEAVASADLITTAVGPAVLKIIASSIAEG
FT                   LKQKNPDHIINIVACENMIGGSSHLKEAVFSHLTEEEQKALSQTVGFPNAAVDRIVPIQ
FT                   HHEDILKVSVEPFFEWVIDETGFIGDVPQIDGATFVQDLTPYIERKLFTVNTGHALAAY
FT                   VGYQQGVQTIKEAVDTPEIRQVVEGALHETGSYLIDTYGFKKEEHDAYIQKIIKRFENV
FT                   FISDEVTRVARSPLRKLGADDRLIGPAKKMKQPVYLIKGIAAALAYDFAEDEEAVRLQK
FT                   LRKEKGIEGVLEEVCGLTPTDDLYQAILKETTR"
FT   gene            438501..440249
FT                   /locus_tag="BPUM_0372"
FT   CDS_pept        438501..440249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0372"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61067"
FT                   /db_xref="GOA:A8FA00"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA00"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214436.1"
FT                   /protein_id="ABV61067.1"
FT                   /translation="MKRKMFASRSVFFQLMSAIIVITILTGGLVGTTGYLLAKHVLIDA
FT                   GKADLKHIVSGAMATLEQLNDRVEKKELTLEQAQEQARIYLSGPKNDNGKGYQFQKSDF
FT                   IYKNKGYLVAYGADYSSQVHPVNDIGVIPDNTTNREKMVAGAKSEGEDAHYVTYLDKDD
FT                   ATGEEKQKLAYMSQFAPWNWSIGIAVFQDEFYKELEQMKLYMMLITAGVALLSLGVFYL
FT                   AARGKVRLLKQVTAASKEIAAGNLERTSLKETTDEIGQLAKGFNHMSGELRTLVSGLQE
FT                   TSSQLVESATDLSAISEETSASSEEIGRAIGDISTGTLHQASDLDVANQQMTQFNQSIE
FT                   NVKEQSDQIKRISDQSSQSSQQGQQIVQQLKQSNEQSIQASQGIRVGIEQLSTKVQDIS
FT                   KITDTIESISNETNLLALNASIEAARAGEHGKGFSVVASEVRNLAEQTKQSAVQIQQMV
FT                   QGIKEETTATAGMMSNTMDRFAELDKAVHATEHEFNAISTSISQTIVETDAMAKELNAL
FT                   LEQNDLITKAMQGAAHISQESAAAIEEITASTDEQVTAISNVAKAAERLNELSIRLNHD
FT                   IARYRL"
FT   gene            440476..440868
FT                   /locus_tag="BPUM_0373"
FT   CDS_pept        440476..440868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0373"
FT                   /product="enamine deaminase RidA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61068"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA01"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008347206.1"
FT                   /protein_id="ABV61068.1"
FT                   /translation="MEKITRKNPESMPKPVGNYSHITRVPKGAGLFVTSGQVGTDIDGQ
FT                   VPSSLNDQVTNTFENIKKILESEGSNEEHVIKVNIWATEEIDWDHLYPQWDTIFKTAYP
FT                   SMTVAYVSALGWPELKIEIELWCADI"
FT   gene            complement(440900..441139)
FT                   /locus_tag="BPUM_0374"
FT   CDS_pept        complement(440900..441139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61069"
FT                   /db_xref="GOA:A8FA02"
FT                   /db_xref="InterPro:IPR020258"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA02"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214096.1"
FT                   /protein_id="ABV61069.1"
FT                   /translation="MAVFILFVVFGFPILSVLIGIFGTMLLKNVWMPTLIVLLASVILM
FT                   YTSIGGNESFLIWVIIYTVFTLIAAWMTKRFRFK"
FT   gene            complement(441165..441458)
FT                   /locus_tag="BPUM_0375"
FT   CDS_pept        complement(441165..441458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61070"
FT                   /db_xref="GOA:A8FA03"
FT                   /db_xref="InterPro:IPR035167"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA03"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008938.1"
FT                   /protein_id="ABV61070.1"
FT                   /translation="MRNKHAFIAGVCSMIVICSAAMILQHHEWIGWISGGISMIGIMIS
FT                   GLLMGAWTSGDETRAAYHSETKEHRMWRLDTAFLMMIFALPHMAVSIFYFFM"
FT   gene            complement(441483..441860)
FT                   /locus_tag="BPUM_0376"
FT   CDS_pept        complement(441483..441860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0376"
FT                   /product="glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61071"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA04"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008939.1"
FT                   /protein_id="ABV61071.1"
FT                   /translation="MKMKYTILYVNDVEASIHFYQHVLGFPMKLRVESYVEFDTGDVTL
FT                   SINSRQDVKDALGLPVPEANQGSQTFEIGFVVDDVEQTIASMKEKGVSIIKEPAKKPWG
FT                   QTVAYVADPDGHFIEICDAVS"
FT   gene            442048..442314
FT                   /locus_tag="BPUM_0377"
FT   CDS_pept        442048..442314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0377"
FT                   /product="calcium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61072"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA05"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214076.1"
FT                   /protein_id="ABV61072.2"
FT                   /translation="MKKIMVAVLSLGLLLSVTQVDTHTADAKTVKSYKNCKALNKVYKG
FT                   GVAKSKNTKNKGGKTKYKPYASKALYLKNKHLDRDKDGIACER"
FT   gene            442442..443197
FT                   /locus_tag="BPUM_0378"
FT   CDS_pept        442442..443197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61073"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA06"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214460.1"
FT                   /protein_id="ABV61073.1"
FT                   /translation="MSIQADKKDIRLIAIDMDGTLLNSEHVIPEENKQAIKDAEAKGVH
FT                   VVISTGRTLMTCRELVEPLKLSSYLVTANGSEIWDSNFQLIERDLLHPDHVQMMWDLKN
FT                   RYETDYWASTVDKVWRGEFPERIHDHEWLKFGFDIHDDDVREEVLNTLKTNEHLEITNS
FT                   SPTNIEVNAAGINKAAALAKVAERIGCTMDNVMSLGDSLNDMAMIQEAGLGIAMGNAQE
FT                   VVKEAADWITAPNTEHGVAKAIQHWVLSK"
FT   gene            443368..444126
FT                   /locus_tag="BPUM_0379"
FT   CDS_pept        443368..444126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0379"
FT                   /product="lactam utilization protein LamB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61074"
FT                   /db_xref="GOA:A8FA07"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FA07"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358496.1"
FT                   /protein_id="ABV61074.1"
FT                   /translation="MYQVDINCDLGESFGQYTIGSDEQILEYVTSANIACGFHAGDPTV
FT                   MRKTVRMALEKGVQIGAHPGLQDLVGFGRRPIAISAEEAYDLVVYQIGALSAFLKAEGS
FT                   TMQHVKPHGALYNMAAKNTELSESIAKAVYHVDPSLVLYGLSGSELALAGERMGLQVAH
FT                   EVFSDRTYQTDGTLTSRREPNALIEDDELAVQQVVRMVREGKVHTVQGEDISLKADTVC
FT                   IHGDGIHALQFAKTITSKLKEASIRLKAFQ"
FT   gene            444153..445370
FT                   /locus_tag="BPUM_0380"
FT   CDS_pept        444153..445370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61075"
FT                   /db_xref="GOA:A8FA08"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA08"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213863.1"
FT                   /protein_id="ABV61075.1"
FT                   /translation="MKKQEVKYTKASKGNRSMLMGAAFLMATSAIGPGFLTQTTVFTQQ
FT                   LTASFGFVILISILLDIFAQTNVWRIIAVSEKRGQDIANMVLPGLGYVLAVLIVMGGLA
FT                   FNIGNIAGAGLGFQVITGIDPRIGAAISAVIAILIFVIKEAGKAMDRFTQIAGFVMIGL
FT                   MLYVAISTAPPVGEAALRTFVPKEIDILSIVTLVGGTVGGYIVFAGGHRLLDAGIKGKD
FT                   ALPQVTKSSVFGILITSVMRVALFLAVLGVVSKGLQIDPANPPASVFQLASGNVGYKMF
FT                   GIIMWAAAITSVIGAAYTSVSFFKTFSPKIEQNQRGIIIGFIALSTICFVTIGRPVNIL
FT                   VLVGAINALILPLALGTLLVAAYKKDIVGDYRHPFFLTVSGAFVVVIMALMGGYTIINE
FT                   IPKLWS"
FT   gene            445376..446167
FT                   /locus_tag="BPUM_0381"
FT   CDS_pept        445376..446167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61076"
FT                   /db_xref="GOA:A8FA09"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FA09"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8FA09.1"
FT                   /protein_id="ABV61076.1"
FT                   /translation="MNIYQTYEPSQIRELIRKKEITGPTAGLAEGYAQANLMIVKKELA
FT                   FDFLLFCQRNPAACPLLDVLEPGDPVPRKSAPKADIRTDFPKYRIYRKGILQEEVSDIS
FT                   AYWEDDMVAFLIGCSFTFEHALMLNDIPVRHIENGHNVPMYQTNIACKRAGVFHGPMVV
FT                   SMRPIPAHQITRSVQVTSRFPSVHGGPIHIGDPAMIGIANVDQPDFGETSVIKEGEVPV
FT                   FWACGVTPQAVVMHTKPEIAITHAPGHMFITDQRDQQLGVL"
FT   gene            446186..446932
FT                   /locus_tag="BPUM_0382"
FT   CDS_pept        446186..446932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0382"
FT                   /product="kinase inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61077"
FT                   /db_xref="GOA:A8FA10"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA10"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214037.1"
FT                   /protein_id="ABV61077.1"
FT                   /translation="MAFSTIKDSFTFHPLGDAAIVIQAGTDICEEIHERVVQLFSCIEQ
FT                   HPFDGYVEAVQAFTNVTVFYEPYTVYQSASLQQQDLSPYEWVKSYIETLLEKKWQEGIQ
FT                   GKRRTIDIPVCYGGELGPDLEEVARINCLTPEEVVRIHTSGTYLVYMIGFAPGFPFLGG
FT                   LSEKIAAPRRETPRMSIPKGSVGIAGKQTGVYPISTPGGWQLIGQTPLPLFRPDEKIPS
FT                   LLRAGDEVRFVQMSEEEFFSMKEAER"
FT   gene            446929..447942
FT                   /locus_tag="BPUM_0383"
FT   CDS_pept        446929..447942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0383"
FT                   /product="KipI antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61078"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA11"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008946.1"
FT                   /protein_id="ABV61078.1"
FT                   /translation="MSIHVIKPGMFTTIQDKGRKGYQKYGVLTSGGMDPLSLRIANILT
FT                   GNEESEAVLEITLMGPGPVLTCQKDALISVTGADVEIDIDGEPASLWKPLFVRSGSTLT
FT                   FGPCKRGCRSYLAVAGGFDVETVMESKSTYVRAGIGGLNGRPLEKGDVLSIGKPSLVAN
FT                   RLSNRLKSHLKQAAYSAPDWTVSHTHFLPLRKSPVIRVLPGRHLSFFQESSQSTFFEQP
FT                   FQVTPQSDRMGCRLKGEPVQLKEKLELISEAVAFGSIQIPPDGQPIILLADRQTTGGYP
FT                   RIGEVATVDLPLIAQAMPGANLYFKRIDHQDAEQALFKQEAELKELAARIKLEAYV"
FT   gene            447958..448719
FT                   /locus_tag="BPUM_0384"
FT   CDS_pept        447958..448719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0384"
FT                   /product="IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61079"
FT                   /db_xref="GOA:A8FA12"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA12"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008947.1"
FT                   /protein_id="ABV61079.1"
FT                   /translation="MQNTNKTVVKSMEILRLFIAHDQLTLNEMIELSGMPKTSVHRMAS
FT                   SLTDMGLLEKHDSGVYRLGLMFLEYGQLVADRLDIRRIARPFMEGLRDEVGEAVQLIVR
FT                   EGDEAIYVDKIEGTQPVRLYTAVGRRSPLYAGACARSILSFLPETERLAYIDSIELGKI
FT                   GIGTITDKAVLRNILEESNERGYTLSYSELENYTAAVGAPIFNHLGEVTAGISIAGFEA
FT                   GYQKERLPYLIEQVKKAASGISRELGFHLNK"
FT   gene            complement(448765..449400)
FT                   /locus_tag="BPUM_0385"
FT   CDS_pept        complement(448765..449400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0385"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61080"
FT                   /db_xref="GOA:A8FA13"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FA13"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007498092.1"
FT                   /protein_id="ABV61080.1"
FT                   /translation="MAKVLYITAHPHDETVSYSMATAKAFIESYKEANPSDEVVHIDLY
FT                   KENIPHIDADVFAGWGKLQSGAGFDTLSAEEQAKVARLNELSDQFVSADKYVFVSPLWN
FT                   FSFPPVLKAYIDSVAVAGKTFKYTEQGPVGLLTDKKALHIQARGGYYTEGPAAELEAGH
FT                   RYLGTIASFFGIPSFEGLIVEGHNAEPAKAEQIKADAIERAKALGKTF"
FT   gene            449804..450436
FT                   /locus_tag="BPUM_0386"
FT   CDS_pept        449804..450436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0386"
FT                   /product="spore gernimation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61081"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA14"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008948.1"
FT                   /protein_id="ABV61081.1"
FT                   /translation="MGRSYVAIGDSLTVGVGARLFGGGFAERYQWMLEKKTHAPVELSV
FT                   FAKSGLTTDQILQLFKRSNVRRAIAAANIITITGCGNDLVQAIQQYEKGEDETKLLQAT
FT                   LHCQANFSKMIQEIAQIKRGQKQSYCVYLMNLYNPFPQIPIAGRWLQQYNHQLRSLAAN
FT                   PHVEVVDVYRAFEGHEHEYLSIDQFHPNHKGYEAMAKILFQQSCKQL"
FT   gene            450526..451605
FT                   /locus_tag="BPUM_0387"
FT   CDS_pept        450526..451605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0387"
FT                   /product="choloylglycine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61082"
FT                   /db_xref="GOA:A8FA15"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA15"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008949.1"
FT                   /protein_id="ABV61082.1"
FT                   /translation="MEEISAYFHEMTGTAYEVGKQQAVWMKTQGLQTQYIRTEPLEKEA
FT                   LKETKQMIRPYLPQLEEEIAGFCDEMQLEERYLTFFYSSHLQPGCSHCVRQGNMAAGQQ
FT                   TVMLRNYDFSPIFDDMRLVTTHVKGLPYHTGSSLLLFGRSDGMNEHGLSVTFSACGPPI
FT                   GNEPGLKPPSVAGLQVYHVIRSVLESCQTVEEAIFSIQEMPVASNVHLMFADRKGEAAV
FT                   IEIIDGRKMVRRPETGFIAATNHPLADQTAKGMTKQHSVVRYDMLMEALVQRQSSDSLA
FT                   KLFQTEYPDGLAVHNYEELFGTMRTVIFRPEEGTMDYCFGSPVYNPTYSLKAGGLLPFH
FT                   EQKVQFHQKDYGPSFWRNV"
FT   gene            451736..453823
FT                   /locus_tag="BPUM_0388"
FT   CDS_pept        451736..453823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0388"
FT                   /product="PTS sugar transporter subunit IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61083"
FT                   /db_xref="GOA:A8FA16"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA16"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214441.1"
FT                   /protein_id="ABV61083.1"
FT                   /translation="MYITAREQKIIKYIIQQNRYVTIREIAESVQVSTRTIHRELKSIK
FT                   PILKNYDLSLDKQPGKGLKAVGEQEDKQRLLAHMSNEDQIEYSSDERKLLILCALLEAK
FT                   EPVKLYTLAADLQVTNATISYDLDELTEWIAPYGLQLIRKRGYGIELKGPEEAKRKIVG
FT                   NLIVDRLDIQLFLETIEMNIKHRTKATEKVFGVVSRGQLLKVERLLFHLKNRLSLSLSD
FT                   SAYIALVVHLTYAIERIQLGETIRMEEEELLELKRTKEFESSLRIARALERMFNVVIPE
FT                   AEVGYMTIHLRSANRSFGAEYRIDEIELDIAIRTKKLIDFISNKTGYHLNENDSLYEGL
FT                   VSHLEPAMNRLKEKMRIYNPLTQQIKKDYFLLFMAIEEGVERFFPEIAFPEDEIAFIVL
FT                   HFGSVLEIKKEETNIHALVVCSSGIGSSKMLASRLKKELPEIAEFDLSSLIELKEIDAS
FT                   SYDMIVSTVPIPYEHIDYIMVSPLLNEDDAMRVKAHIKRKIPYIIEKKRMKEADKESVQ
FT                   ESVNMMVVAEQVTNYMSVIRSILSHFTIEKRKAMPQHEATIKQLLRQLEEEGFITHADE
FT                   VASGLLEREQQGGLGIPGTEFALFHLKHAFIKEPIFHMYDLDQAYEVKSMDGGQQQMSR
FT                   MLMMLAPQELGKEGSEMFSLISSSIIESEESMTLYGHGSKEDIEQKLHQLFYQFVKEAK
FT                   W"
FT   gene            complement(453841..454452)
FT                   /locus_tag="BPUM_0389"
FT   CDS_pept        complement(453841..454452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0389"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61084"
FT                   /db_xref="GOA:A8FA17"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA17"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358489.1"
FT                   /protein_id="ABV61084.2"
FT                   /translation="MLSTISKTFSRPKGWLGSIAGFIMANENKALNQWAIQHLDLSDGE
FT                   NILEIGYGPGYSIKHMLKHYDDLHIDGLDASSTMQEQAQSRVNKRSKDKQVRLYVGKIE
FT                   KTRLPGEQYDKVLSVNNFTIWDDPKTGLLNLYHTLKPGGKLVIVMQPREKGADASRTKE
FT                   MGENILNDLQFAGFDHFSVEYEEIRPTLAVCVTAKKPRSE"
FT   gene            454608..455477
FT                   /locus_tag="BPUM_0390"
FT   CDS_pept        454608..455477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0390"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61085"
FT                   /db_xref="GOA:A8FA18"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA18"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358488.1"
FT                   /protein_id="ABV61085.1"
FT                   /translation="MDLREYLTNGIPRQTQDQQPGSEREMNPAPIFEDESYQGSGKLKG
FT                   KVALITGGDSGIGRAVSVAYAKEGAHVAIVYLNEHNDAKDTQKRVEQEGVKCLTIAGDV
FT                   GDEAFCEKAVEKTVEAFGQLDILVNNAAEQHPKERIQDISSEQLHQTFRTNFYSYFYFT
FT                   KKALDYLKPGSSIINTTSINPYRGNKVLIDYTATKGAINGFTRSMAQSLVKDGIRVNGV
FT                   APGPIWTPLIPSTFDEDSVESFGAETPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHV
FT                   NGGSFMNT"
FT   gene            455766..456188
FT                   /locus_tag="BPUM_0391"
FT   CDS_pept        455766..456188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0391"
FT                   /product="general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61086"
FT                   /db_xref="GOA:A8FA19"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA19"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008347166.1"
FT                   /protein_id="ABV61086.1"
FT                   /translation="MSQEELKQKVLSLLDEQKVGTLATVEQDKPHTRYMTFFHEGLTLY
FT                   TPTSKETHKADEIEKNPNVHILIGYSGEGFGDTYAEIAGTATLTDDPELIDRLWSEEME
FT                   KWFKGKDDPNLVILKIDPTSIRYMNEGSRTPAELSL"
FT   gene            complement(456214..456363)
FT                   /locus_tag="BPUM_0392"
FT   CDS_pept        complement(456214..456363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61087"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA20"
FT                   /protein_id="ABV61087.1"
FT                   /translation="MQKEKNKFVRFDSVSFLSSRSSIASHYVIEKRKFTFFIYLLISTL
FT                   NIKL"
FT   gene            456588..456854
FT                   /locus_tag="BPUM_03880"
FT   CDS_pept        456588..456854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_03880"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35533"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2X5Y9"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ALS35533.1"
FT                   /translation="MIIYLHDKSKEEAAIYLAAFFIGLNNKTPKPTSPRKGKMKLETKR
FT                   IASASKGFDIKNRPMIAQVITVNKASFMINHFGLSSDTAKSSE"
FT   gene            complement(456808..456990)
FT                   /locus_tag="BPUM_0393"
FT   CDS_pept        complement(456808..456990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61088"
FT                   /db_xref="GOA:A8FA21"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA21"
FT                   /protein_id="ABV61088.1"
FT                   /translation="MKESISYFAISFVLQWVWFGIVHPNKGVTLLDMFIFSILFAVMFF
FT                   FIRRIWQYQKKGRSD"
FT   gene            complement(457004..457222)
FT                   /locus_tag="BPUM_0394"
FT   CDS_pept        complement(457004..457222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61089"
FT                   /db_xref="GOA:A8FA22"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA22"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008955.1"
FT                   /protein_id="ABV61089.1"
FT                   /translation="MDKLSSIILAAWLRVPRWFKQWVLVSISIFFFYMCFVKALTSWHT
FT                   LPPVTLLSCVIGSFFIWLLWQKGQKNK"
FT   gene            457365..459635
FT                   /locus_tag="BPUM_0395"
FT   CDS_pept        457365..459635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61090"
FT                   /db_xref="GOA:A8FA23"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA23"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008956.1"
FT                   /protein_id="ABV61090.1"
FT                   /translation="MKGSDQVKRIPVIFLRYIVFFIPAIILSFLVWNHYQDDLSAGKAT
FT                   QYDIRRIFTFDEGKRVVSAVSKDQQLRFVMYDPQSGKIISEWTTESDTFNEMLPSIQGN
FT                   NLLLALKNKEGQLLIEKLTPSGEKKELIKQNLQIPSFLKTNTYQWNGRLVFTGEMEGAA
FT                   IVLGELKNGQFFHVHNLNKLNLPARPVSIDAVMNSFRGQTPIPIFELTLKNDQKAYVSG
FT                   VSNDKHQLGVYVSKNAEPFSLIQDKVEKQLAKTIGTSQNFAVAVESNYPKRPRKVNAEG
FT                   GLGEVVPTPKPIYQTFIYQLNEEEVLLVGSTAKDEAKGKLTGYIYNHRTNKTTSVSKLF
FT                   QSFSYENLNREGLFFHKNVKSDWIYYSFENQLTGAFETKSKQLKEFPLQKVISIENASP
FT                   AHQTSFDTFMQYVMKGGPLILNWALWLFIPLLLFVLAIFLPPILRLVRNNKIKDSVTLE
FT                   ANIVSVKETGTYINEQPLVKMQLQFQYDGQNIEKTVKTVVSYTQIPQPGQRIAILYNPQ
FT                   KKKAMLLKEGDFSQTSEPKFIKGAVLRNIESYGTVGRGTVLSLTFEADQKKYTIPMIQA
FT                   NGFEYRTGEKADLVDISGQLKMAAYGHEVRNRSGKDVTLTGTIQRVKQYPVTIHNQKPI
FT                   MLDVMVSSGDQSITKTVSQFIPDHMEVAPGTQITMQTKQEELDKEISLMQEKQGSAKVT
FT                   HVAFSGVIGNQPLATIQIERDGVMYEVKQPIDPITSVLPGDELWVAYHEMTRQAAIVKY
FT                   ASI"
FT   gene            complement(459814..460110)
FT                   /locus_tag="BPUM_0396"
FT   CDS_pept        complement(459814..460110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61091"
FT                   /db_xref="GOA:A8FA24"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA24"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214125.1"
FT                   /protein_id="ABV61091.1"
FT                   /translation="MHTSISRLRQAGFIEGMSLLTLLLIAMPLKYFADIPMAVTIVGSL
FT                   HGALFVIYMLILAYVTFKVRWHLKWSIAGFFAAFIPFGNFAYDKVLRQYDTKA"
FT   gene            complement(460247..460921)
FT                   /locus_tag="BPUM_0397"
FT   CDS_pept        complement(460247..460921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0397"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61092"
FT                   /db_xref="GOA:A8FA25"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA25"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008957.1"
FT                   /protein_id="ABV61092.1"
FT                   /translation="MNSFEMERPAPYHMQFYEQLKQMIFDGQFQPGERINETQLAKQFG
FT                   VSRSPVREAMRLLEKDELLIADHRSGYSIYTLSEEDVEELYQIRIALETLAVELACKEA
FT                   AQKELDEIEQVLTQADEAIKQQLPSKDIVQLHEAFHQKIILASHNHRLYKQLNHVNALI
FT                   HFCRIFHFSGGARAETIQTEHAAIYSEMKERRSTEAVQAMTNHLLHDVMHLKQVLSETN
FT                   KD"
FT   gene            461007..461240
FT                   /locus_tag="BPUM_0398"
FT   CDS_pept        461007..461240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61093"
FT                   /db_xref="GOA:A8FA26"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA26"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_005344139.1"
FT                   /protein_id="ABV61093.2"
FT                   /translation="MSYNSREKGCSVKTSVYIYGVPIITMVISMIVLHERLTLMSALGT
FT                   VLTLGGLVLSDKKSARRKKENPSMLFQDKQAL"
FT   gene            461337..462392
FT                   /locus_tag="BPUM_0399"
FT   CDS_pept        461337..462392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0399"
FT                   /product="tartrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61094"
FT                   /db_xref="GOA:A8FA27"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA27"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358420.1"
FT                   /protein_id="ABV61094.1"
FT                   /translation="MKHVSIAAIPGDGVGKEVVPEAIRVLKAVSEVHGGLSFTFQDFPW
FT                   SCEYYLEHGEMMPKDGLDQLKAFDSIFLGAVGDANLVPDHVSLWGLLIKIRREFEQVIN
FT                   VRPAKQLNGIRSPLSQPKDFDLLVVRENGEGEYSEIGGRIYQGEDQLAVQNAVFSRKGT
FT                   ERAMRFAFQLAEKRRKHVTSATKSNGIVHTMPFWDEVFQDVAKDYPEVTADSQHIDALS
FT                   AFFVTRPEKFDVIVASNLFGDILTDLGAAIMGSIGVAPAANINVNGKYPSMFEPVHGSA
FT                   PDIAGKGIANPIGQIWTAKLMLDHFGEEELGTHLLETIESVTADGFLTADIGGAYQTQE
FT                   VTNEIIKRLKK"
FT   gene            462465..464651
FT                   /locus_tag="BPUM_0400"
FT   CDS_pept        462465..464651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0400"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61095"
FT                   /db_xref="GOA:A8FA28"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA28"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358419.1"
FT                   /protein_id="ABV61095.1"
FT                   /translation="MSKTVVLAEKPSVGRDLARVLKCHKKGNGFLEGDQYIVTWALGHL
FT                   VTLADPEGYGKEFQSWRLEDLPIIPEPLKLVVMKKTGKQFQAVKAQLARKDVKDIVIAT
FT                   DAGREGELVARWILEKAHVKKPLKRLWISSVTDKAIQEGFKRLKDGKEYDNLYRSAVAR
FT                   AEADWIVGINATRALTTKFNAQLSCGRVQTPTIAMIFKREEDIQQFQPKPFYGLTAQVD
FT                   GLTLTWQDAKTKQNRTFQENVIKERLAACKGKPAVVDALKKTAKKAFAPGLYDLTELQR
FT                   DAHKRYGFSAKETLSTLQRLYEQHKLVTYPRTDSRFISADIVPTLKDRLKGMNVRPYAQ
FT                   HVNRILQSGVKAHKGFVNDAKVSDHHAIIPTEEELYPGVLSDKERKLYDLIAKRFLAVL
FT                   MNPFEYEETTVITKIGSETFTAKGKTVQAAGWKAVYDDSYEEEESAEADQHLPLLSEGQ
FT                   SLDVRQLKETRGETKPPARFNEATLLSAMENPAAFMQNEEKDLVKTLGETGGLGTVATR
FT                   ADIIEKLFNSFLIEKKGKDIFITSKGKQLLSLVPEDLKSPALTAEWEQKLSKIAKGQLK
FT                   ASQFMSEMKSYAKQAVSEIKQTNQTFKHDNVTGTHCPDCGKLMLKVNGKHGTMLVCQDR
FT                   ECGHRKNVAKKTNARCPNCHKKLELRGEGDGKIFACVCGHREKLSVFEKRKSQSNQKKA
FT                   SKHDVSKYMKKQKKVEEPINNALAEQLKKLKLDQ"
FT   gene            464849..465931
FT                   /locus_tag="BPUM_0401"
FT   CDS_pept        464849..465931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0401"
FT                   /product="glycosyl hydrolase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61096"
FT                   /db_xref="GOA:A8FA29"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA29"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214245.1"
FT                   /protein_id="ABV61096.1"
FT                   /translation="MHTRIYRTAIFLLIVILLGGCTWRQQKESADPVSPQPVLPGEYFI
FT                   THHLMTDQGLIRTSFAEEHIYLSESLGLWMDYLVRKKDQNLFDQQLGVLQDQFLLDHHL
FT                   LSWQIESEQKSKANALVDDLRVVSALQKANRLWKKPAYQSTAKEIAQALKEKNMYKGIL
FT                   SDYYDASTNRTSHTITLSYIDPKAIKELESLHIFTKQMTSNQLAILKQAPRKKGFFPKS
FT                   YDIKKKTYSFDQEINMIDQLYTAQHAHHAKVNTSEIMKWLKTSFKQDGKLYGRYKLSTL
FT                   QPSVTYESPSVYALVILYALKQNEQKFAKTVYHRMKELQTQDPLKPYYGGYMNEKETHS
FT                   FDNLLPLIAERELLNESVVQ"
FT   gene            465912..466763
FT                   /locus_tag="BPUM_0402"
FT   CDS_pept        465912..466763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61097"
FT                   /db_xref="GOA:A8FA30"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA30"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008962.1"
FT                   /protein_id="ABV61097.1"
FT                   /translation="MNRLFSNTYRLYYSLLLTFAGLILFMGYLNVQDAESFMIIALTFV
FT                   VLGCGILFGILPALIFTLLILFFIGSAMFFTELGHVSPLFSNQTLQDVVIWGVALLFFA
FT                   ISAGSLHERIHTLRHTIEQQKQAIKQFVAIDSTTGFDNAERMKLELSEEMKRAERYKQP
FT                   FVFILLHMNYAAEFKSLYGEKEMQHLFQQLSLKIRESVRETDKKFRLSEERMGLLLTHT
FT                   PEENVSVVLDKLKDKLQTHVLLNGREVTLTFHVCHLTSSSDYRTPEQFLEELEKEMMMN
FT                   EL"
FT   gene            466753..468468
FT                   /locus_tag="BPUM_0403"
FT   CDS_pept        466753..468468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61098"
FT                   /db_xref="GOA:A8FA31"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA31"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008963.1"
FT                   /protein_id="ABV61098.1"
FT                   /translation="MNCNSLMKCCLMITLFTIVSFKHIASADALVTQPNTLIVYSTPSG
FT                   EVTPAVHMLDLLVGHFSKQTMIVSDEHLAEKRINEFQQVIYLGEIKRTLSKQTIRAMNE
FT                   SQQFIAIGYNAEQFRPFSKLTFHKQDHTSQIKHTHDQTYRQLERSINVLTVRGAELKNE
FT                   FLVKKRQSDLPFVIQTKEGAAYIGILDVMQHNELLAEALEKHMSPSVQMTTKYLMLGNI
FT                   SPASDEKKLLELGQYVSAQHIPYQIAVTPAWIDRATGDEVTLSDRPKLVSVLKQLQGNG
FT                   ASIILHGFSRTYRTEESGQGFEFWDAKYDQPISSNDPKKAEKKRMKSQFPNEKDFHTYT
FT                   KSYQEQEIAYTEEKLTKGIELLTSQGLYPLGFEVPHDATSQQGYEVISKHVSSLFGQVQ
FT                   LSDRTWKSVGASPLVTSPAMLHGMTLYPQHQVEQAPDQEGSNVLTEQTIQSVQHLQSAA
FT                   IGLSYDVELGIAGLQDLITQMEAIPSSEWLDIKKTKQTVQTAHVKIQTFGNGHIQVEES
FT                   NIAETKTVKRSGMENMLRILTVVVMLFIAAFALYTLYLRLTMKKRIFKERKLGG"
FT   gene            468461..469729
FT                   /locus_tag="BPUM_0404"
FT   CDS_pept        468461..469729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0404"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61099"
FT                   /db_xref="GOA:A8FA32"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA32"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358415.1"
FT                   /protein_id="ABV61099.1"
FT                   /translation="MADVLFYLSLMLIWIMLLYHMFLMQGGFQHYLTYEKVLPKWTKQG
FT                   KDLPTVSILIPAHNEEVVIRQTLKAMVQLSYPKHLLEIIVINDNSSDRTGEIVQSFSEQ
FT                   YDHVHMIETKPPFAGKGKSTALNEGLKASTGEVICVYDADNMPEPRAVYHLVLGLLNDP
FT                   KAGAVVGKFRVINAAKNLLTKFINIETICFQWMAQGGRWKWFGIATIPGTNFAIRRHIL
FT                   EELGGWDVQALAEDTELTIRVYNLGYVIRFFPAAITWEQEPETWKVWWRQRTRWARGNQ
FT                   YVVLKFLRQFMKLKRKRMIFDLFYFFFTYFLFFFGVLLSNGIFIVNLFVDLHLSVGAVA
FT                   LILWGLAFFLFLTEVMITLSIEKTELTKQNILIVVLMYFTYSQVWIALVVYSLCVEVKS
FT                   RLLKQEVKWYKTERYDQQQKKSG"
FT   gene            469734..471821
FT                   /locus_tag="BPUM_0405"
FT   CDS_pept        469734..471821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0405"
FT                   /product="regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61100"
FT                   /db_xref="GOA:A8FA33"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA33"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008965.1"
FT                   /protein_id="ABV61100.2"
FT                   /translation="MKSVKWMFLILALSLAIQPFFMASQAMAQSNRVQVKDDWVHSSKG
FT                   NQTETQHLSEDVVTLYGQEDRTEFSYQMEKEKVESSTLTLNIEASPLLISPSSFTVMID
FT                   GEIEKTIPVSGENAKKSIEIKLNKAQLKKGSHQIQLAFYGVLKEGVCINQETPANWLKV
FT                   YPESELAFKGVQTKDVTLDSFPSPFISSGEQNEQTDIVIPNKPNAAELEAAMKVYRTLK
FT                   NKDRQADLKLVQEKDIEQIAHPTIAVGAKGSWNGRMKSIEQAAGIKTEGDQLTLAVRTL
FT                   TAKKKEQPVLFVTAKQPKIIAEKINVLTQPELTGQLTGTDLLLQKVTANVSKPSHHIRL
FT                   IDFGGDDIKVGTKKTASDHYYYPKALMAQQKSGAKLTLSFKKSDPANKAERLTVMINNE
FT                   PHDVPLTKLGNKDENGFYHVSIPVDSQVLQKNEYVDLQFVTTGFKNMESCRHTDEEGWI
FT                   YIDKNSSLQIPEGTTSDTPDLTAWPLPYTSETQQGNTLIIMPDQITQASINQMAMLTES
FT                   FSQPEATHYHLVEASNVTDEQLKKNSLIFIGGIQTFSLLKEKADDLIVPAEKDQYDVSS
FT                   FGMINETTARIVWTQPSVWNKELTMTVFSGMTPADANISNEVIQFLQTNTETATVAIES
FT                   KNKDMFSNHQTVSNAKNDLKKGEKQGAGESWVYFACIAVLIIFVAVMIVYFLRKNRKKT
FT                   D"
FT   misc_feature    471954..472023
FT                   /note="possible YdaO-YuaA riboswitch; BPUM_nc0004"
FT   gene            472149..473975
FT                   /locus_tag="BPUM_0406"
FT   CDS_pept        472149..473975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0406"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61101"
FT                   /db_xref="GOA:A8FA34"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA34"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019743134.1"
FT                   /protein_id="ABV61101.1"
FT                   /translation="MYSLMKRILIGKPLKSQAAGEQKLSKIKALALLSSDALSSVAYGT
FT                   EQILIVLSVVSAAAFWYSLPIAGCVLILLMALILSYRQIIYAYPEGGGAYVVSSRNLGE
FT                   KPGLIAGGSLLVDYILTVAVSISAGTDAVTSAFPALYPYHVLISIVLVIVIMVLNLRGL
FT                   TESASILAYPVYLFVFSLLILIGVGGFKLLTGGVPPAPEHTAVGTHVQGITLFLLLKAF
FT                   SSGCSALTGVEAISNTIPSFKKPAAQNAARTLLMMGGLLAVLFVGVTLLAFGFGISPKP
FT                   EETVVSQIASDTFGRTFFYYVIQAVTALILILAANTGFSAFPLLAVNLAKDKYMPRMFT
FT                   VRGDRLGYSNGIIFLGVASMLLIWLFDGKTEHLIPLYAVGVFIPFTLSQTGMCVKWIRE
FT                   KPQGWKTKMPINIVGALISFTVFMILILTKFHLVWPVFVFLPIVLFIFHSIKKHYLSVG
FT                   EQLRLLNETESVEMKGNVVIVPIAGVTRVVEQSLQYAKSLSEQVIAVHVSFDKEKDKKI
FT                   EEDWEKLNSGVRLVMLHSSYRSLIHPLDKFLETVEAKANAHQYKVMVLVPQFIPKKRWH
FT                   TILHNQSAFLLRFRLLWKRDIVVATLPYHFKK"
FT   gene            474046..475767
FT                   /locus_tag="BPUM_0407"
FT   CDS_pept        474046..475767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0407"
FT                   /product="thiamine pyrophosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61102"
FT                   /db_xref="GOA:A8FA35"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA35"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008347133.1"
FT                   /protein_id="ABV61102.1"
FT                   /translation="MPQRTAGKEVTALLEEWGVKHIYGMPGDSINELIEELRHESSQIQ
FT                   FIQTRHEEVAALSAAADAKLTGKLGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQV
FT                   ASAEVGRDAFQEIKLERMFDDVAVFNQQVQTAEALPDLLNQAIKAAYTHKGVAVLTVSD
FT                   DLFSQKIKRKPVYTSPLYVEGEVRPKKDQLLKAAQLINNAKKPVILAGKGLRHAKEELL
FT                   SFAEKAAAPIVITLPAKGVVPDRHPYFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYR
FT                   DYLPEDTQAIQLDIKPDQIGKRYPVDVGIVSDSKSGLHELTSYIEYKEQRGFLEACTEH
FT                   MMKWREEMDKEKSVATSPIKPQQVIARLEEAVEDDAILSVDVGNVTVWMARHFEMKQQD
FT                   FIISSWLATMGCGLPGAISAKLNEPNRQAIAVCGDGGFTMVMQDFVTSVKYKLPIVVVI
FT                   LNNKNLGMIEYEQQVKGNMNYGIELEDIDFAKFAEACGGKGISVSSHEELAPAFDTALQ
FT                   SDKPVIIDVAVDNEPPLPGKITYTQAAGFSKYLLKKFFEKGELDIPPLKKSLKRFF"
FT   gene            476004..477557
FT                   /gene="yqcG"
FT                   /locus_tag="BPUM_0408"
FT   CDS_pept        476004..477557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqcG"
FT                   /locus_tag="BPUM_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61103"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="InterPro:IPR027797"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA36"
FT                   /protein_id="ABV61103.1"
FT                   /translation="MDARSKHYQELREQMVDLKKALQGVANLGDDFTGKGADNIKSFYK
FT                   ELAGNVDMFISFIDKQKAFHEGVSGTLDDTNFGGDTFVEEHFLDNAVHMGIKNAKSIVK
FT                   DQKKALKTIFQDIDDLLSLEVFDSQTFDEKIADAEDERKKTVKDLRELDQNLKDEYALS
FT                   ETEQQATMALYAEMMNATNDGKAISPMNFDKKAYQNSEIYKAKSDIEKQTSEYLNIKKE
FT                   QQEAREIAKEQEALANRPWYEKALDYGGNIVNELTGVNDAKRAATGVDPITGEELTAGQ
FT                   RVAAGGMAAAGYIPIVGWAGRIFKGGKAVYKTTQATSAAVKAVDIYKTSQKSFDALKTS
FT                   QKGLYGLTATNGFSEAITGRDMFGNKISKEQQEASMNAALGMLLPFGAKGFHGKMGVKN
FT                   TRELKHPVLENPRAGSALKDDFYHSFNDIIDNYAVHSKRFDLPNRKGHMDSLYQIEGSV
FT                   VKYETKYVKVKNNAPEMVQSKEIKNGVFEWVVDPTTNTVTHRTFIPGGKVTGKINQWER
FT                   "
FT   gene            477562..478041
FT                   /locus_tag="BPUM_0409"
FT   CDS_pept        477562..478041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61104"
FT                   /db_xref="InterPro:IPR016630"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA37"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008969.1"
FT                   /protein_id="ABV61104.1"
FT                   /translation="MYKTEIITKNGFDCNWSTLFIGRQFNLISALEVTNYAVKYLENNP
FT                   NANNELMLELAWEQEEVKVDNILESITSDSSSEDMKREYHKWLYSTVKETYSHSSDEDI
FT                   FEEIENIFSIFNTPENMYDFFRKVSDAFYYPHDSKNTIKELVEEFLETEKELIFK"
FT   gene            478309..478533
FT                   /locus_tag="BPUM_0410"
FT   CDS_pept        478309..478533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61105"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA38"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008970.1"
FT                   /protein_id="ABV61105.1"
FT                   /translation="MLLILTQNQQTIIHVQEVSVSGKKIEGMILGSTSWAKLLGKYDSN
FT                   ERAAEILQDMMKTIEEHPNATMTYRMPPQ"
FT   gene            complement(478574..478837)
FT                   /locus_tag="BPUM_0411"
FT   CDS_pept        complement(478574..478837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0411"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61106"
FT                   /db_xref="GOA:A8FA39"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA39"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346966.1"
FT                   /protein_id="ABV61106.1"
FT                   /translation="MSLIILFYLWIVPLVFGIFFSFLTKKATYKRRFVPSYSMIGLSIV
FT                   FLILALVFSASHFLFICGMFLFATTLVGTGIPLFLAFGKTPS"
FT   gene            complement(478936..479505)
FT                   /locus_tag="BPUM_0412"
FT   CDS_pept        complement(478936..479505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0412"
FT                   /product="GCN5 family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61107"
FT                   /db_xref="GOA:A8FA40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA40"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008972.1"
FT                   /protein_id="ABV61107.1"
FT                   /translation="MFVYQDQEISMRLLEPRDARSLYLLIQRSREHLREWMLWVDSTQT
FT                   EEDSMMFIQGAMQQAMQNNGFQAGIWSHGELVGIIGTHQIHWINKTVSIGYWLGEGYQG
FT                   KGIMTKACQAVIRYLFEECGLHRIEIRAAVDNQKSRRIPERLSFSLEGVLRQCEWLGNR
FT                   FTDHCVYALLQPEYMKQKTDAMNQHT"
FT   gene            complement(479576..480853)
FT                   /locus_tag="BPUM_0413"
FT   CDS_pept        complement(479576..480853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0413"
FT                   /product="manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61108"
FT                   /db_xref="GOA:A8FA41"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA41"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008362186.1"
FT                   /protein_id="ABV61108.1"
FT                   /translation="MTNKYIEAQAHMSEAAERALEGKVKGFRRLLPFLGPAFIAAIAYI
FT                   DPGNFATNIAAGSKYGYLLLWVILISNLMALLIQSLSAKLGIATGKNLPEIAREEFPKP
FT                   VSIGLWIQGELVIIATDLAEFIGAALGLYLLFRIPLLEASIIAAIGSFAILELQRRGYR
FT                   ALEAGITGMLFVVVIAFAVQTFVAKPDIASVAGGLFIPKFDGADSVLLAAGILGATVMP
FT                   HAIYLHSALTQRRVVGRTEKEKKQIFRFEFLDILIAMIVAGAINASMLIVAAALFYKNG
FT                   LFVEDLDVAFQHFGTLAGPVSAILFGVGLLVAGLSSSSVGTLSGDIIMQGFIQYRIPLY
FT                   VRRLITIIPPIAIIASGVNPTSALVMSQVVLSFGIAFALIPLILFTSKKRIMGELTNAR
FT                   WVTGISWVIAALVVALNLFLIVDTFM"
FT   gene            complement(481076..481336)
FT                   /locus_tag="BPUM_0414"
FT   CDS_pept        complement(481076..481336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61109"
FT                   /db_xref="GOA:A8FA42"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA42"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214275.1"
FT                   /protein_id="ABV61109.1"
FT                   /translation="MLGFLISLVVAIVIGLIGSALAGGSVPGGWIGSMIAGLAGAWIGH
FT                   GLLGTWGPSLAGFAIIPAILGAAIFVIILSLIFRSVGSRVS"
FT   gene            481493..482323
FT                   /locus_tag="BPUM_0415"
FT   CDS_pept        481493..482323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61110"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA43"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008973.1"
FT                   /protein_id="ABV61110.1"
FT                   /translation="MEEREWLKAQLKEIEKWEKDQQKVWFWEKLSRLPFQMLDKLTPAF
FT                   IQKKIGVLLDEMGHYIQSGGAYLTSEKGIIHQFQKKCADDSIQRIEDIEKAPIEIMDAI
FT                   SEHMGKNRTNLATVQGATTGVGGMFTLAADIPAVLGLSLKTLQDIAVTYGYDPKNKEER
FT                   VFIIKCLQLTSADVVGKKSILKELRSFHDSEGKHENMFSQIQGWREVVYNYRDSFGWKK
FT                   LFQLVPVAGILFGAVSNRSQLKSIAETGMMQYRKRRIVSRLEEITQQEQSESGA"
FT   gene            complement(482529..483626)
FT                   /locus_tag="BPUM_0416"
FT   CDS_pept        complement(482529..483626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0416"
FT                   /product="C4-dicarboxylate ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61111"
FT                   /db_xref="GOA:A8FA44"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA44"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008974.1"
FT                   /protein_id="ABV61111.1"
FT                   /translation="MKNLLAYTLLLLIGFVTALYFGFYHMMPKDATTFDDEQTGLRDQL
FT                   VFKFSHVVADNTPKGLAAKKFAELVHEKSDGKITIQIFSNGSLYSDIEEINALKENQVQ
FT                   FIAPSTSKLGMLSPEWLALDLPFAFSNYDAVQEGLHGAIGQRLFGTLQKDGLKGMAYWT
FT                   NGFKQITSNKGPIKQPSDLKNQSLRIMQSDMIEKQFKLLGAKPYQESFNSTFQLLETKK
FT                   VDGEENTISNIYSKKFYHIQDYMTISNHGYLGYVVLTDQSFFDRQTPETKQILLEAMEE
FT                   TTAWNEKHAEQMNKDQLEEIKRESPIAIHELTPAERQKWVKALDPLYEEAEKTIGSPLI
FT                   KQIRELRARYEHSPIHAFQEEDKTK"
FT   gene            483694..485313
FT                   /locus_tag="BPUM_0417"
FT   CDS_pept        483694..485313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0417"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61112"
FT                   /db_xref="GOA:A8FA45"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA45"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346953.1"
FT                   /protein_id="ABV61112.2"
FT                   /translation="MMRNRLKLQQLSIRWKLTILTYFVVIFALLIGGIVLVGGIQQTEE
FT                   RELRKRLMNTARTVAEMNEVKQALADQTKERDRLQHAIEEIRIIQDADYIVVMDMDHVR
FT                   LTHPVKARIGQRSEGTDEEPAFAEHIYFSEAEGELGTAIRAFYPVKDDQFNQTGVVLVG
FT                   RTLPSMIDILGEMKRDILMILLLTLSFGLVGSFLLARHIKQQMFKLEPHEIVRMLEERT
FT                   ATFHSINEGVIAIDNQHMITIFNEKAKQIFSVTGDVVGKNIWDVLSDTRLPEIIDRAEP
FT                   VYNEEIHMSGKRIMSSRIPIVMKKKIIGAVAIFQDRTEATKLAEELTGVKNFVDGLRVQ
FT                   NHEHMNKLHTIAGLIQLGKPDQALDLAFQTTEEQEHVLDFLHRVIQHDAVAGLLMSKIR
FT                   RGKELGIKVEVDEQSYLRDFPERLDQHDMTKLLGNLIENAFASYDTVERDTKCISISID
FT                   QTEDVLAILIEDNGSGIEEEMIPYIFDKGFTHGKEGGTGYGLYIVKTIIDKGMGNVEVT
FT                   SSIGIGTTFSIEFPMIIEERDR"
FT   gene            485310..485993
FT                   /locus_tag="BPUM_0418"
FT   CDS_pept        485310..485993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0418"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61113"
FT                   /db_xref="GOA:A8FA46"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA46"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214207.1"
FT                   /protein_id="ABV61113.1"
FT                   /translation="MTQIKVLLIEDDPMVQEVNKEFIKSVPGFQVVAIAGNGEQGIQLI
FT                   KEIRPDLVVLDVYMPKKDGMKTLQDIRKQKIQVDVIVISAAKDKETIGTMLQNGARDYI
FT                   IKPFKFERMKESLETYKAFKSKIRTAAEFSQEMLDDIIRKPAVKQEDTWLPKGLNVHTM
FT                   NEIKAYMGLQEGPQSAEEVANALGIARVTARRYLDFLVKEGELKLDMQYGGVGRPVNKY
FT                   IVHSD"
FT   gene            486118..487386
FT                   /locus_tag="BPUM_0419"
FT   CDS_pept        486118..487386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0419"
FT                   /product="glutamate:protein symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61114"
FT                   /db_xref="GOA:A8FA47"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA47"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008361851.1"
FT                   /protein_id="ABV61114.1"
FT                   /translation="MKRLLKNLTFQVVAAVIIGIIVGMVWPNVGKEMKPLGDTFINAVK
FT                   MVIAPIIFLTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALVIGLFVVNIMKPGAGL
FT                   DYSKLEKGDVSQYTQNGGQGIDWMEFVTHIVPSNMVDAFAKGDILQVLFFSILFGVALA
FT                   ALGDKGKGIIEWLDKLSLVFFKIIGYIMRAAPLGAFGAMAYTIGHFGLASIKPLASLML
FT                   SVYLTMFLFIFVVLNIICKMYGFSLLGYLRFIKDEILIVLGTSSSESVLPRMMDKMERY
FT                   GCSKSVVGLVIPTGYSFNLDGTSIYLSMAVVFLAQVFGVDLSIGQQITIILVLMLTSKG
FT                   AAGVTGSGFIVLASTLAALQVIPLEGLALLLGVDRFMSEGRAITNLIGNGIATIVVAKS
FT                   EGEFDEAKSKTALQEMRNMKQAV"
FT   gene            487596..488618
FT                   /locus_tag="BPUM_0420"
FT   CDS_pept        487596..488618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61115"
FT                   /db_xref="GOA:A8FA48"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA48"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:P96604.1"
FT                   /protein_id="ABV61115.1"
FT                   /translation="MAAFLKLFEKPGVKRFSVFVVLATALYLLRGMMNLILLTFIFTFL
FT                   MNRLEEVIRGFLSRFLKIGQKSVITILYILLAGGLTFGGFVFVPIIAKQVEQLFHLGKK
FT                   IADHPQNLPFFDVITNVFGDFKISAYFEKGFNFLYTYLTDFSTFSIQVIMSLILSMFFL
FT                   FEKERLIQFMNKFKTSKISVFYHEIAFFGRKFSRTFGKVLEAQFIIATVNCVLTTIALG
FT                   IMGFPQLFGLAVMVFLLGLIPVAGVVISLIPLSIIAYTLGGGMYVLYIVLVIVIIHAIE
FT                   AYFLNPKLMSAKTELPIFFTFIVLIFSEHYIGIWGLIIGIPIFVFILDILEVTNKEESS
FT                   "
FT   gene            488894..490135
FT                   /locus_tag="BPUM_0421"
FT   CDS_pept        488894..490135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0421"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61116"
FT                   /db_xref="GOA:A8FA49"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA49"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008979.1"
FT                   /protein_id="ABV61116.1"
FT                   /translation="MKLATKIIIALIVGAITGLLLNIFAPNVFKTLDPYLFTPLGQIFL
FT                   NLIKMLVVPIVFFSITLGVAGLGDPKKLGRIGAKSILYFLLTTTFAIIIAMSLALLIKP
FT                   GSIGSFDTKGAEYEPQEAPSTTDTLLNIIPSNPVQSLVEGNMLQIIVFCVFLGLGIAVL
FT                   GKKTEGLLNILEQGNELMMYLVGVVMKFAPYGTFGLIVTAIGSQGLEAIKAMGLYFTVV
FT                   LVALLVHFFLTYGSTLALFAKRNPFTFFKDFSPAMVVAFSTSSSSAVLPVSMETAQKKL
FT                   KVPEPISSFVQPLGATINMDGTAIMQGVATIFIAQVFGVELTLMQMLTVVLTAVLASIG
FT                   TAGVPGVGLIMLAMVLNSVGLPVEGIALILGIDRLLDMARTVVNITGDAACAVIVTETE
FT                   KKHEKDAASPNLSM"
FT   gene            490272..491198
FT                   /locus_tag="BPUM_0422"
FT   CDS_pept        490272..491198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0422"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61117"
FT                   /db_xref="GOA:A8FA50"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA50"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214395.1"
FT                   /protein_id="ABV61117.1"
FT                   /translation="MESAVLKVEKVDKRIGRKIILQDISIEIGKGEIVGLLGPNGSGKT
FT                   TLIRLIVGLMKKNNGRIMINGYSQDEDFRHAMSSVGAIIENPEFYSYLTGFENLELYAA
FT                   MHNGVTEERMHEVVKRVRLEHAIHQKVKTYSLGMKQRLGIAQAILHQPNLLILDEPTNG
FT                   LDPAGMKEFREHLQTLVREEGTSVLFATHLLHEVEELCDRMIIIQKGEIKASTMLRDIE
FT                   GKEQMLMNIQPVEKAVTWLETHDYTYERNGSHVLLQLNKEQVPELNKQLVLAGFDVLEM
FT                   TPQKPSIEEAFMKWTEGGTADASTHQE"
FT   gene            491176..491943
FT                   /locus_tag="BPUM_0423"
FT   CDS_pept        491176..491943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61118"
FT                   /db_xref="GOA:A8FA51"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA51"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214257.1"
FT                   /protein_id="ABV61118.1"
FT                   /translation="MLQLIKNEHKKMMKKKITFIALGLIVVFQLAMALALKRVISSFGG
FT                   QDTVANYFAYSTNVVFILQVLAVVIGATLISTEFQKRTIKFLLIRPKTRLQIYLSKYIT
FT                   LVLKVIYLFVFYYVIAFLFGLIFFGTAFDESSGRLFQHTFAVIGSQWVEVLMMASFAFM
FT                   CSSLFRNSLVALVTSFFVLYAAKSLVPIMSLLENQWGKILLFANTDFTQYSFQGPPPFH
FT                   GMSPLFSLFMVGAHFVFFVGTAWVLFWKRDVNV"
FT   gene            492061..492396
FT                   /locus_tag="BPUM_0424"
FT   CDS_pept        492061..492396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61119"
FT                   /db_xref="GOA:A8FA52"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA52"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366657.1"
FT                   /protein_id="ABV61119.1"
FT                   /translation="MKNFITALPILLLLSFSFVSFAFQFDHLIYFRLALGIFSLAGLFF
FT                   LYTLKRNMKWFMVYLYASWIILAAVTTFEEPVFSQFFFGGLTMTMGYLTYMLIYLGMKQ
FT                   DRVAKSH"
FT   gene            complement(492496..492645)
FT                   /gene="ydbN"
FT                   /locus_tag="BPUM_0425"
FT   CDS_pept        complement(492496..492645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbN"
FT                   /locus_tag="BPUM_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61120"
FT                   /db_xref="InterPro:IPR025004"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA53"
FT                   /protein_id="ABV61120.1"
FT                   /translation="MSKKKIKTYQQLIEENKKAIMRDPKMMESIYETIDKKHQKQLAAT
FT                   GRES"
FT   gene            complement(492992..493312)
FT                   /locus_tag="BPUM_0426"
FT   CDS_pept        complement(492992..493312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0426"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61121"
FT                   /db_xref="GOA:A8FA54"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA54"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214131.1"
FT                   /protein_id="ABV61121.1"
FT                   /translation="MKKITSTEQFNEIIQSDKEVIVKFFATWCPDCTRMDMFIPDILEA
FT                   YAHHEWFEINKDDFPELAETYQVMGIPSLLIFKNGEKTGHLHSANAKSPEEVTEFLQEH
FT                   VS"
FT   gene            493496..494578
FT                   /gene="ddl"
FT                   /locus_tag="BPUM_0427"
FT   CDS_pept        493496..494578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BPUM_0427"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="D-alanine--D-alanine ligase; DdlA; DdlB;
FT                   cytoplasmic; catalyzes the formation of D-alanyl-D-alanine
FT                   from two D-alanines in peptidoglycan synthesis; there are
FT                   two forms of this enzyme in Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61122"
FT                   /db_xref="GOA:A8FA55"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FA55"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358403.1"
FT                   /protein_id="ABV61122.1"
FT                   /translation="MKISLGLIYGGKSAEHNVSLQTALAVTKALNTEKFDIHPIYITEE
FT                   GEWLRGEKLTEPVSNVRMLQFEQNAKTFLPTSLNESMFPQPTSADEKIDVVFPLLHGPN
FT                   GEDGTMQGLLELLNIPYVGNGVLASAAGMDKVMMKDVFAQAGLAQAKHLSFNKKDYEKA
FT                   TPDSLEQVEQVLGYPCFVKPANMGSSVGISKCRSKEELQTAFDLAFQYDRRVVVEEGVV
FT                   GREIEIGVLGNDEPKCSVVGEIAPKTDFYDYKAKYEDGDTDLIIPASVSEDEYKTIHDM
FT                   AIKAFKSLDGSGLVRADFFLTEKGEVLINEVNTMPGFTPFSMFPLLWKHTGVEYPELIE
FT                   KLVSLAIERHQEKQTIKTTF"
FT   gene            494660..496024
FT                   /locus_tag="BPUM_0428"
FT   CDS_pept        494660..496024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0428"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61123"
FT                   /db_xref="GOA:A8FA56"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA56"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496502.1"
FT                   /protein_id="ABV61123.1"
FT                   /translation="MIKRTVKQIAQMAGGTLSNQAFGEEQIHGVTTDTRKVSKGALFIP
FT                   LIGEHFNGHTFASKAVELGAAAVLWNQKETNPPEGVPVILVDDTLAALQQLAKSYLKEE
FT                   NPRVVGITGSNGKTTTKDMIHSVLQTTYQVHKTDGNFNNHIGLPLTILSMPKGTEIAVL
FT                   EMGMSAKGEIEFLSNLAEPDAAVITNIGESHMQDLGSREAIADAKCEITKGLKEDGTFY
FT                   YLGDEPLIRERATQLSQQVKTFGEADDCDIKVTHINQLAEGTEFQVEGYAQGFLIPVLG
FT                   KHNVKNALAAIAIGQHFGLNERQIAQGLMQTKLTGMRLELFKTEKGITVINDAYNASPT
FT                   SMKAAIDLVGDMDGFANRILVLGDMLEMGSEEETYHYELGRYIKPEFIDHVMTYGRLGA
FT                   FIAEGAKKSFGDTRVFSFMDKEELKKKLADVAGPDDVVLVKASRGMRLEEVITAL"
FT   gene            496052..496744
FT                   /locus_tag="BPUM_0429"
FT   CDS_pept        496052..496744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0429"
FT                   /product="carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61124"
FT                   /db_xref="GOA:A8FA57"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA57"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346929.1"
FT                   /protein_id="ABV61124.1"
FT                   /translation="MIGCLCIHGFTGAPYEVEPLAQYLKQKTDWNVQSVTLPGHGDELQ
FT                   LKGILYQEWIATAELELLSLYRTCETIFLIGFSMGGMIASYLAAKYPVARLVLLSAAAK
FT                   YVNPKQMIQDTRQMVKESLSGLIDTNPLYDRYRHKLTSTPLSAAVEFMKLVKQTKSSLE
FT                   KLHLPVLIVQGESDGIVPASSAQLIDHKIPSRQKEMFYLPDCKHHVCHEPCAQQLFEKV
FT                   EEFLKKTI"
FT   gene            496872..497210
FT                   /locus_tag="BPUM_0430"
FT   CDS_pept        496872..497210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0430"
FT                   /product="n-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61125"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA58"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346926.1"
FT                   /protein_id="ABV61125.1"
FT                   /translation="MFQYDGKTFVPQSNSSNGEVSVGTVFQYRQDGNILTGTYQGGSII
FT                   SGVLVGTVNEDGTLHFRYHHVSKDGSMRSGSCNSTPNQLDNGKIQLFEKWKWMDGDQSD
FT                   GESVIVEQ"
FT   gene            497376..498866
FT                   /locus_tag="BPUM_0431"
FT   CDS_pept        497376..498866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0431"
FT                   /product="DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61126"
FT                   /db_xref="GOA:A8FA59"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA59"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359541.1"
FT                   /protein_id="ABV61126.2"
FT                   /translation="MTITFQDFQLSESLMKAINRMGFEEATPIQAETIPLGLQNKDVIG
FT                   QAQTGTGKTAAFGIPLVEKIDPASPNIQAIIIAPTRELAIQVSEELYKIGQDKRARVLP
FT                   IYGGQDIGRQIRSLKKNPHIIVGTPGRLLDHINRRTMRLQNVETVVLDEADEMLNMGFI
FT                   EDIESILSNVPSEHQTLLFSATMPAPIKRIAERFMTNPEHVKVKAKEMTVSNIQQFYLD
FT                   IHERKKFDTLTRLLDIQSPELSIVFGRTKRRVDELTEALNLRGYTAEGIHGDLTQAKRM
FT                   VALRKFKEGSIDVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGRTGM
FT                   AMTFITPREKDMLRAIEQTTKRKMDRMKEPTLDEAIEGQQQVTVDRLRTIISENNLNFY
FT                   MTAAAELLEDHDSVTVVAAAIKMMTKEPDATPVRLTDEAPMVSKRNRNNRSSSKRRDGG
FT                   GGGGYRGKSRSSYGDKKRSSNDRNRSSSDRRQKKSYNN"
FT   gene            498977..499456
FT                   /locus_tag="BPUM_0432"
FT   CDS_pept        498977..499456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61127"
FT                   /db_xref="GOA:A8FA60"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA60"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346922.1"
FT                   /protein_id="ABV61127.1"
FT                   /translation="MRKQPQRQISLNGLKVWRLQNGIISLIFLLIIIGVFVASYYLHWP
FT                   YWIGAILTGLWVLQVVFGIWLIPKIRHRIWRYEVFENEIEIQHGLIRVTRVIVPMVRVQ
FT                   HVDTSQGPLLRRYRLASVQISTAATVHDIPALELEEADELRDYISRLARVTEDDV"
FT   gene            499446..500945
FT                   /locus_tag="BPUM_0433"
FT   CDS_pept        499446..500945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61128"
FT                   /db_xref="GOA:A8FA61"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA61"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008990.1"
FT                   /protein_id="ABV61128.1"
FT                   /translation="MMSEPKRVHPISMFIDFISDAVSMIKNFIIPFFVLIFVNSNSSIR
FT                   FYAFIILGVLLLWKAVLTVLAWRRFTYRMEDDEFRVESGVITKKKKYISLERIQTVNTS
FT                   EGIFQRIFGLVRVQIETAGGTDGPEVSLTAITKAEAEQLKQSIFNRKKSLQQEEMVDEN
FT                   GGTPHDPLAAHQPVEKEINVSYRMGIPELLLAATTSSGIGVIISGCLAIYTQIDEILPL
FT                   DGFIKQFSFLSHASVEIYAILIFIAVLIAWILSVGVTALQYANFNAKRKGKDIIITRGL
FT                   IERHQMTIPLARIQAVKIKENILREPFGFATVMLVSAGGSITEKETSSVLFPLIRKKKI
FT                   NELLSQFTDDYHLEPESELKKVPKRSLKRYLISFGFVPLLVGVILSVRFPPWGYLALIP
FT                   LPLALVFGYLAYKQSGYTIKDPLIQLTSRGIGKTTGIVLRKRMQNYTMTQSFFQKKGRV
FT                   ASIHTFVKSSALLDSFGVHHLEEEDAARVMDWYSYEKNKSS"
FT   gene            complement(501002..501607)
FT                   /locus_tag="BPUM_0434"
FT   CDS_pept        complement(501002..501607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61129"
FT                   /db_xref="GOA:A8FA62"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA62"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008991.1"
FT                   /protein_id="ABV61129.1"
FT                   /translation="MFIRTESFQQFIRSYPIVTTILALQFGLWLLFALPIPLIQLGHDH
FT                   LVGFNYGVAAGEWWRLITPVFLHGSLTHILFNSMSLFLFAPALEHLLGKVRFLIIYLGA
FT                   GFIGNLGTYWVEPLEYVHVGASGAIFGLFGVYLYLVLFKPHMMDRGNSQVILTILAVSV
FT                   IMTFVNSNINIMAHLFGLIGGMLLAPLTLVFHSKKRRY"
FT   gene            501702..502067
FT                   /locus_tag="BPUM_0435"
FT   CDS_pept        501702..502067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0435"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61130"
FT                   /db_xref="GOA:A8FA63"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FA63"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358398.1"
FT                   /protein_id="ABV61130.1"
FT                   /translation="MIKGIGLDIVEINRLAHVLSRQPRLPERILTLNEQDIFHALSEKR
FT                   QLEFLAGRFAAKEAFAKAYGTGIGRHLSFHDIEIQKDEHGKPFIKSEKTKDDQVHVSIT
FT                   HTKEYAAAQVLIERLSS"
FT   gene            502237..503244
FT                   /locus_tag="BPUM_0436"
FT   CDS_pept        502237..503244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0436"
FT                   /product="sporulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61131"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA64"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213990.1"
FT                   /protein_id="ABV61131.1"
FT                   /translation="MRKSFVLLVTGILFVLILSACGQKSQKDIVGDLNKKAEEMTSYKA
FT                   KAKMTIETGNDPQEYQVEIWYKKPELYRVYLENPKKDQSQVILRNGNGVFVLTPSLNKS
FT                   FRFHSDWPNNSSQVYLFESLVKDIKNDSAAQFKAKDSKYVFETKTNYQHNQMLPTQEIT
FT                   FHKKTMAPASVKVLDSDKKPMVKVEFSHFEFNKSFDKDAFDEKKNMTLSQMDVATSADP
FT                   SDSFAVKTPVDMPEGVKKMEEKEMMTDAGKRYVMTYGGKKSFTLIQEKARVAEASTPVT
FT                   MNGEPVDLGMTVGVLTDQSLSWTSDGVDYLISSSDLSKEELLMVAKSVEGQSAK"
FT   gene            503586..504764
FT                   /locus_tag="BPUM_0437"
FT   CDS_pept        503586..504764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0437"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61132"
FT                   /db_xref="GOA:A8FA65"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA65"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008994.1"
FT                   /protein_id="ABV61132.1"
FT                   /translation="MDTNAFYRDTWAEINLSAIKHNVSHMKDHIGQSVQLMAVVKANAY
FT                   GHGDIEVASAALKAGADILAVAFLDEAVSLRNKGIKAPILVLGAVPTEYVKVAVRYNVI
FT                   MTAYSIDWLKDVINMMEGQMGQPIRFHLKIDSGMNRLGVKTIEQVNEVKKLVDEHSYLQ
FT                   LEGVFTHFATADEKDEAYFDRQVDTFQTLLEPLHTDKLLIHCANSAAGLRFKDVLFNMV
FT                   RFGISMYGLSPSEEIKDELPFKLEEAMSLHTKLAHVKHIQKGESVSYGATYTANQDTWI
FT                   GTVPVGYADGWIRKLAGTEVLVGGKRRKITGRICMDQFMVELKDKLPVGEPVVLIGKQG
FT                   EDMIQVDEIAKRLETINYEITCSIGHRVPRVYIEDGKRVQVRNPLLQGGPSF"
FT   gene            505061..505342
FT                   /locus_tag="BPUM_0438"
FT   CDS_pept        505061..505342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0438"
FT                   /product="antitoxin endoai"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61133"
FT                   /db_xref="GOA:A8FA66"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA66"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012008995.1"
FT                   /protein_id="ABV61133.1"
FT                   /translation="MSESSATNEMKIRLPETLMSEIERVAEQDKVTRNELIYRATKTYI
FT                   RERNIRQNRESMRRGYMEMAKINLNISSEAQYAEFEAENTVERLVSGG"
FT   gene            505347..505697
FT                   /locus_tag="BPUM_0439"
FT   CDS_pept        505347..505697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0439"
FT                   /product="PemK family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61134"
FT                   /db_xref="GOA:A8FA67"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA67"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003253417.1"
FT                   /protein_id="ABV61134.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVA
FT                   AITAQIQKAKLPTHVEINAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMEKVD
FT                   EALQVSLALIDF"
FT   gene            505812..506642
FT                   /locus_tag="BPUM_0440"
FT   CDS_pept        505812..506642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0440"
FT                   /product="RsbT co-antagonist protein RsbRA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61135"
FT                   /db_xref="GOA:A8FA68"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA68"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358395.1"
FT                   /protein_id="ABV61135.1"
FT                   /translation="MSNHIVLAFARKHQKELEKEWTDILKRLGEKETDMMLNDKMYETI
FT                   CSEYVQLIITSLSEGDNEDFEEKVQNFALKIVQMGISLKLLANGLTEIRTHLYEKMNDD
FT                   KDTTQESHDLIWQIDRFITPIHNEILNQYSISWEKTVSLQKIALQELSAPLIPVFEHIT
FT                   VMPLVGTIDTDRAKKIMENLLNGVVKHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRL
FT                   VGAKCLLVGIRPEIAQTIVNLGIDLSQVTTKNTLQKGIQTALEMTNRKIVSLEG"
FT   gene            506647..507015
FT                   /locus_tag="BPUM_0441"
FT   CDS_pept        506647..507015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0441"
FT                   /product="RsbT antagonist protein RsbS"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61136"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA69"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359559.1"
FT                   /protein_id="ABV61136.1"
FT                   /translation="MRNHPKIPILKLYNCLLISIQWELDDQTALHFQEDLLNKIHETGA
FT                   NGVVIDLTSVDMIDSFIAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGISLEEIQ
FT                   TALDLEQGLETLKRELGE"
FT   gene            507018..507419
FT                   /locus_tag="BPUM_0442"
FT   CDS_pept        507018..507419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0442"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61137"
FT                   /db_xref="GOA:A8FA70"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA70"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214085.1"
FT                   /protein_id="ABV61137.1"
FT                   /translation="MKDQSCVKILTEWDIVAARQLGRNVAKELGFGTVDQARITTAISE
FT                   LARNIYLYAGKGQICIEEVMERGKRGLKVIAADEGPGIMDIRKVMEDGFSTSGGLGAGL
FT                   PGVRRLMDEFKLDSAPEQGTEIQAVKWLR"
FT   gene            507430..508437
FT                   /locus_tag="BPUM_0443"
FT   CDS_pept        507430..508437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0443"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61138"
FT                   /db_xref="GOA:A8FA71"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA71"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358394.1"
FT                   /protein_id="ABV61138.1"
FT                   /translation="MDFKEVMEQRYHQLLSRYISDLTETSLYQAQKFSRKTIEHQIPPE
FT                   EIVSVHRKVIQELYPDLPEDVFHSLDFLIEVMIGYGLAYQEHLTLRGIQQEIKSEIEIA
FT                   ANVQQTLLETKIPEGDTFDIGAISVPAKQMSGDYYHFVTDHDTINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPESGSGPTKVLKTLNRVVEQNVDPSMFITMFYGSYNKETHEFKYAS
FT                   AGHEPGFFYCNKENQFYDLDAKGLVLGIAPDFDYKQYEKHLDVGDMVILFSDGVTESKS
FT                   EDGFLEREDIKALISENLSYSAQEMVDAIYDSLLKLQEFQLHDDFTLLVLKRKV"
FT   gene            508497..508826
FT                   /locus_tag="BPUM_0444"
FT   CDS_pept        508497..508826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0444"
FT                   /product="anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61139"
FT                   /db_xref="GOA:A8FA72"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA72"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019744215.1"
FT                   /protein_id="ABV61139.1"
FT                   /translation="MNMSVKEHQIDQKTKISVSGEIDVYSAPQLRETLMPKAEAGEHLE
FT                   ICLKDVTYMDSTGLGVFVGLFKAAQKAGGTLKLENLSDRLVRLFEITGLKDIIDISAKS
FT                   EGGVQ"
FT   gene            508823..509311
FT                   /locus_tag="BPUM_0445"
FT   CDS_pept        508823..509311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0445"
FT                   /product="serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="binds to sigma-B preventing the formation of an RNA
FT                   polymerase holoenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61140"
FT                   /db_xref="GOA:A8FA73"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FA73"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358392.1"
FT                   /protein_id="ABV61140.1"
FT                   /translation="MNETVDLIEMKIPAKPEYVGIIRLTLSGVASRMGYVYEEIEDLKI
FT                   AVSEACTNAVQHAYKGKDGEDGEVAVRFLVYEDRLEIIVADKGGSFDFKQKQEDLGPYT
FT                   TAHTVDQLAEGGLGLYLMQTLMDEVEVQANSGVTVAMTKFLNRERVDHDTTIQNYETN"
FT   gene            509277..510065
FT                   /locus_tag="BPUM_0446"
FT   CDS_pept        509277..510065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0446"
FT                   /product="RNA polymerase sigma-B factor"
FT                   /note="sigma factors are initiation factors that promote
FT                   the attachment of RNA polymerase to specific initiation
FT                   sites and are then released; sigma B is not essential for
FT                   sporulation; rather it is required for maximal expression
FT                   of ctc and csbA which are transcribed in the early
FT                   stationary phase under conditions inimical to sporulation;
FT                   induced by heat shock, salt stress, oxidative stress,
FT                   glucose limitation, oxygen limitation and entry into
FT                   stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61141"
FT                   /db_xref="GOA:A8FA74"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA74"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359569.1"
FT                   /protein_id="ABV61141.1"
FT                   /translation="MTQPSKTMKLTKDEVDRLIQSYQSNQDEQAQLTLVECYTNLVDML
FT                   AKKYSKGKSFHEDLRQVGMIGLLGAIKRYDPLVGKSFEAFAIPTIIGEIKRFLRDKTWS
FT                   VHVPRRIKELGPRIKMAVDHLTTETQKSPKVQEIAEYLDVTEEEVLETMEMGKSYQALS
FT                   VDQGVEADSEGSTVTILDVVGSQEEGYERVNQKMMLESVLHVLTDREKEIINLTYLQNK
FT                   SQKETGDLLGISQMHVSRLQRKAVKKLRDALSEDASMELG"
FT   gene            510065..510664
FT                   /locus_tag="BPUM_0447"
FT   CDS_pept        510065..510664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0447"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61142"
FT                   /db_xref="GOA:A8FA75"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA75"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358391.1"
FT                   /protein_id="ABV61142.1"
FT                   /translation="MKQIEQHEHVNAIIYQSNKEGKSCCGDSFFIKADDEELICAVADG
FT                   LGSGQFANESSSLVSEIVEEYGHEDMTTLIDRCNQAMKNKRGATVGILKVNFSQQQFTY
FT                   CSVGNIRFILNAPSGDYIYPLPTSGYLSGKPRKYKTYTYSYEKGSTFIMYSDGLNVPNM
FT                   RMCLKHSHSVEDIAKQLETYTQDKKDDLTYVLGQLT"
FT   gene            510741..512900
FT                   /locus_tag="BPUM_0448"
FT   CDS_pept        510741..512900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61143"
FT                   /db_xref="GOA:A8FA76"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA76"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366665.1"
FT                   /protein_id="ABV61143.1"
FT                   /translation="MKTSDFLLKQIATELKLSTKQIESVIKLLEDGNTVPFIARYRKEQ
FT                   TGSLDEVQIQTISERYTYIQNVMNRKEEVIRLIAEQDKLTDELKQKIEQAHKLQEVEDL
FT                   YRPFKQKRKTKANVAKAKGLEPLAEYILTLPSDEIEKKAASFINEDKEVTSVEEALEGA
FT                   QHIIAEQLADDPDMRKWIRSETYQKGSLITSGKDIENDEKNVYEMYYDYQEPIKKIVPH
FT                   RVLAVNRGEKEGILKAAIEPPAENIRFYLDKQVIKGKQTTARPFIEAAIDDAYKRLIQP
FT                   SIEREIRKELTEKAEEQAIHIFAENLRKLLLQPPMKGKRVLGVDPAFRTGCKLAVVDDT
FT                   GKVHHIGVIYPHPPVQKKAEAKQKVKEIIQSSNIEVIAIGNGTASRETEQFIADLIQEL
FT                   DQPVSYLIVNEAGASVYSASALAREEFPDLQVEERSAISIARRLQDPLAELVKIDPKSV
FT                   GVGQYQHDVSQKQLNSSLTFVVETVVNQVGVNVNTASQALLQYVSGLSKAVAGNIIKRR
FT                   EEIGRFTSRKELKDIPRLGAKTYEQCIGFLRIADGQDPLDRTGIHPESYKETKQFLRMI
FT                   KMTPDDLGTEQLKEKIAEVKLDEAAEQLDIGIITLQDIVDQLTRPERDPRDEVPKPLLK
FT                   TDVLKLEDLKQGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLSNRFVKHPLDVVSVG
FT                   DIVTVWVDSVDQAKGRVALSMLKPE"
FT   gene            complement(512921..513055)
FT                   /locus_tag="BPUM_0449"
FT   CDS_pept        complement(512921..513055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61144"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA77"
FT                   /protein_id="ABV61144.1"
FT                   /translation="MPNWLKNQMQKAFFEKNHYQIKLLNQCWYFYRKKHSVASRHTPS"
FT   gene            513155..513628
FT                   /locus_tag="BPUM_0450"
FT   CDS_pept        513155..513628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61145"
FT                   /db_xref="GOA:A8FA78"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA78"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009004.1"
FT                   /protein_id="ABV61145.1"
FT                   /translation="MKESELQQLTEHISEQFFGKTFRHQAVFNDRLKTTGGRYLLGTHN
FT                   IELNRRYLEEHGREELIGIIKHELCHYHLHLEGKGYQHRDRSFKDLLQQVGAPRFCTPL
FT                   KTVQNKRRVQKRQEYVCTGCGQYFIRKRRIDTSRYVCGVCKGKLKWQRTIGSD"
FT   gene            513822..514799
FT                   /locus_tag="BPUM_0451"
FT   CDS_pept        513822..514799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0451"
FT                   /product="acetoin:2,6-dichlorophenolindophenol
FT                   oxidoreductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61146"
FT                   /db_xref="GOA:A8FA79"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA79"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019744217.1"
FT                   /protein_id="ABV61146.1"
FT                   /translation="MEMALTKEKAVWMYQKMQEIRQFEDQVHTLFTKGILPGFVHLYAG
FT                   EEAVAVGVCAHLNEQDSITSTHRGHGHCIAKGCDLKGMMAEIYGKATGLCKGKGGSMHI
FT                   ADFDKGMLGANGIVGGGFPLACGAALTAKYKKTNNVSVCFFGDGANNQGTFHEGINLAA
FT                   IWKLPVIFIAENNGYGEATPFSYASSCKSIVDRAAGYDIPGIQVDGKDVMAVYQAAEQA
FT                   IERAKNGEGPTLIECMTYRNYGHFEGDAQRYKTNQEKTEHQEERDAIALFKNELIKQQL
FT                   LTNGELSNIEAAVADAIDEAVRFSEESEYPDHTELLTDVYVSYQ"
FT   gene            514820..515857
FT                   /locus_tag="BPUM_0452"
FT   CDS_pept        514820..515857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0452"
FT                   /product="pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61147"
FT                   /db_xref="GOA:A8FA80"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA80"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009006.1"
FT                   /protein_id="ABV61147.1"
FT                   /translation="MAREISMSSALNEAIKLAMRRDENVILMGEDVAGGAHVDHLQDDE
FT                   AWGGVLGVTKGIVQEFGRERVLDTPISEAGYVGAAMAAASTGLRPIAELMFNDFIGTCL
FT                   DQVLNQGAKFRYMFGGKAEVPITIRTTHGAGFRAAAQHSQSLYALFTSIPGLKVVVPSS
FT                   PYDAKGLLLAAIEDQDPVIFFEDKTLYNITGDVPERYYTLPLGKADVKREGSDVTIFAV
FT                   GKQVHTALEAAEQLAAQGIEAEVIDPRSLSPLDEEAILTSVEKTNRLVIVDEANPRCGI
FT                   AADISSLVADKGFDLLDAPIKKVTAPHTPVPFSPPLEDIYLPTPDKVVNTVLEMIGKSH
FT                   DKILN"
FT   gene            515875..517014
FT                   /locus_tag="BPUM_0453"
FT   CDS_pept        515875..517014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0453"
FT                   /product="branched-chain alpha-keto acid dehydrogenase
FT                   subunit E2"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61148"
FT                   /db_xref="GOA:A8FA81"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA81"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009007.1"
FT                   /protein_id="ABV61148.1"
FT                   /translation="MAVEVVMPKLGMSMKEGTVSVWNKEVGETVNKGESIASINSEKIE
FT                   MEIESPAEGTILDIKVPEGEGVPPGTVICYIGEGNEQVEEKKEKGLPPKQKKERIKISP
FT                   VARKIAQSANLDIHTLVGTGPDGRITKADVLRALPDEKEKQKQQNEPTKHQPVSMMRKT
FT                   IASRMMESLQTSAQLTITMKADVTKLTNLQQQLNETAIARYETKLTITDFIAKAAILSL
FT                   LEHPAMNSQYHNGVVETFENVHLGIAAALDNGLAVPVIQHAERLTLIELAKSIKLYGKK
FT                   AREGKLLHDEIRGSTFTITNLGAYGVEHFTPILNPPEAGILGIGTMYDTPVYREDELCK
FT                   GTILPLSLTFDHRVLDGAPASAFLSTVKAHLEEPISILL"
FT   gene            517033..518412
FT                   /gene="acoL"
FT                   /locus_tag="BPUM_0454"
FT   CDS_pept        517033..518412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoL"
FT                   /locus_tag="BPUM_0454"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="E3 component of acetoin cleaving system; catalyzes
FT                   the oxidation of dihydrolipoamide to lipoamide"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61149"
FT                   /db_xref="GOA:A8FA82"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA82"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009008.1"
FT                   /protein_id="ABV61149.1"
FT                   /translation="MTLVIIGGGPAGYVAAITAARFGREVVLIDQGQLGGTCLNEGCIP
FT                   TKALLQSADMYEHVKSAVHFGIELPEHEPTIHWHVVQKRKQSVVKQLTDGVRYLMNKNK
FT                   ITVVNGKASFLSAHELFIESEGKSEIIQAKQIIIATGAAPAALPFAPFDGEWIIHSKDA
FT                   MSLSSIPDSLCIIGGGVIGCEFASIYCRMGSKVVMIERALHILPEEDREIAQCLHEQLE
FT                   ETGVDILTAAAVKQLDSTSRRVVVENNQGERCDIQSDLCLVAIGRTPQLEELNLDQIGI
FT                   EFDRNGIYVNEHMQTNLPHIYACGDVTGGIQLAHTAFHEGMVAASHAAGEHIKVNEQVI
FT                   PRCIYTSPEIASVGLNEESARKQYEEIRIGTCAFSANGKALILNQPAGQVKVIVEPQYQ
FT                   EIVGVSIIGPHATELIGQAAVMMHTELTADTLEQFIAAHPTLSEAIHEALLQTIGRAVH
FT                   C"
FT   gene            518521..520368
FT                   /locus_tag="BPUM_0455"
FT   CDS_pept        518521..520368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0455"
FT                   /product="acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61150"
FT                   /db_xref="GOA:A8FA83"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA83"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358384.1"
FT                   /protein_id="ABV61150.1"
FT                   /translation="MNPPPCYLNTWKRFVREGLLDQSRLNKRVAESWHRCKQANVNPYL
FT                   DKGQSLLEKELFSAQKKKYSLFLNAALPYLNKISQQLKESDMLALLIDADGYVLSLAGS
FT                   ERTMVEARRINFMEGSRWTETDVGTNAIGTALVIGEAVTINGTEHFSIASHHWSCSAAP
FT                   IRDADGTIIGVIDISCMTDNKHPFMLGMASTVAYAIERDIQVQQKRREMELITHCLQQV
FT                   EAGKPYVVCNEKKQIVSASRSIRDRFSDWYGMDVERLKDHSFVIRGKQIIRSEQDGKVL
FT                   GISFSFEEAAKNDITVSFAQFPGESGTSKVFQQTLSQMKKAAQTDAHVYIWGETGTGKE
FT                   LAARAIHSASERHKGPFIAVNCGAIPESLLESELFGYVEGAFTGAKRHGAKGKFEQAHK
FT                   GTLFLDEIGEIPYAMQVALLRVIEERAVVPLGGTHEIPLDIRIITATHRNMHELLKEGK
FT                   IREDLYYRLHVYPINIPPLRERKEDIHDLYRYYQKKHHWNAAFPESFFQKLQEYHWPGN
FT                   IRELFNLFEHLRVLFPNGGWIGESQYASVLESIDHKKQKLHLAEYTKTPKELTFRERIQ
FT                   KQTVVDALHKTKGHVSEAARLSGVPRSTFYKWMRKFHLS"
FT   gene            520580..520654
FT                   /locus_tag="BPUM_03885"
FT                   /old_locus_tag="BPUM_t0009"
FT   tRNA            520580..520654
FT                   /locus_tag="BPUM_03885"
FT                   /old_locus_tag="BPUM_t0009"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:520612..520614,aa:Asn,seq:gtt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            520659..520749
FT                   /locus_tag="BPUM_03890"
FT                   /old_locus_tag="BPUM_t0010"
FT   tRNA            520659..520749
FT                   /locus_tag="BPUM_03890"
FT                   /old_locus_tag="BPUM_t0010"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:520693..520695,aa:Ser,seq:gct)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            520759..520830
FT                   /locus_tag="BPUM_03895"
FT                   /old_locus_tag="BPUM_t0011"
FT   tRNA            520759..520830
FT                   /locus_tag="BPUM_03895"
FT                   /old_locus_tag="BPUM_t0011"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:520792..520794,aa:Glu,seq:ttc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            520853..520927
FT                   /locus_tag="BPUM_03900"
FT                   /old_locus_tag="BPUM_t0012"
FT   tRNA            520853..520927
FT                   /locus_tag="BPUM_03900"
FT                   /old_locus_tag="BPUM_t0012"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:520885..520887,aa:Gln,seq:ttg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            520958..521033
FT                   /locus_tag="BPUM_03905"
FT                   /old_locus_tag="BPUM_t0013"
FT   tRNA            520958..521033
FT                   /locus_tag="BPUM_03905"
FT                   /old_locus_tag="BPUM_t0013"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:520991..520993,aa:Lys,seq:ttt)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            521041..521123
FT                   /locus_tag="BPUM_03910"
FT                   /old_locus_tag="BPUM_t0014"
FT   tRNA            521041..521123
FT                   /locus_tag="BPUM_03910"
FT                   /old_locus_tag="BPUM_t0014"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:521075..521077,aa:Leu,seq:tag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            521172..521255
FT                   /locus_tag="BPUM_03915"
FT                   /old_locus_tag="BPUM_t0015"
FT   tRNA            521172..521255
FT                   /locus_tag="BPUM_03915"
FT                   /old_locus_tag="BPUM_t0015"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:521205..521207,aa:Leu,seq:gag)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            521229..521390
FT                   /locus_tag="BPUM_0456"
FT   CDS_pept        521229..521390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61151"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA84"
FT                   /protein_id="ABV61151.1"
FT                   /translation="MEVQVLSAASKKPKVVDLWFFCVFNVIEPLFMTVYDDAKFSGTKN
FT                   IAKIVRKY"
FT   gene            521414..522208
FT                   /locus_tag="BPUM_0457"
FT   CDS_pept        521414..522208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0457"
FT                   /product="2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61152"
FT                   /db_xref="GOA:A8FA85"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA85"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009011.1"
FT                   /protein_id="ABV61152.1"
FT                   /translation="MSIYHKVIGEGFPIVILHGWTLDHQVMLHALEPVFEKQSGWKRIY
FT                   IDLPGMGRSEPHPSIQNSDDMLEAVLRLLDEMIPDEQFIVCGYSYGGYIARGIVHSRRE
FT                   TVRGLLLVAPMTIPVFDKRVLPEKTVLKSDSSLISQLSIEETDEFCSMAVVQGKTEWER
FT                   FRDEIYLPSQQTNHEFINNILQNGYGYTFDISSEFQYPTLIITGRQDNVVGYHDAWRLI
FT                   EDYPRATFAVLDMGGHNLQIEQPDVFNSLVYNWLKRLESENM"
FT   gene            522421..522927
FT                   /locus_tag="BPUM_0458"
FT   CDS_pept        522421..522927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61153"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA86"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009012.1"
FT                   /protein_id="ABV61153.1"
FT                   /translation="MLGLPRGEVFLVPWSAEWGKEFEREKKRIVEVIGQYTVNVHHIGS
FT                   TAVNGLSAKPIIDIAIEIDYFFDGTQCVTALQGLGYSYRGTNVLPERHYFNKGEPRTHQ
FT                   IHMYQTGNRYLLEQLNFRDYLKSNELVRNEYEQLKLNLSSLNKNDKHKYAEGKTNFVQS
FT                   ILERI"
FT   gene            523213..523416
FT                   /locus_tag="BPUM_0459"
FT   CDS_pept        523213..523416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0459"
FT                   /product="cold-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61154"
FT                   /db_xref="GOA:A8FA87"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA87"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346765.1"
FT                   /protein_id="ABV61154.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIEREEGDDVFVHFSAIQGDGFKSLDEGQ
FT                   KVSFDVEQGSRGAQAANVQKIA"
FT   gene            complement(523707..524183)
FT                   /locus_tag="BPUM_0460"
FT   CDS_pept        complement(523707..524183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0460"
FT                   /product="transcription factor YdeB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61155"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA88"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214090.1"
FT                   /protein_id="ABV61155.2"
FT                   /translation="MEADDMFQIGDNIVYPMHGAGIIEAIEEKEFSDEKQQYYVIKMSI
FT                   SHMKVMIPTRKISGSRIRPVTDLLALNNVMHVFQHGESDQLLTWKERHTINTNKIKTGD
FT                   IQDGAEVVRDLMRMKKEKALNASEKKMLDEAHEFLLSELEVIEGITEKQIKSFC"
FT   gene            complement(524409..525458)
FT                   /locus_tag="BPUM_0461"
FT   CDS_pept        complement(524409..525458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0461"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61156"
FT                   /db_xref="GOA:A8FA89"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA89"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358458.1"
FT                   /protein_id="ABV61156.1"
FT                   /translation="MCQTHQSNVLSVSHAKANFERTTIERRALRPHDILIDIQFSGICH
FT                   SDIHSAFDEWGGGIFPMVPGHEITGVVSAVGDDVTKFQIGDRVGVGCFVDSCGTCEYCQ
FT                   NGDEQYCTKGVVQTYNSIDYDGEPTYGGYSQKIVVTERFVVSIPDQLSLDAASPLLCAG
FT                   ITTYSPLKHWKAGPGKKVAIVGMGGLGHVAIQFARALGAEVTVLSRSMNKKEEALSFGA
FT                   KNYFATSDPDTFKTLAGQYDLILNTVSANINVDAYLSLLRVDGTLVNVGAPPNPDQFHV
FT                   FSLISGRRSIAGSLVGGIQETQEMLDFAAAHKIAPQIEVINANQIDEAYERVLKSDVLY
FT                   RFVIDISTL"
FT   gene            525682..526083
FT                   /locus_tag="BPUM_0462"
FT   CDS_pept        525682..526083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0462"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61157"
FT                   /db_xref="GOA:A8FA90"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA90"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009015.1"
FT                   /protein_id="ABV61157.1"
FT                   /translation="MKIAQAAKQLDLSTATLRYYENIGLIRPIRRDENGVRDYAEEDIQ
FT                   WIEFIKCMRNAGLSIDALREYTALFIEGEDHTLSSRKSILVNERERLVEKQKEIEETIK
FT                   RLDYKIESYEDIIHSYEQKLVHQLKTNSI"
FT   gene            complement(526126..526857)
FT                   /locus_tag="BPUM_0463"
FT   CDS_pept        complement(526126..526857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0463"
FT                   /product="beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61158"
FT                   /db_xref="GOA:A8FA91"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008263"
FT                   /db_xref="InterPro:IPR008264"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA91"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358456.1"
FT                   /protein_id="ABV61158.1"
FT                   /translation="MSYRVKRMLMLLVTGIVLSLSTFTAGASAQTGGSFYEPFNNYNTG
FT                   LWQKADGYSNGNMFNCTWRANNVSMTSLGEMRLSLTSPSYNKFDCGENRSTQTYGYGLY
FT                   EVSMKPAKNVGIVSSFFTYTGPTDGTPWDEIDIEFLGKDTTKVQFNYYTNGVGNHEKIV
FT                   NLGFDAANSYHTYAFDWQPNSIKWYVDGQLKHTATTQIPQTPGKIMMNLWNGAGVDEWL
FT                   GSYNGVTPLHAHYNWVRYTKR"
FT   gene            527163..527741
FT                   /locus_tag="BPUM_0464"
FT   CDS_pept        527163..527741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0464"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61159"
FT                   /db_xref="GOA:A8FA92"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA92"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009016.1"
FT                   /protein_id="ABV61159.1"
FT                   /translation="MEKDIGKEIEEVAFSLFQEFGVENVSMHKIAKTAGVGQGTLYRRY
FT                   ANKSDLCLSILGEKFEQLIPALHLYLSKISDQPVRERLRYVLEEIHLIVGQHLDWIRML
FT                   TISGNLEQTSKVYDCHYSQSLRQMIRDLLEEADEKGEASIQDIELTTLCMSSPMTPELM
FT                   FYIHESGYSIEKIAQFAAEKQILSVFNRH"
FT   gene            527814..529253
FT                   /locus_tag="BPUM_0465"
FT   CDS_pept        527814..529253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0465"
FT                   /product="multidrug MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61160"
FT                   /db_xref="GOA:A8FA93"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA93"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009017.1"
FT                   /protein_id="ABV61160.1"
FT                   /translation="MNKQQAANSHIRTLPIIISFITAGFIGLFSETALNMALRSLTLDF
FT                   GIEATTAQWLTTGYLLTLGILVPISGLILQWFTTRQLFMTSLVFSIIGTFIAAVAPVFS
FT                   ILMVARVVQAVGTALLLPLMFNTILVIIPPHKRGRSMGIIGLVIMFAPAVGPTVSGLIL
FT                   KSLTWHWIFWISLPLLIAALVFGFIFMQNITEPTRPKIDILSIVLSTIGFGGIVYGFSS
FT                   AGEGGGWGSMHVIVAIVVGVIGILVFSLRQLNMKEPMLNLSPFKYPMFVIGLLLILVCM
FT                   MVMLSAMMILPLYLQTSLALTTFTAGLMLLPGGIINGLLSPIMGGLFDKFGPKWLVIPG
FT                   LAIVAATMLGFTNLSVNTSIGYIVTLHITLMVGIAMIMMPAQTNGLNQLPPELYPHGTA
FT                   IMNTLQQVSGAIGTAVGISILSSGTRSFMENVADPANPMNQLLAFTNGVQHAFIFAVIM
FT                   TVIGLIIAFFIKRVKVEQQVS"
FT   gene            529448..530341
FT                   /locus_tag="BPUM_0466"
FT   CDS_pept        529448..530341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0466"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61161"
FT                   /db_xref="GOA:A8FA94"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA94"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008346740.1"
FT                   /protein_id="ABV61161.1"
FT                   /translation="MNLQEQIKIAASLRQPAEGSLPSQSELKPVHPPEVNKMEYDIPTS
FT                   AGETKVWVFKPVNTSKQPLPVFVNLHGGGFILGSAEMDNHWCPVIADRAQCIVVNVEYQ
FT                   LAPEHPFPAALHECYDVLKWLYEHPDELQIDPKSIAIGGHSAGGNLATAACLLNIQKGN
FT                   PLPIVYQVLDYPPLDLATDPAQKPAFEEAIPVEMARLFNAFYLQGQDPHNPLVSPIFAD
FT                   RSSLAQLPPALVITAERDSLAQEAEQYAEKLKEAGVDVTYRQFKGVPHAFTHAGDLEIA
FT                   EEAWHLMSDQLKKAFE"
FT   gene            530483..530848
FT                   /locus_tag="BPUM_0467"
FT   CDS_pept        530483..530848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0467"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61162"
FT                   /db_xref="GOA:A8FA95"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA95"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009019.1"
FT                   /protein_id="ABV61162.1"
FT                   /translation="MEKENLQAFCHSLKGVTHDYQPEWQADRYHIGGKMFAMMGGDANR
FT                   KPVITLKCDPQRAEELREMHEGIIPGYYMNKTHWNSIYLDADIPSSFVEELIEHSYQLV
FT                   FRKLTKKSQQDILQQDK"
FT   gene            530953..531714
FT                   /locus_tag="BPUM_0468"
FT   CDS_pept        530953..531714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0468"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61163"
FT                   /db_xref="GOA:A8FA96"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA96"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009020.1"
FT                   /protein_id="ABV61163.1"
FT                   /translation="MGYTVITGASSGIGYEAALAFAARGKNLILAARRLEKLQELKKEI
FT                   LDQYPDIKVNIQSVDLTDMAQVNSFYESLAEYELDTFINNAGFGHFGSIGEQDLSKIGD
FT                   MLHLNIEALTILSTLFVRDYEQVEGAQLINISSRAGYTVVGNAVTYSATKFYVSAFTEG
FT                   LALELKEKGAKLQAKILAPSATESEFAKRSLDVDQFEYEGNIKKYHTSKEMAACLLELY
FT                   DHEKTVGIVDGKTFDFELKDPIFSHAGSSMK"
FT   gene            complement(531864..532232)
FT                   /locus_tag="BPUM_0469"
FT   CDS_pept        complement(531864..532232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61164"
FT                   /db_xref="GOA:A8FA97"
FT                   /db_xref="InterPro:IPR031374"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA97"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_050945641.1"
FT                   /protein_id="ABV61164.1"
FT                   /translation="MQLLQSFHKILITLFLSSILLSLFVCFYPPIQGDPAFLVFYVPIF
FT                   FVCYFVFAVPLQLLFSLQPKAFHPLYLATYLMIAMVVMLFVIDGIGSSTSIPIIIMSSL
FT                   IYWVSDSLLYQRTYEKNT"
FT   gene            532510..533658
FT                   /locus_tag="BPUM_0470"
FT   CDS_pept        532510..533658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0470"
FT                   /product="L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61165"
FT                   /db_xref="GOA:A8FA98"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA98"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214267.1"
FT                   /protein_id="ABV61165.1"
FT                   /translation="MNVTKWLGAVLLSVLLLLTAACANTSTQEKNQNENETASNESKDK
FT                   TTAVETGNKSLSNIKVLATGGTIAGSSDSDTDTTGYKSGALGIDKVIASVPQLKDIANV
FT                   TGEQVANVGSENVDDALLLKLAKRVNKLLNDDQVDGIVITHGTDTLEETAYFLNLVVKS
FT                   DKPVVVVGSMRPASAISADGPLNLYHAVKIASTKAAKGKGVMVTLNDRIASARFITKTN
FT                   TTTTDSFKSLEHGYIGEIAGEVVSFYNEPTRKHTSESEFDVSNIKELPQVDILYGYQND
FT                   QKYMYDAAVKAGAKGIVVAAAGNGTMSTEAIKGATDAVKKDVVVVRSSRAGNGIVTHEK
FT                   MDDEHHFVSSDSLNPQKARILLMLALTKTKDPSKVQTFYEKY"
FT   gene            complement(533692..534591)
FT                   /locus_tag="BPUM_0471"
FT   CDS_pept        complement(533692..534591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0471"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61166"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FA99"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009023.1"
FT                   /protein_id="ABV61166.1"
FT                   /translation="MNSILLQDGRHIGLCEYGDLAGFPIFFFHGTPGSRVTFLEDDPIS
FT                   KELGIRLICLDRPGFGLSTPQPERTILDWAKDVLEVADQLGIHHFSVMGVSGGGAFAAA
FT                   CAYQLPNRVLSAALISSTTPFQDGKPPKSMLKENKLAFFLSKKFPWLLKASYRSQKKMI
FT                   ENKPEKFKKLAKNGNKHLHPWDRQFLQTDEQLEMMMTHLHEATRQSVDECIREPNLLSR
FT                   PWAFDMKDIQIPVDVWHGKEDSMAPFVEIEKMAPHIPNVKTNYIDEAGHFLTDVDDIWR
FT                   DILFSLKTRAKEHHQEHV"
FT   gene            complement(534648..535100)
FT                   /locus_tag="BPUM_0472"
FT   CDS_pept        complement(534648..535100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0472"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61167"
FT                   /db_xref="GOA:A8FAA0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009024.1"
FT                   /protein_id="ABV61167.2"
FT                   /translation="MSLDEEIIHYSKRIIEYSNALGSIYVEEYQRFLKHEYADLSAKQE
FT                   LTLELLRTKTRTINELADYFSISASAASQLVSKLEQLGYVKREINPQNRREIIVDFAQK
FT                   GHDFHKNTEEIQLHLIQKYYAKLPKDDLKTLLSLYEKIYQIAKEAP"
FT   gene            535180..535329
FT                   /locus_tag="BPUM_0473"
FT   CDS_pept        535180..535329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61168"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA1"
FT                   /protein_id="ABV61168.1"
FT                   /translation="MIVSMTFSLYFKKNTFIIKNKPTGRFLFVLMKKSKVEGIVKDDKH
FT                   TKRG"
FT   gene            535304..535909
FT                   /locus_tag="BPUM_0474"
FT   CDS_pept        535304..535909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0474"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61169"
FT                   /db_xref="GOA:A8FAA2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019743354.1"
FT                   /protein_id="ABV61169.1"
FT                   /translation="MTSTQSGAEKSEKTKRKIVTASRDLFAKKGYSETSVRDILEAAEV
FT                   SKGNLYHHFKGKEFLFLHIMEEDHLLMMETWHQEKQTMHQAIDQLAGFAELLSQMGINY
FT                   PLMRASEEFCASAFTSDEVMERLNKIDADFDDVMRDIILEGNEDGSWSIQHVESTVKIL
FT                   LSVFYGLDVLYKNDPIEEKKELQKQAISLIIHGINHHE"
FT   gene            535941..537137
FT                   /locus_tag="BPUM_0475"
FT   CDS_pept        535941..537137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0475"
FT                   /product="multidrug MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61170"
FT                   /db_xref="GOA:A8FAA3"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009027.1"
FT                   /protein_id="ABV61170.1"
FT                   /translation="MQKPIREQKAVLVILLSNIFIAFLGIGLIIPVMPLFMNVMHLTGS
FT                   TMGYLVAAFAVAQLIASPIAGRWVDRYGRKVMIVSGLFLFALSELVFGLGTHVYVLYFA
FT                   RLLGGISAAFIMPAVTAYVADITTVQERSKAMGYVSAAISTGFIIGPGIGGFIAEYGVR
FT                   LPFFFAAGIAFIAVISSMLLLKEPLTKEERAKQMDQVKESTFFKDLKRSIHPSYLIAFI
FT                   IVFVLAFGLSAYETVFSLFTNHKFGFGPKDIAVIITVSSIVAVIIQVLVFGKLVNALGE
FT                   KRVIQLCLIVGAVLAFVSTVVSGFMVVLIVTCVIFLAFDLLRPALTTFLSKIAGNQQGF
FT                   VAGMNSTYTSLGTIFGPALGGILFDQNIHFPFLFAGVVLFLGLGLTLIWKGKAEEPAA"
FT   gene            complement(537372..537788)
FT                   /locus_tag="BPUM_0476"
FT   CDS_pept        complement(537372..537788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61171"
FT                   /db_xref="GOA:A8FAA4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009028.1"
FT                   /protein_id="ABV61171.1"
FT                   /translation="MINEMKNQFMQTSFVSIVWLTLILSLTNQSVTIPFGYVWHIIAIG
FT                   TLAGFVFGVMYPLLWNYLNFPAPVNILISTVVNLAFQLGAVALYSTDLLQLIMPYFIAI
FT                   AFLTLAGHIIAFLFYKKHQNQKMAQALNHLKPQS"
FT   gene            complement(537785..538225)
FT                   /locus_tag="BPUM_0477"
FT   CDS_pept        complement(537785..538225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0477"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61172"
FT                   /db_xref="GOA:A8FAA5"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009029.1"
FT                   /protein_id="ABV61172.1"
FT                   /translation="MKLRFIWNQEKDVTEVDVISHPHNQERLQKIEALLETPPSLTVKD
FT                   PKNDRQSLLPLEQIEAISALGHLSKVVTADGRTYFLNKRLKDLKWLEHELFFRINNAVI
FT                   LNLAQVHSFAAGTYARLEVETLSQNSYTVSRHYAKYIKERFQ"
FT   gene            538388..539173
FT                   /locus_tag="BPUM_0478"
FT   CDS_pept        538388..539173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0478"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61173"
FT                   /db_xref="GOA:A8FAA6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009030.1"
FT                   /protein_id="ABV61173.2"
FT                   /translation="MYLLEKQRTAAIKEGIRQIDLAYPVFVDAVMDGFIQGNLYVDDAM
FT                   HPRIYFLETACGIYYVAGKREEELSHCSAFIVDVYERQKRQNGRFTVFSANQLTDVMMK
FT                   KYLGSHLNEMERHAYIFSEVHSYVPASHSGYRVERTNEQVIKASKAFTPSYYEAYWGRA
FT                   ARFLSKGIGVAILDGEDVVSECVSIFSSEDRVEIDIWKEEACRGKGLAQLAGQHMIRSC
FT                   LENKRTPHWDCDVQHLTSIKLAEKLGFQRTKTYRLFYSS"
FT   gene            complement(539168..539638)
FT                   /locus_tag="BPUM_0479"
FT   CDS_pept        complement(539168..539638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0479"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61174"
FT                   /db_xref="GOA:A8FAA7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009031.1"
FT                   /protein_id="ABV61174.1"
FT                   /translation="MNIRPIEQKDNPYIAAIIRQSLESADLAIEGTAYTDPHLDQLHEY
FT                   YQSLTHAAYWVAEENGDIVGGVGIAPFSNGICELQKLYLSPKAQGKGAGKKLMDTALHY
FT                   ASTYYEACYLETRQELTAATGLYQRYGFSLLSEPIEGSEHSAMDAWYLKTFS"
FT   gene            539691..539960
FT                   /locus_tag="BPUM_0480"
FT   CDS_pept        539691..539960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61175"
FT                   /db_xref="GOA:A8FAA8"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214041.1"
FT                   /protein_id="ABV61175.1"
FT                   /translation="MFWLQTAIFTMVVLCLSWWAGKRGGNRHAGLILPVCFILFGLVLL
FT                   ISSFFIGRWEGMALSISSVSIVLSSMICLIIVAAIQFFKKDVPS"
FT   gene            complement(539957..540496)
FT                   /locus_tag="BPUM_0481"
FT   CDS_pept        complement(539957..540496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0481"
FT                   /product="aminoglycoside adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61176"
FT                   /db_xref="GOA:A8FAA9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAA9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009033.1"
FT                   /protein_id="ABV61176.1"
FT                   /translation="MTRLFLRPIEEQDYPGIQRGCQHAETLYMTGTRKTFTLEEIRSAY
FT                   TRFSQDDSRRDFAICLLDTQEMIGDAAIVDIDPINHTASFRIALHGPEHFQKGYGTEAV
FT                   RMVQAFAFDTLELNRLELEVFSHNPRAFRSYEKAGFQYEGKRRQALYFNGAYSDVIIMG
FT                   ILREEYNQINSGDAPA"
FT   gene            complement(540493..540888)
FT                   /locus_tag="BPUM_0482"
FT   CDS_pept        complement(540493..540888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0482"
FT                   /product="glyoxalase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61177"
FT                   /db_xref="GOA:A8FAB0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214262.1"
FT                   /protein_id="ABV61177.1"
FT                   /translation="MIRRLDHIVLTVQHIEDTIRFYTNVLGMKEETFGEGRKALRFGLQ
FT                   KINLHEAGHEYEQAAAHPLPGSSDLCFITDLDMDSLLLHLRKQVVPIEEGPVKRTGTLG
FT                   PVESVYIRDPDLNLIEISRYIEEGDPS"
FT   gene            complement(540957..541580)
FT                   /locus_tag="BPUM_0483"
FT   CDS_pept        complement(540957..541580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0483"
FT                   /product="histone acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61178"
FT                   /db_xref="GOA:A8FAB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009035.1"
FT                   /protein_id="ABV61178.1"
FT                   /translation="MVHFRLAREDELPQVADLLEDSFRDYSFFDLLCEKVSKRSTFARE
FT                   LHLVNTKVYFQHQICLVGVENGHIVSAALLKHPRFPEPGLMDYVLSGGLKLLFTGGISA
FT                   IQHVFRMLKEAKKACSSLNKPFWYLEALAVAKNQQGKKLGSRMLKQCLFPFIARQGGGL
FT                   FTLITHNEANRHFYRKNGWVEFDERVLRGKEMSLQSWSYKTVIQ"
FT   gene            541730..542281
FT                   /locus_tag="BPUM_0484"
FT   CDS_pept        541730..542281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0484"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61179"
FT                   /db_xref="GOA:A8FAB2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009036.1"
FT                   /protein_id="ABV61179.1"
FT                   /translation="MQDRRTIKTKRAIRESFLELLKEKEVQQITVSELSRKADLGRGTF
FT                   YLHYQDVFDLYEQLEKELFDQLGGLYDETFPSQDPLDMLSFLNKTTEYLKENQYMLTLF
FT                   VKPNGPTTNQFKAFFKEKIMKEWRLVERHITEKEQIEASFVVSGVVGVLEEWIHEDMTI
FT                   DAGKLAHKLYELLVKVEHES"
FT   gene            542371..542913
FT                   /locus_tag="BPUM_0485"
FT   CDS_pept        542371..542913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61180"
FT                   /db_xref="GOA:A8FAB3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009037.1"
FT                   /protein_id="ABV61180.1"
FT                   /translation="MSQQRKLLFYGAMSIDGYLAREDHRLDWLIGTEGEEDTNYDDFYA
FT                   SVDTLIMGRNTYEQVLQLSPDEFPYEGKTCYIMSRTLQDSLKGTHIIREDILSFVRKLK
FT                   NETGQHIWIVGGGELLQSFIKAGLVDELYLQIVPVMIGRGIPLFSPVDMEAKFSLKEVR
FT                   QYKQIAEMHFILKQEDH"
FT   gene            543022..543495
FT                   /locus_tag="BPUM_0486"
FT   CDS_pept        543022..543495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0486"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61181"
FT                   /db_xref="GOA:A8FAB4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009038.1"
FT                   /protein_id="ABV61181.1"
FT                   /translation="MVQHEHELDLRLFRVWMKAYQALFTNIQKDIERYDIGFENFQILE
FT                   LLYSKGPHPVQKISDILSIPSGSMTYVVNKLEKQGLVKRQCAPSDKRVFHVLLTEKGKQ
FT                   LFDDIFPKHTDVISQNLSFIEKEEKEQLIELLKKVGLGAKQLYEKGKQDDTQF"
FT   gene            543479..544102
FT                   /locus_tag="BPUM_0487"
FT   CDS_pept        543479..544102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0487"
FT                   /product="NAD(P)H nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61182"
FT                   /db_xref="GOA:A8FAB5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017358432.1"
FT                   /protein_id="ABV61182.2"
FT                   /translation="MTLSFETLVRERRSASNFLPNISISREELNSIFEEVKMAPSAFNL
FT                   QHTQYVVVQTEGLKEQVREAAFGQYKVHSASAAIIVLGDPKAYQQAGNIYEGLKMLGIL
FT                   NKQQYEEMVRETMSFYEKRGADFQKEEAIRNASLSAMLFMLAAKNKGWDTCPMIGFDPD
FT                   VMKKVLNIESDLVPVLMITLGKEKVESRQARGYRKPVSEFVTYL"
FT   gene            544120..545172
FT                   /locus_tag="BPUM_0488"
FT   CDS_pept        544120..545172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0488"
FT                   /product="luciferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61183"
FT                   /db_xref="GOA:A8FAB6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214049.1"
FT                   /protein_id="ABV61183.1"
FT                   /translation="MELGISTFVETTPDFQTGKTVSHAQRIREVVEEIILADQVGLDVF
FT                   GVGEHHRQDFAASNPAVVLAAAATQTKNIRLTSAVTVLSSADPVRVFQDFATLDGLSNG
FT                   RAEIMAGRGSFIESFPLFGYDLNDYEELFEEKLDLLLKLQQSERVTWSGKHRPAIQDVG
FT                   VYPRPVQDPLPIWIGSGGNRESVVRAGLLGLPLVLAIIGGSPRQFAPLVQLYKQAAAHA
FT                   GHDPEKLTVASHSHGFVAEETDLAADQFFPSTQHVMNTLARERGWGPYTRSTFDAARTL
FT                   EGALYVGDPDAVAEKVIHLRKNVGITRFMLHVPVGSMPHDQVLKAIELFGKEVAPKVRE
FT                   EVARWEAEQA"
FT   gene            complement(545220..545426)
FT                   /locus_tag="BPUM_0489"
FT   CDS_pept        complement(545220..545426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61184"
FT                   /db_xref="GOA:A8FAB7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB7"
FT                   /protein_id="ABV61184.1"
FT                   /translation="MIVLCWIESVLYFYAFFLISFRQTIVNGGDFMKKWLICFQLVFLF
FT                   TLTTTPLASAASCPTVKPCVIDP"
FT   gene            545521..545814
FT                   /locus_tag="BPUM_0490"
FT   CDS_pept        545521..545814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61185"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359791.1"
FT                   /protein_id="ABV61185.2"
FT                   /translation="MKKVMSSVLVGAIVLTGAGVTTAPVEAKEQTKSEITVQASRIVSE
FT                   TRTYTTSNIPSSITYAKDGWVGILKQSSIEELGLGKYRVTFTGTVVRDPGFN"
FT   gene            complement(545856..546410)
FT                   /locus_tag="BPUM_0491"
FT   CDS_pept        complement(545856..546410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0491"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61186"
FT                   /db_xref="GOA:A8FAB9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAB9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009043.1"
FT                   /protein_id="ABV61186.1"
FT                   /translation="MEDVQSIISKNVRLLRDQKKLSLEKMAELTGVSKTMIGQIERGES
FT                   TPTITTLWKIANGLKVSFSELIHAPQPEIKVVRHEDAQILTEDDGRYRVYTTFPFDDRG
FT                   KFEVYRVEIDPGGSLHANEHIGGTEELITVFEGSLDISIGDEQYRLKTGDSIRFKADRT
FT                   HTYKQFGEQMVRLQMILYYPQ"
FT   gene            546522..547109
FT                   /locus_tag="BPUM_0492"
FT   CDS_pept        546522..547109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0492"
FT                   /product="lysine transporter LysE"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61187"
FT                   /db_xref="GOA:A8FAC0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214091.1"
FT                   /protein_id="ABV61187.1"
FT                   /translation="MILSMLIYAFVSSFTPGPNNIMAMVFTNKYGVKQTFRFCLGVGIG
FT                   FLVILCLSCFFNIILYQVMPKIGWVMAFIGAAYMIYLAVKIMKSKGGDDETLDRYNHFV
FT                   PGMMLQFINPKAILYGLTVISTFVLPYGQSNMQYVIWTLILALIGFLGTFSWSLFGSLY
FT                   KRFLTAYERPFQYVMGLLLIYSAVSMVWGYVM"
FT   gene            complement(547114..547665)
FT                   /locus_tag="BPUM_0493"
FT   CDS_pept        complement(547114..547665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0493"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61188"
FT                   /db_xref="GOA:A8FAC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009045.1"
FT                   /protein_id="ABV61188.1"
FT                   /translation="MIIAENIFTVRDLTYRIRSAAIGDAKQLSALRLKIDGETEYLDRE
FT                   PGEAFLHEKDFEVLIQEDTKQSRHLFLVADIEGDIVGFSRCEGHSLKRFAHKVTFGVAI
FT                   RKDVWGYHIGKELLAASIDWADQQGIQKMSLEVLETNQKAIRLYEHHGFLIEGVLKNDK
FT                   RLADGLYYNTVVMGRQRPRF"
FT   gene            complement(547788..548681)
FT                   /locus_tag="BPUM_0494"
FT   CDS_pept        complement(547788..548681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0494"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61189"
FT                   /db_xref="GOA:A8FAC2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009046.1"
FT                   /protein_id="ABV61189.2"
FT                   /translation="MDLRQIRYFIMVAEELNFSRAAERLKMAQPPLSQEIRKLEEQLGV
FT                   TLFHRTRRQVELSDSGRVFLEEARRTLLQVDRTIKATQLADDGKIGHLTIGFVDSTDMV
FT                   IDIIKRFRESFPNIHLVLCEMATEQQLKALHKKEIQIGFIRSNQNNKILTSEICCEESL
FT                   SLVLPENHPLASFPKVPIHLLANEPFIMFPRHLGAAFYDLIISYFWENNISLNVVQEAV
FT                   QMHTIVNLVAAGMGISVVPSSVESVKRSGVVYRKIQETTPRVNLYVSWRHDETSTVAQH
FT                   FLTVVREAYLSSQSKS"
FT   gene            548831..549619
FT                   /locus_tag="BPUM_0495"
FT   CDS_pept        548831..549619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0495"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61190"
FT                   /db_xref="GOA:A8FAC3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009047.1"
FT                   /protein_id="ABV61190.1"
FT                   /translation="MKYSKLGNSGLTISKLAYGNWINHGGKINEETAHDCVKAALDVGI
FT                   TTFDTADVYSDTKAEEILGRSLKGIRRESIELCTKVCHPTGTGKNDRGLSRKHIMENCH
FT                   ASLQRLQTDYIDIYYAHRFDPTTPLEETMLAFADLVRQGKVNYIGVSEWTAEQITRGAV
FT                   LARELNVPLIASQPQYSMLWRIIESDVIPTCQREGLGQVVWSPLAQGILTGKYLPGKSL
FT                   PTNSRANSTAGKPFFKNLAQRWMNNNTLEAIQKLKLVASE"
FT   gene            549782..549967
FT                   /locus_tag="BPUM_0496"
FT   CDS_pept        549782..549967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0496"
FT                   /product="stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61191"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009048.1"
FT                   /protein_id="ABV61191.1"
FT                   /translation="MSEEKGHMDKAKGKTNQAKGQLKEKLGEATDHQKLKSEGKKDQAK
FT                   GKLQDKKGDLKNHLNE"
FT   gene            550116..550778
FT                   /locus_tag="BPUM_0497"
FT   CDS_pept        550116..550778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0497"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61192"
FT                   /db_xref="GOA:A8FAC5"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214446.1"
FT                   /protein_id="ABV61192.1"
FT                   /translation="MKQVWEKVDEYITDKLIPKDDVLEQALTHNKQAGLPEIDVSPAQG
FT                   KMLYLLAKTKNAKRILEIGTLGGYSTIWLARALEEDGELITLEAVSHHVQIAQQNISRA
FT                   GLSERVSILQGKALDTLPQLKERDVLPFDLIFIDADKPNNPKYLKWALYFSKKGTVIIA
FT                   DNVVRNGAVLHDFDEDERVQGTREFFNLLKQESRIEATAIQTVGEKGYDGFVYGIVK"
FT   gene            complement(550815..551135)
FT                   /locus_tag="BPUM_0498"
FT   CDS_pept        complement(550815..551135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0498"
FT                   /product="branched-chain amino acid transporter AzlD"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61193"
FT                   /db_xref="GOA:A8FAC6"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008359806.1"
FT                   /protein_id="ABV61193.1"
FT                   /translation="MISSFMMWLILGCMIVTVIPRVVPFIFVRSIELPEVVLKWLSFIP
FT                   ICIFTALIAEHLFIHTTTGVTIHWMYLAVLVPTVVIAVWTKSLSLTVLVGVMLMGTARW
FT                   FF"
FT   gene            complement(551132..551857)
FT                   /locus_tag="BPUM_0499"
FT   CDS_pept        complement(551132..551857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0499"
FT                   /product="branched-chain amino acid ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61194"
FT                   /db_xref="GOA:A8FAC7"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009050.1"
FT                   /protein_id="ABV61194.1"
FT                   /translation="MDIEARKHIPRTEHEPFLEGIKDCVPTLLGYMSIGFAFGIVGISA
FT                   QLSLWDIALLAIFIYAGASQFIICALLVTGSPLSAIILTTFIVNLRHLLLSLTLAPHFT
FT                   RYSLKQNIGFGLLLTDESFGVAMNKLAQHGKLNNRWMHGLNITAYLCWIAACVLGGIFG
FT                   HWISNPEALGLDFALSAMFAALLVLSLQTVPKSKLTHRLSLVLYMVVAMFVLLHFVPSH
FT                   VAVLLATMIVATIGVVTDK"
FT   gene            552152..553027
FT                   /locus_tag="BPUM_0500"
FT   CDS_pept        552152..553027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61195"
FT                   /db_xref="GOA:A8FAC8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009051.1"
FT                   /protein_id="ABV61195.1"
FT                   /translation="MNEKYIGALYLAIAASIWGGMYVVVKVTVAVVPPLELVWMRYAIA
FT                   GIVLVFTIWRLGYSFQLDKKDIPLMVLIGLIGNFLSIVTQEIGTMYTSAQMGAVITSAT
FT                   PAFMVLFAFFLLKEAMTVRKCASILLATAGVWLMIGPVAVQTDEFVGGLSLVFAALTWA
FT                   LMSVLLKRVPGKYPQVVTTTYAIIIAFIVLTPPVLFRLPHLDVEQMARPEIWGGILYLG
FT                   IISTALAFFLWNRGLQLMDASSGGLFFFFQPIVGAILGWLLLGEEMGLRSFIGILCIFA
FT                   GVYTVLRQKE"
FT   gene            complement(553271..554521)
FT                   /locus_tag="BPUM_0501"
FT   CDS_pept        complement(553271..554521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0501"
FT                   /product="glutamate:protein symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61196"
FT                   /db_xref="GOA:A8FAC9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAC9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009052.1"
FT                   /protein_id="ABV61196.1"
FT                   /translation="MKKFVAFQIMIALVIGALIGHFFPDFGMALRPIGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGGMKKMGSLGLKTIIWFEVITTIVLGIGLLLANVLKPGVGLDFS
FT                   KLAKKDIGELDGYTQKVVNFKQMVLDIIPTNIVDVMAQNDLLAVIFFAILFGVAASGIG
FT                   KASAPVLTFFESVAQIMFKLTQMVMVTAPIGVLALMAASVGQYGIVLLIPMMKLVGTVF
FT                   LGLFIILFALFPLVALIFRFNYFEVLKMIWDLFLVAFSTTSTETVLPQLMSRMEKYGCP
FT                   KRIVSFVIPSGLSLNCDGSSLYLSVSCVFLAQAFGVDMSLSQQLLMMLVLVLTSKGIAA
FT                   VPSGSLVVLLATAHAVGLPAEGVAIIAGVDRIMDMARTGVNVPGHAVACIVVSKWEKVF
FT                   RESAWEVPKAGEETKGM"
FT   gene            554586..554756
FT                   /locus_tag="BPUM_0502"
FT   CDS_pept        554586..554756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61197"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAD0"
FT                   /protein_id="ABV61197.1"
FT                   /translation="MTMFCPLLDLERFYLRIIRIMKEEKKIGLSHLYLSKKKQLLKKHE
FT                   TFLEKCIDPFV"
FT   gene            554891..554967
FT                   /locus_tag="BPUM_03920"
FT                   /old_locus_tag="BPUM_t0016"
FT   tRNA            554891..554967
FT                   /locus_tag="BPUM_03920"
FT                   /old_locus_tag="BPUM_t0016"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:554925..554927,aa:Arg,seq:acg)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            554979..555052
FT                   /locus_tag="BPUM_03925"
FT                   /old_locus_tag="BPUM_t0017"
FT   tRNA            554979..555052
FT                   /locus_tag="BPUM_03925"
FT                   /old_locus_tag="BPUM_t0017"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:555011..555013,aa:Gly,seq:tcc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            555237..556786
FT                   /locus_tag="BPUM_03930"
FT                   /old_locus_tag="BPUM_r0013"
FT   rRNA            555237..556786
FT                   /locus_tag="BPUM_03930"
FT                   /old_locus_tag="BPUM_r0013"
FT                   /product="16S ribosomal RNA"
FT   gene            556963..559897
FT                   /locus_tag="BPUM_03935"
FT                   /old_locus_tag="BPUM_r0014"
FT   rRNA            556963..559897
FT                   /locus_tag="BPUM_03935"
FT                   /old_locus_tag="BPUM_r0014"
FT                   /product="23S ribosomal RNA"
FT   gene            559957..560072
FT                   /locus_tag="BPUM_03940"
FT                   /old_locus_tag="BPUM_r0015"
FT   rRNA            559957..560072
FT                   /locus_tag="BPUM_03940"
FT                   /old_locus_tag="BPUM_r0015"
FT                   /product="5S ribosomal RNA"
FT   gene            560095..560171
FT                   /locus_tag="BPUM_03945"
FT                   /old_locus_tag="BPUM_t0021"
FT   tRNA            560095..560171
FT                   /locus_tag="BPUM_03945"
FT                   /old_locus_tag="BPUM_t0021"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:560129..560131,aa:Met,seq:cat)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            560176..560252
FT                   /locus_tag="BPUM_03950"
FT                   /old_locus_tag="BPUM_t0022"
FT   tRNA            560176..560252
FT                   /locus_tag="BPUM_03950"
FT                   /old_locus_tag="BPUM_t0022"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:560210..560212,aa:Asp,seq:gtc)"
FT                   /inference="COORDINATES:profile:tRNAscan-SE:1.23"
FT   gene            560529..561506
FT                   /locus_tag="BPUM_0521"
FT   CDS_pept        560529..561506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0521"
FT                   /product="thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61216"
FT                   /db_xref="GOA:A8FAE9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAE9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009069.1"
FT                   /protein_id="ABV61216.1"
FT                   /translation="MDEFDLIRRITPTETHQRSLVMGIGDDASVYQPHSHCEEVVCVDT
FT                   MVEHVHFRFDFSTPFEIGFKALAVNVSDIAAMGGTPKYYLVSIAIPPHGDETVVSALYE
FT                   GMKALADTYQMDLIGGDTVATHSDFIITVTVIGEVSKGKACYRHSAQTGDIVFVTGELG
FT                   SSAAGLSLLMNELDSPKAVDTAFFLERHKKPQPHIAAGLICSSYSRVSLNDVSDGLASE
FT                   LNEIAEASHVTIEIDANKLPIHPDLPVLRKDWLEWVLFGGEDFVLTGTIPQADWDSFEM
FT                   QCRKKDIQVKRIGQVKGDQAASVLLKDNEQQTMLMKKGYNHFKK"
FT   gene            561529..561996
FT                   /locus_tag="BPUM_0522"
FT   CDS_pept        561529..561996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0522"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein TsaE"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61217"
FT                   /db_xref="GOA:A8FAF0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009070.1"
FT                   /protein_id="ABV61217.1"
FT                   /translation="MWTTKGADETKRIAAALAKLVMPSDVLTLEGDLGAGKTTFSKGFA
FT                   EGLGITRIVNSPTFTIIKEYTDGRLPLYHMDVYRMEDAEEDIGLEEYFEGEGVCLVEWA
FT                   HLIGPQLPSSYLKIEMLRTEREEERHLTFSAKGERYETLCKEMKEFDHTGN"
FT   gene            561977..562666
FT                   /locus_tag="BPUM_0523"
FT   CDS_pept        561977..562666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0523"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein TsaB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61218"
FT                   /db_xref="GOA:A8FAF1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019743792.1"
FT                   /protein_id="ABV61218.1"
FT                   /translation="MTILAIDTSNHTLGIALVKDSIVIGESITYLKKNHSVRAMPTVEA
FT                   LMKECGVAPSELSKIVVAKGPGSYTGVRIGVTIAKTLAWTLSIPISAVSSLETLAANGQ
FT                   YFDGWISPLFDARRGQVYTGLYMFEDGKIQEIKQDQNILLTDWLHELKKTGKPVLFLGQ
FT                   DVHLHEESIRSILGETAVIAEGAFHNPRPSMLAFLGTDRPAEDVHQLVPNYIRMAEAEV
FT                   KWLEGQK"
FT   gene            562692..563120
FT                   /locus_tag="BPUM_0524"
FT   CDS_pept        562692..563120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0524"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61219"
FT                   /db_xref="GOA:A8FAF2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214231.1"
FT                   /protein_id="ABV61219.2"
FT                   /translation="MTVADIPEVYTIEVHSFTAPWKKESFVYEILHNQYSHYFLIEEDE
FT                   QPVGYCGVWIVMDDAQITNIAILPEHRGKGYGEALLRYVMEFCKEKKTDHLSLEVRVSN
FT                   TPAQSLYEKLGFRPASIRKNYYTDNGEDALVMWVNINE"
FT   gene            563113..564141
FT                   /locus_tag="BPUM_0525"
FT   CDS_pept        563113..564141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0525"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein TsaB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61220"
FT                   /db_xref="GOA:A8FAF3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214279.1"
FT                   /protein_id="ABV61220.1"
FT                   /translation="MSEQTDRFILGIETSCDETAASIVKNGKEIVANVVASQIESHKRF
FT                   GGVVPEIASRHHVEQVTIVLEEVMTQANMSFQDLDAIAVTEGPGLVGALLIGVNAAKAL
FT                   SFAHQIPLVGVHHIAGHIYANQLVDELQFPCLALVVSGGHTELVLMKEHGSFEVIGETL
FT                   DDAAGEAYDKVARTMGLPYPGGPHIDRLAHEGEPTIKLPRAWLEEGSYHFSFSGLKSAV
FT                   INTLHNASQKDEIIAPENLAASFQASVIEVLVGKTLKAAEAYGVKQVVLAGGVAANKGL
FT                   REALTTAFTKLPDVKVIVPPLSLCTDNAAMIAAAGTIAFERGIRGDMAMNGQPGLPLVS
FT                   YE"
FT   gene            complement(564413..566335)
FT                   /locus_tag="BPUM_0526"
FT   CDS_pept        complement(564413..566335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0526"
FT                   /product="multidrug ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61221"
FT                   /db_xref="GOA:A8FAF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009074.1"
FT                   /protein_id="ABV61221.1"
FT                   /translation="MMILQVNQLSKSFGADTVLTNIKLEVKARDRIAIVGRNGAGKSTL
FT                   LKIIAGQLSYEQGEIIKPKDLSIGYLAQHTDVTSTRTLKDELLSVFDHLKKMEQEMRTI
FT                   EEKMASSTGAELDSLMKTYDRLQQEFKDQGGYQYEADVRSILHGLGFSHFENETTVQSL
FT                   SGGQKTRLALGKLLLMKPQLLILDEPTNHLDIDTLSWLEQYLQNYTGAILIVSHDRYFL
FT                   DKVVNHVYEVSRTAMKKFAGNYSKYLDLKAEQLERDMKLYEKQQEEISKLQDFVDRNLA
FT                   RASTTKRAQSRRKQLERMDRLDKPLGDEKSANFHFDITRQSGNDVLKVHDLDIRYDEKI
FT                   PLLSSLSFQIKREDSVALIGPNGIGKSTLLKTLTNTLKPAKGDITFGSHVTIGYYDQEQ
FT                   AKLTSSKKVLNELWDDYPHMNEKDIRTCLGNFLFSGDDVLKPVHALSGGEKARLALAKL
FT                   MLQKANFLILDEPTNHLDLDSKEILENALIDYPGTILFVSHDRYFINRLATKVFELSPT
FT                   ETREYLGDYDYYLEKKDEQLELEAIQENEALKKQAAKPVETAKLSYAEEKELKKKERQK
FT                   QRRIEEIEERIAIIEAKLGDNEELLCDPAIFQDHEKVQNIQIENDTFHQELESLFAEWE
FT                   ELSES"
FT   gene            566475..566966
FT                   /locus_tag="BPUM_0527"
FT   CDS_pept        566475..566966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0527"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61222"
FT                   /db_xref="GOA:A8FAF5"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAF5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214058.1"
FT                   /protein_id="ABV61222.1"
FT                   /translation="MSQFSHFNEQGRAKMVDISDKSSTMRTAVAASSVRMIKEVFHKIE
FT                   QREIGKGDVLSVAQVAGIMAAKQTSTIIPMCHPLALKGVDISFDWEEDGNAHILNIQVQ
FT                   VKTKGSTGVEMEALTSASVCALTVYDMCKAIDKGMIIGPTYLIEKTGGKNGDFHRASDI
FT                   "
FT   gene            566982..567635
FT                   /locus_tag="BPUM_0528"
FT   CDS_pept        566982..567635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0528"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /note="modulates transcription in response to the
FT                   NADH/NAD(+) redox state"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61223"
FT                   /db_xref="GOA:A8FAF6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAF6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8FAF6.1"
FT                   /protein_id="ABV61223.1"
FT                   /translation="MNIDQSKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKV
FT                   DSATIRRDFSYFGALGKKGYGYNVDYLLTFFRKTLDQDEMTNVMLIGVGNLGTAFLHYN
FT                   FIKNNNTKISMAFDVNESKIGSEIGGVPVYDLDKLEEHVQEVGDIPVAILTVPAVAAQP
FT                   ITDRLIALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYSITQED"
FT   gene            567663..567842
FT                   /locus_tag="BPUM_0529"
FT   CDS_pept        567663..567842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0529"
FT                   /product="preprotein translocase subunit TatA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61224"
FT                   /db_xref="GOA:A8FAF7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008344374.1"
FT                   /protein_id="ABV61224.1"
FT                   /translation="MGPIGPGSLVLIAIVALIIFGPKKLPQLGRAAGDTLREFKNATKG
FT                   LADDQEENKKKEDQ"
FT   gene            567858..568613
FT                   /locus_tag="BPUM_0530"
FT   CDS_pept        567858..568613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0530"
FT                   /product="preprotein translocase subunit TatC"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61225"
FT                   /db_xref="GOA:A8FAF8"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009078.1"
FT                   /protein_id="ABV61225.2"
FT                   /translation="MNVKDMPLMEHIVELRKRLVVIAMFFVAFMVAGFFLAKPVIVYLQ
FT                   NTDEAATLTLNAFKLTDPLYVFMQFAFVIALVLTCPVILYQLWAFVSPGLYDKERKVTL
FT                   AYIPIALLLFLSGVAFSYFILFPFVVDFMIRMSNDLNVEQVIGIHEYFTFLMQLTLPFG
FT                   FLFQMPVVLMFLTRLGIITPMFLSKIRKYAYFVLLVIAALITPPEIVSHLMVTLPMLVL
FT                   YEVSIVISRVTYRKMQQTETGEKENDDVS"
FT   gene            complement(568652..569278)
FT                   /locus_tag="BPUM_0531"
FT   CDS_pept        complement(568652..569278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0531"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61226"
FT                   /db_xref="GOA:A8FAF9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAF9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009079.1"
FT                   /protein_id="ABV61226.1"
FT                   /translation="MEQEKLNILNEQHETIGVAARSDIHAHGLWHETFHFWLLKKEHDI
FT                   MYLYFQLRSPVKKDFPFLFDITAAGHLLANEQPFDGVREVEEELGLTVPFEDLAFAGVI
FT                   QDEIHLPNFTDREFCHVYLYVHPEEQMNIQLQKEEVAGLYRAKLMDAQQLFTRKIDNMQ
FT                   LEGFEIDEAGERRKESKIVCVQDFVPHEPAYYEHLFQAINQFLSK"
FT   gene            complement(569335..569529)
FT                   /locus_tag="BPUM_0532"
FT   CDS_pept        complement(569335..569529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61227"
FT                   /db_xref="GOA:A8FAG0"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008355695.1"
FT                   /protein_id="ABV61227.1"
FT                   /translation="MRNPVIWGIIYFAVGVAFTYMAIQNPGDMWSFYNILLMVFAAYNI
FT                   NIALKMFAFSVKLKKQQQK"
FT   gene            complement(569526..570260)
FT                   /locus_tag="BPUM_0533"
FT   CDS_pept        complement(569526..570260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0533"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61228"
FT                   /db_xref="GOA:A8FAG1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214447.1"
FT                   /protein_id="ABV61228.1"
FT                   /translation="MKKQYWYIILTYILVQLSAIPYVFIMKWLGYIQTPMTQAELSNLS
FT                   GTWTIISFCVGLIIILLILRTVPKASLRNEAPASVGAAIVWIIVGFFLSLFAQSIAGAI
FT                   EQYAFGIGRESENTQNILSIMDAVPWLVIVIALIGPILEEIIFRKIIFGVVYEKTNFFI
FT                   GALVSSVVFAAVHNDFPHILLYTAMGFTFAFLYAKTKRIIVPIGAHMLMNSLVILVQIE
FT                   PVRKMIEEQSQTMQMIIGGFFS"
FT   gene            570491..570775
FT                   /locus_tag="BPUM_0534"
FT   CDS_pept        570491..570775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61229"
FT                   /db_xref="GOA:A8FAG2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAG2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496016.1"
FT                   /protein_id="ABV61229.1"
FT                   /translation="MLKPLGDRVIIELVESEEKTASGIVLPDSAKEKPQEGKIVAAGSG
FT                   RVLESGERVALEVNTGDRIIFSKYAGTEVKYEGKEYLILRESDILAVIG"
FT   gene            570831..572465
FT                   /gene="groEL"
FT                   /locus_tag="BPUM_0535"
FT   CDS_pept        570831..572465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BPUM_0535"
FT                   /product="molecular chaperone GroEL"
FT                   /note="60 kDa chaperone family; promotes refolding of
FT                   misfolded polypeptides especially under stressful
FT                   conditions; forms two stacked rings of heptamers to form a
FT                   barrel-shaped 14mer; ends can be capped by GroES; misfolded
FT                   proteins enter the barrel where they are refolded when
FT                   GroES binds; many bacteria have multiple copies of the
FT                   groEL gene which are active under different environmental
FT                   conditions; the B.japonicum protein in this cluster is
FT                   expressed constitutively; in Rhodobacter, Corynebacterium
FT                   and Rhizobium this protein is essential for growth"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61230"
FT                   /db_xref="GOA:A8FAG3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAG3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020861279.1"
FT                   /protein_id="ABV61230.1"
FT                   /translation="MAKDIKFSEEARRAMLRGVDALADAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPVGVRKGIEEAVKVALEGLHEISKPIEGKESIAQVASISAADEEVGSLIAEA
FT                   MERVGNDGVITIEESKGFTTELEVVEGMQFDRGYASPYMVTDSDKMEAVLENPYILITD
FT                   KKITNIQEILPVLEQVVQQGKPLLLIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDISVLTGGELITEDLGLDLKSTEIGQLGRASKVVVTKENTTIVEGSGDSAQI
FT                   AARVNQIRAQVEETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVSGGGTALVNVYKKVASIEADGDVQTGVNIVLRSLEEPIRQIAHNAGLE
FT                   GSVIVERLKNEEIGVGFNAATNEWVNMIEKGIVDPTKVTRSALQNAASVAAMLLTTEAV
FT                   VADKPEEGGSGGGMPDMGGMGGMGGMM"
FT   gene            573006..573422
FT                   /locus_tag="BPUM_0536"
FT   CDS_pept        573006..573422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35534"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2X9M8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008355699.1"
FT                   /protein_id="ALS35534.1"
FT                   /translation="MDQNLLQMNQVRSEDELAVVNISSTEIGALSKEAAERILQTKDTD
FT                   HIHQIMYVPIEKKADLHWLIQRIGQALEVEDNDIVALELADLLYFFVIPFYKEYILMER
FT                   HLYECIDDLLARLASWAHSDIHTLVDAMRDDLFV"
FT   gene            complement(573468..573935)
FT                   /locus_tag="BPUM_0537"
FT   CDS_pept        complement(573468..573935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61231"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009083.1"
FT                   /protein_id="ABV61231.1"
FT                   /translation="MKKSLLVFMSLVAILSILAACSNTTKEQKPETKALPTINERIQKE
FT                   TKEVMEQSKLIKDTDITVDQKKKIISLNVTASSDTNSDYAEVIGLNFAKTLAIGASTEK
FT                   ENNLHKPENDSLGALYSFYDLNITVKQENGKVLAKGTKKTNETKITWERAQ"
FT   gene            complement(574060..574734)
FT                   /locus_tag="BPUM_0538"
FT   CDS_pept        complement(574060..574734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61232"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359849.1"
FT                   /protein_id="ABV61232.1"
FT                   /translation="MKKWFIVLSVSLTFVLMLSSIPASAASPRHGAIVTQTDEAKWSGI
FT                   SADIVLPKTATIKNGYADWYLGLGSAVIESGISKTASGYKVFLGSGSQGGSKYWNSEYD
FT                   SSIKDGARVNLKLINNGDGTVSLYVNGTLRYKQPIYKPSRLKNLDVVKMVHGVQDNGTN
FT                   SYSQASFSNVQLRANTSGSVYKKWDGSIKSSLLRKNLESGAAAPKFTVISSVPLSTSLS
FT                   AQ"
FT   gene            574945..575313
FT                   /locus_tag="BPUM_0539"
FT   CDS_pept        574945..575313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61233"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008344356.1"
FT                   /protein_id="ABV61233.1"
FT                   /translation="MNKKLIATIVTVASLFLAFSFSHGASAKKVSGNITWYNGVGKKGA
FT                   DGKKLGHWDAATKMGFDVPKKGTKLRVTTKAKPHKVITVYKYDVGRMPNAVLDVSPKAF
FT                   KALGYKTSKGVVKGHYTY"
FT   gene            575387..576436
FT                   /locus_tag="BPUM_0540"
FT   CDS_pept        575387..576436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61234"
FT                   /db_xref="GOA:A8FAG7"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019743780.1"
FT                   /protein_id="ABV61234.1"
FT                   /translation="MKKSTWWIITVIGVAVIAAVIFFLMKPGQEAKHAGKVKTNQDAKD
FT                   ELLVSFTDQQLNNTYYLHDRALHTEKLTAYPSIAYDSTKQLLYYTYTDEDTQKVSIREL
FT                   NVKKDEEKTLFTSHDSIDSMRLSGDGKQLYLRYNKDSGEQFYVAMFDVNTHKVKVLYPE
FT                   KSKDDTVSSFAYDPASNHLAIQHYSLKEDYKKTDEANEKGRDPEPTTMKITLQTGAKGK
FT                   QIARISQTINDISFSPDHKTLIYTEVKVRKEKEVSTIKMLDVETGKTTTLVKNSKDVHI
FT                   LSAAQPQFSTDGSSVYFLGVAKNAKELKDDTGRKAKVRTIFEYNIKKKTVDAAWEKDGG
FT                   IVNNFTVNR"
FT   gene            complement(576652..577026)
FT                   /locus_tag="BPUM_0541"
FT   CDS_pept        complement(576652..577026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0541"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61235"
FT                   /db_xref="GOA:A8FAG8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009086.1"
FT                   /protein_id="ABV61235.1"
FT                   /translation="MNEEKETCQITQETTAGNIEELSIQKNESIRSNIEQLTIELGEQK
FT                   EFNHFILDEKQKAIITLSALITKGDSDEELKTHFEQALHIGLSVIEIMEIIKHCTKVAG
FT                   FPHSINALFIFQNLLDHNTK"
FT   gene            complement(577314..578843)
FT                   /locus_tag="BPUM_0542"
FT   CDS_pept        complement(577314..578843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0542"
FT                   /product="copper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61236"
FT                   /db_xref="GOA:A8FAG9"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAG9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009087.1"
FT                   /protein_id="ABV61236.1"
FT                   /translation="MNLEKFVDELPIPEVAEPVKKNPRQTYYEIAMEEVFLKVHRDLPP
FT                   TKLWTYNGSLPGPTIHANRNEKVKVKWMNKLPLKHFLPVDHTIHEGHHDEPEVKTVVHL
FT                   HGGVTPASSDGYPEAWFSRDFEATGPFFEREVYEYPNHQQACTLWYHDHAMALTRLNVY
FT                   AGLAGFYLISDAFEKSLELPKDEYDIPLMIMDRTFQEDGALFYPSRPNNTPEDSDLPDP
FT                   SIVPFFCGETILVNGKVWPYLEVEPRKYRFRILNASNTRTYELHLDNDATILQIGSDGG
FT                   FLPRPVHHQSFTIAPAERFDVIIDFSAYENKTITLKNKAGCGQEVNPETDANIMQFKVT
FT                   RPLKGRAPKTLRPIFKPLPPLRPSRADQERTLTLTGTQDKYGRPILLLDNHFWNDPVTE
FT                   NPRLGSVEVWSIVNPTRGTHPIHLHLVQFRVIDRRPFDTEVYQSTGDIVYTGPNEAPPL
FT                   HEQGYKDTIQAHAGEVIRIIARFVPYSGRYVWHCHILEHEDYDMMRPMDII"
FT   gene            complement(578943..580331)
FT                   /locus_tag="BPUM_0543"
FT   CDS_pept        complement(578943..580331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0543"
FT                   /product="GABA permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61237"
FT                   /db_xref="GOA:A8FAH0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214237.1"
FT                   /protein_id="ABV61237.2"
FT                   /translation="MSNMTNGLQKNLKTRHISMISIAGVIGAGLFVGSGAVIHSAGPGS
FT                   ILSYSFAGLLVIFIMRMLGEMACAYPTSGSFSQYASDAIGPWAGFTIGWLYWFFWVIVI
FT                   AIEAIAGAAIIQYWYGDAPVWLTSLILTILLTLTNIFSVKSFGEFEYWFSLIKVVSIIL
FT                   FLLIGFAFIFGFGGHHTVGLANLTGNGGFLPNGFSSVLLGIVVVIFSFMGTEIVAIAAG
FT                   ESADPVKSVTTATRSVVWRIIVFYVGSIAVVVTLLPWNSASILTSPFVAVLEYIGVPSA
FT                   AQVMNVIVLTAVLSCLNSGLYTTSRMLYSLAERGEAPKRFMKISKRGVPVAATVAGTFF
FT                   SYIAVMMNYFYPETIFLFLVNASGAIALLVYLVIAVSQLRMRRKIEKENPEQLKIKMWL
FT                   FPYLTYFTILVICAILISMLFIESMRPQLILTSIITFSVLAAYFIFKPNKKAPANATLE
FT                   NKHP"
FT   gene            580814..581713
FT                   /locus_tag="BPUM_0544"
FT   CDS_pept        580814..581713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0544"
FT                   /product="transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61238"
FT                   /db_xref="GOA:A8FAH1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214299.1"
FT                   /protein_id="ABV61238.1"
FT                   /translation="MERYNELRQGETGAWVSIIAYVILSAVKLLIGYTFHSEALSADGL
FT                   NNTTDIIASLAVLIGLRISQKPPDEDHPYGHFRAENIASLVASFIMMLVGLQVLLSAGQ
FT                   SLFSSEHQTPDMIAAWTAAGSAVVMYGVYIYNRNLSKRINSQALHAAAADNKSDAYVSI
FT                   GTFVGIIASQFQLAWIDTLAAFVIGLIICKTAWEIFRDASHSLTDGFHIKDMSKYKETI
FT                   EATPGVGDLKDIKARYLGSTIHVDVVVEVEPHLNIAESHDIADEIERRMKKEHDILHSH
FT                   VHMEPAGEPKEEKKSFPS"
FT   gene            581815..582777
FT                   /locus_tag="BPUM_0545"
FT   CDS_pept        581815..582777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0545"
FT                   /product="AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61239"
FT                   /db_xref="GOA:A8FAH2"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366721.1"
FT                   /protein_id="ABV61239.1"
FT                   /translation="MAFDEPMHSDLQKIVDNINKVMVGKKDIAILSLVAILAKGHVLLE
FT                   DVPGVGKTMMVRALAKSIGCEFKRIQFTPDLLPSDVTGVSIYNKKTNEFEFRQGPIMGQ
FT                   IILADEINRTSPKTQSALLEAMEEGSVTVDGETMLLADPFFVMATQNPVEYEGTYPLPE
FT                   AQMDRFLFKLQMGYPTMLEELEVLNLQEKQSPIDTLQAVMTKDHLHALQQAVQTIHVDA
FT                   SIKEYIVEIAQATRQHPSVYLGVSPRGSIALMKAAQAYALLNRRDYVIPDDVQYLVSYT
FT                   LPHRMILTSEATYEGKKAETLLRQMLEQIGVPVQKSMTQ"
FT   gene            582774..583964
FT                   /locus_tag="BPUM_0546"
FT   CDS_pept        582774..583964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61240"
FT                   /db_xref="GOA:A8FAH3"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003213890.1"
FT                   /protein_id="ABV61240.1"
FT                   /translation="MKLGHRFAFSLWLRVMMLIILTAAVFCYAMFQGGFVSWFLFYAFL
FT                   PYALYALLFALVPLRVTAKRTLQQTRLKAGDVLSVDLEIKRTNPFPYVYVLIEDDPPDT
FT                   FHLKEQIEMKQMLFPWFRKTWRFSYQLNDVMRGEHHLSAVRIKTGDMFGFVEKEVIIPL
FT                   EKKLLVYPKMLDLQVESAESVNENGGKAVHSWLNEPTHVTTGVREYQQGDRFAWVDWKT
FT                   TARRGQLMTKEFEQNQTKDLVVFADFTDEAAFETVVSITASVLQSAVKKGVPAGLVPLG
FT                   DQHVFRVDQGESHLQDLLYFLTMVQHHPSRALECKAFAASEYQYAGKYVVTGHLHEELA
FT                   ESLFVNRNRKNITVLLVKRAADRYTTKEKQLVDRLKASGMRTTVLFEDRLHERTVR"
FT   gene            583974..586178
FT                   /locus_tag="BPUM_0547"
FT   CDS_pept        583974..586178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61241"
FT                   /db_xref="GOA:A8FAH4"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009092.1"
FT                   /protein_id="ABV61241.1"
FT                   /translation="MLHTHQRQSRFELFIYYAVAFLLLWEWLRPLQDFTETSHTSYFII
FT                   FIGLTCLFTFFRLKWYVTFPICTGLILLALYLIFYQAEPSYPAALFADIKDNITLMSTG
FT                   MWSDMYPSFRTLLFYILLWLLVYLLHYWVVYQQRIFFFLLMTIVYVTILDTFTPYDATF
FT                   AIVRIMVFGFCLLGLLYFDRLRSAEGIRVSQKARLKWFLPMLALVLLSVTLGASLPKSD
FT                   PKWPDPVPFFKAVTNQDGSAGQNKVGYSTDDSSLGGPFSEDQTPVFKWSGKEPSYFRVE
FT                   TKSIYTGKGWEDASNDTKPTRLKEDSVPNRWFTEHVKTEEHETRVDMESNYRFNHAVYP
FT                   IGTIMLMPMDNIPLQIMGKTEKIVPSMQNPPKNLGNYQVSFLSPTFILEDLQKIKVPTK
FT                   KQVNQQVGREYLQLPSSLPERVKTLANSLTETKDNMYDKAKAIEDYLGSAKFSYETQNV
FT                   AVPSRQEDYVDQFLFDTMIGYCDNFSTSMIVLLRSIGIPARWVKGYTSGQLYETQMDGN
FT                   NVYEVTNNNAHSWVEVYFPNRGWVTFEPTKGFTNPETFTNESASSDQTDDDQKEEDQPS
FT                   SDASEDQPTEQPQQQETAQPAEPKKQTAQAKPNMVQVGSILGFAAGAMILLGLISWMLY
FT                   RFRARWLPFFIVRKAKRLPEEEVFFYAYAALLKQLKRRGIEKKPGMTLREFASLIDDKD
FT                   GDHLMTELTQLYERALYRREDASMLWGQSAKLWENLINRR"
FT   gene            586365..587906
FT                   /locus_tag="BPUM_0548"
FT   CDS_pept        586365..587906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0548"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61242"
FT                   /db_xref="GOA:A8FAH5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAH5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359841.1"
FT                   /protein_id="ABV61242.1"
FT                   /translation="MTNLVNEMILVLDFGSQYNQLITRRIREFGVYSELHPHTLTAEEI
FT                   KEMAPKGIILSGGPNSVYDEGSFRCDEKIFDLDIPVLGICYGMQLMTHYLGGKVEAASQ
FT                   REYGKADIHINGTPALFKDLPTDQVVWMSHGDLVVEVPEGFTVDATSAHCPNSAMSLAE
FT                   KNFYGVQFHPEVRHSEYGNDLLKNFVFGVCDCDGKWSMENFIEIEMQKIRETVGDKQVL
FT                   CALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFSEGFNMNVIKVDA
FT                   KDRFLNKLKGVSDPEQKRKIIGNEFIYVFDDESDKLKGIDYLAQGTLYTDIIESGTATA
FT                   QTIKSHHNVGGLPEDMQFELIEPLNTLFKDEVRALGSELGIPDDIVWRQPFPGPGLGIR
FT                   VLGEISEEKLEIVRESDAILREEIANFGLERDIWQYFTVLPDIRSVGVMGDARTYDYTI
FT                   GIRAVTSIDGMTSDWARIPWDVLEKISTRIVNEVKHVNRVVYDITSKPPATIEWE"
FT   gene            588294..589412
FT                   /locus_tag="BPUM_0549"
FT   CDS_pept        588294..589412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61243"
FT                   /db_xref="GOA:A8FAH6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003237457.1"
FT                   /protein_id="ABV61243.1"
FT                   /translation="MKSVDVRDQLKKLIDINPLSQNEIAKKLGFSSGYISKFINKKQEI
FT                   AFWMVYELIIFLDCDNEKELMKGFIDIIKRNENIRASLEYSHSKSYRELTDILIQRCFL
FT                   VGNKENEEWGLIYQWQLQSKRMVYYDEESYLKNLKKLTPKTLEMKTLLLILEMYCHFFK
FT                   KRYELAAYYVRNINDLILKIQDPFIRKSFKCRLNEASAYIYLKKDNDILNARKIADDLI
FT                   EENLGPNYLITGYFVKGLSFFLESYEVASYCFEKVIEISKKIGRNSTFEETCEQLGLLQ
FT                   IFWEKPLNTEKNSCFIRALGSLKKIDQFNSESKYVPLILLFEGKRKQNKEKLLLAMHYF
FT                   YTQKDNFRASIPRYLLEGLGVQFNINEGGEYV"
FT   gene            complement(589732..590118)
FT                   /locus_tag="BPUM_0550"
FT   CDS_pept        complement(589732..590118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0550"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61244"
FT                   /db_xref="GOA:A8FAH7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009095.1"
FT                   /protein_id="ABV61244.1"
FT                   /translation="MDNLVGQKIKKLRKQKKYTQKYVAENLGITDSYLSKLEKGQPPSI
FT                   TLLKKMADFFDVDQSYFFIKDDELKNFNETEKELIFEKDLSLENIKNKFNILKVDDQEI
FT                   SDDELKLMLEVLKAYRVSKNDIDS"
FT   gene            590286..590534
FT                   /locus_tag="BPUM_0551"
FT   CDS_pept        590286..590534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35535"
FT                   /db_xref="GOA:A0A0U2NLZ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2NLZ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003220302.1"
FT                   /protein_id="ALS35535.1"
FT                   /translation="MNVGAFVKKVRKEYFLTQEQFSMRLGVSNSYISKIERNKVNPSLK
FT                   FLKILSKEFSVPLQNFLNENRHIYQLLMVSRKTNLLK"
FT   gene            590559..590801
FT                   /locus_tag="BPUM_0552"
FT   CDS_pept        590559..590801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61245"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009096.1"
FT                   /protein_id="ABV61245.1"
FT                   /translation="MVLEDTKNVMKKAVSLAKQLEGNWTARMKMALNKVYIEHYLSQPL
FT                   TREVIERLLLKGMSFRRIKKHYNVGMQEISSLLAK"
FT   gene            591491..591874
FT                   /locus_tag="BPUM_03955"
FT   CDS_pept        591491..591874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_03955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_03955"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35536"
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2MU31"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019743982.1"
FT                   /protein_id="ALS35536.1"
FT                   /translation="MELKFIVPNIKETFGEVKFMGFNRERFVYDRVRQQRTDQLESRTY
FT                   NLGSSCQGGQIEVTVPAAVELKEFDFMSDVELVNPIIQAQARANGNFANLAWTVVADDI
FT                   VQKGSSANASKVMPATTASNDKK"
FT   gene            592160..593116
FT                   /locus_tag="BPUM_0553"
FT   CDS_pept        592160..593116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61246"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAH9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_002340828.1"
FT                   /protein_id="ABV61246.2"
FT                   /translation="MIIIESQDIFKIFQYEMNKDKIKEITQEQKTAAFEWTYNQYMNLF
FT                   NQLSLKPDKLEDFFSFTSKKLDLNIVYYLNDEKDVKLITFFSKSENTGTINIYDVIDQK
FT                   FSFEILNSSERVFISELINKGIVDIDPQKIIESGILETGGVVYEVGKYLFKKEYRENWK
FT                   PQLKTPVEKLNFNSLRIHKEIYEFEDMIDNINNLQFTLELEECLDAYENEKFFLCATGL
FT                   GSVLEHLLYLAIEKHVEEKDIKTNENSTASEYIGQLKKAPFEISKREVSHLKNIFAYRN
FT                   SVSHYNKGIFSKEMCDHLLNGIKTSFDNYYMFKDRAN"
FT   gene            593150..594484
FT                   /locus_tag="BPUM_0554"
FT   CDS_pept        593150..594484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0554"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61247"
FT                   /db_xref="GOA:A8FAI0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009098.1"
FT                   /protein_id="ABV61247.1"
FT                   /translation="MVLWKYRGIRIRRYTRNNLRITGALISVPVFLLLMILFWRSHLWD
FT                   VYEKGIEDTFENFTFNIPLIVKSLLVSIIVPVALILVWYFIFHQSYKKIYHRQKIARMI
FT                   FSNKFYESKSVRSKITEKTVQKISYFPKFYYRVKDNHIIIKIAMDMSRFQQRFMELGRE
FT                   FENGLFCDLVSTDMEDGYFTYKLLYDAGRNRIGINEAIVEKGSMTLMKHIKWEFDKLPH
FT                   MLISGGTGGGKTYFILTLVKSLVASGADVRILDPKNADLADLEEVLEGKVFSRKNGIMM
FT                   TLRKSVEDMMRRMDEMKNHPNYRTGENYAFLGYKPVFIVFDEFVAFVDMLDFKERESVI
FT                   QDIKQIVMLGRQAGFFLVAGAQRPDAKYFADGIRDQFNFRISLGKMSETGYAMLFGDTD
FT                   KKFVEKDIKGRGYAYAGTGNIMEFYSPLIPNGYDFIEEIRLAKGA"
FT   gene            594558..595658
FT                   /locus_tag="BPUM_0555"
FT   CDS_pept        594558..595658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0555"
FT                   /product="DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61248"
FT                   /db_xref="GOA:A8FAI1"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR040819"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009099.1"
FT                   /protein_id="ABV61248.1"
FT                   /translation="MTGKVKPPHANRGVLRKKEEEKSQLTSMVDYVRISFKTHDIDHII
FT                   QNVLHINREFMTEEPRGFYGYIGTWRMDMIKVFYSAPDDERGTLIELSGKGCRQFESFL
FT                   ECRGKTWFDFFQDCLNEKGNFTRLDIAIDDKKTYFSIPNLLKRVQKGLCVSRYRRVDNN
FT                   GSNQIEDGSSAGTTIYFGSKKSESYLCFYEKNYEQADKFNLSYDDLEKWNRYEIRLKSE
FT                   RAHSAVCALIADRNLKKIAIGIISNCIRFVEEKGEGDKRKRKTSPFWLKFIGDVEKLQL
FT                   TIEPKKDFYEKSRNWLQNSCAPTMKVILEVDRVLGNSRLLDVILNAEEGALGDSDLLNM
FT                   IFNAKLQDKHEKMLETFLTPIHEMVV"
FT   gene            595914..596171
FT                   /locus_tag="BPUM_0556"
FT   CDS_pept        595914..596171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0556"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61249"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR039440"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009100.1"
FT                   /protein_id="ABV61249.1"
FT                   /translation="MNETVHDLKIMPQYLWAIKTGIKGFEIRKNDREFQVGDILRLREY
FT                   KDGQYTGRLVLGRITFITSFEQKDDYVVLNFKRLKLDQAV"
FT   gene            596178..596456
FT                   /locus_tag="BPUM_0557"
FT   CDS_pept        596178..596456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61250"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009101.1"
FT                   /protein_id="ABV61250.1"
FT                   /translation="MSQWKGLDHRLFNLGFMVGVPSKVYVRQISREWFLIVEGERIKGY
FT                   SEYRYSFYKTKFMDDGRMTSTKVFLDKSSVRQVYNKVLNHINYLEKT"
FT   gene            596535..597185
FT                   /locus_tag="BPUM_0558"
FT   CDS_pept        596535..597185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61251"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009102.1"
FT                   /protein_id="ABV61251.1"
FT                   /translation="MKAKKVVISLGLAGVLVGGTIWGFSANAKNEAKQETQDKKETKTA
FT                   AAVKETKETKKEVKKKEVKEVKKSKPKKVKKVEKKQKQVISEQPKQKERIVASNEPKKN
FT                   NNNSVSEAPVKKQQTQVYRNTTGSSSPSKNVQPKKKYVSNGGSNQSKSSGPKKSTAVPK
FT                   KSPSSSGGTSATGKRTGGGDIKNHGGDRSGKTYNEYTVDANDLDGVPWDELNK"
FT   gene            597246..599789
FT                   /locus_tag="BPUM_0559"
FT   CDS_pept        597246..599789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61252"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009103.1"
FT                   /protein_id="ABV61252.1"
FT                   /translation="MMNKNSPVWSNKYLAVILLLLLCALLPQNNALKTNVGIESFGVNS
FT                   EGFLELNGEVLYMLVDGKREKATMEGLIRKGDADQVLLVESDIQTENSFVPRLFSFFMP
FT                   ISARAADVKIEYKGAISFRGSVVGDFRVNGLQAFCFQHSKQSPPTGSKYKEATPYDNAK
FT                   VQRALYYGWGGEENIFKNKNEGIVTTSLILDRIYSGGDSGKNLPKYDRLWDLVVNGESL
FT                   NSDVDFSLKNLSVSVKGNKQISQSTTLKAIQKNSVELNVPKGITVVNETTGKKVTGSKA
FT                   RVYGGEKIHLEAGLDKALAFTTGKLKSDMKTFQPMITKPQSGNTQVLGFIKVWDDPVKY
FT                   TSLSAKFEVRQKKINVQHIDKYSGEVLEKESYTRNIGSAYSFEPKTSISKGVEKFIPVD
FT                   QKKKTGTLGNEDVTIKFYYNLERNVTVNYYDNRTGDKIKATKKYKKVRGEKYTEKHPTI
FT                   KDGEYTYRYVKATGDKESGTIGGKNIVINYHYDKPLAKLSFDKLQIYTAQWEKGLPVKV
FT                   YLSKELNYKSSLKDMTDKKIAVALYRGTKKVTSKTYTAKELPKKINMTIPAKYLKVNDK
FT                   ALYAVKFTGFDKRDFKIDAAASELSTDGYAASEKTIKASSSNGKELSYKGVVMTEKTPT
FT                   TGKVYYETLTFPLAKIEKKKTGYGFERKVNLHYENEIGGSIKPSFDFEVPKRLVDSYLM
FT                   YKKSGDGSLITMEQTKATNKKQGETSIYDVVYELPHINVERHTGNLFSDEQVESKDKRI
FT                   SYELVDGGRKFYSPIWSDLGNYETKIKSKPMGVNLIKTEVTEQLELYASMYAHMDSKTI
FT                   NQDEVLLKPVYADNPFPNGLPEGWTKKDLDWVMSR"
FT   gene            complement(600178..601002)
FT                   /locus_tag="BPUM_0560"
FT   CDS_pept        complement(600178..601002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61253"
FT                   /db_xref="GOA:A8FAI6"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009104.1"
FT                   /protein_id="ABV61253.1"
FT                   /translation="MFDTVTFEKVVLFIGSGIIPIVGLFLSLSQNRLKRKKEFQESQQQ
FT                   NYNFIQNGYNNEFNVAIQHNQAQEYYYYHQQKKEEFKERQEKWNSRANFLESVMTKTIF
FT                   VLIIIVAFNEISSSFKQFDLKNAISYSYIFWDSIQVSGKIIITLSFFLLGAIFLSSLLT
FT                   RNALIQNLFIVTITTIANIKTLNFWSNNPIDIKSIQKNTTQVSEQITINSIIDHFMPFL
FT                   LIIHVFTAAIVTIHITKMLYIPEYKVRSKTVIFSFGFYILFPFLYELVRALL"
FT   gene            601231..602016
FT                   /locus_tag="BPUM_0561"
FT   CDS_pept        601231..602016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0561"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61254"
FT                   /db_xref="GOA:A8FAI7"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009105.1"
FT                   /protein_id="ABV61254.1"
FT                   /translation="MQNGWGDIKVRSIELFAGIGGIALAAEMAGIEVMVFCEQNDFCRK
FT                   VLNKNFPGVPVFNDVKKLNRELLEEEGLINRNESIDIISGGYPCQGESVIGDRKGEKDD
FT                   RWLWPEMFRLTKELRPDWVVGENVAGHVTMGLDKVLSDLESENYETRTFVFPAISVGAP
FT                   HQRYRTFVVAHSCSKSKSQTDKAFSTFGKKGDTWNNLARGIGTEIPRAYWETHKSPSVG
FT                   VDDGIPDRVDRSIALGNAVVPQQIYPIFKGIVESSMIKG"
FT   gene            602088..602384
FT                   /locus_tag="BPUM_0562"
FT   CDS_pept        602088..602384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61255"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009106.1"
FT                   /protein_id="ABV61255.1"
FT                   /translation="MAFVFENISKFENELKKVGCTFPSGSFLKAVRKNVEAGAVSFDVG
FT                   TEIEEGEETYNLRVFFSIEEPNEEAETPIAALPTCSFDCLWLEKKEGEDLGEA"
FT   gene            602374..602655
FT                   /locus_tag="BPUM_0563"
FT   CDS_pept        602374..602655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61256"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAI9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009107.1"
FT                   /protein_id="ABV61256.1"
FT                   /translation="MKHNFINYGAYQRQMSEIGCSSLADDLYIQLVERIKDGETGAIDL
FT                   TGNITLGDKDSDGDYKLSLVTVSFSADMNDDGVIEMFFERVNVSEVDW"
FT   gene            602684..603076
FT                   /locus_tag="BPUM_0564"
FT   CDS_pept        602684..603076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61257"
FT                   /db_xref="GOA:A8FAJ0"
FT                   /db_xref="InterPro:IPR020334"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009108.1"
FT                   /protein_id="ABV61257.1"
FT                   /translation="MKGVPLILLMVAVILFIVGATTYYYVADYKQHSIIATMNESARIA
FT                   SLRNVDNSIRIEEGKVELSQRAFELNFESSFNEKNNVELGKTSFKYKYLKGADEKMKAV
FT                   KIILTDQKNKEYRTTLVVDKPKGDRK"
FT   gene            603073..604302
FT                   /locus_tag="BPUM_0565"
FT   CDS_pept        603073..604302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0565"
FT                   /product="type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61258"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009109.1"
FT                   /protein_id="ABV61258.1"
FT                   /translation="MITEIEEQKQLLEDVRKHLKLNHPSELLKAFVDLEARGKVNEVVK
FT                   KDFPHLSNEELKFVMAEVVGLGVIEKIIDEYEGVTDISYNGTHLDVISNQGKFRYGEIE
FT                   ESYIIKIIQKFANACRKEFTRKNPILDAAFSNLRLNAVHKEIAQYGTTMALRVVRPKLA
FT                   LHQENFKSFAPDYIFDLLKAIVASKSNVTIAGETGTGKTELQKLLLSFVEYKDHIVMIE
FT                   DTPESHAKILFPDKDIKSWITNPSINIEILVKAGLRNNPAWQVVSETRGREAYEMMQGI
FT                   LTGHRLITTLHAVNARAIPSRLINMMKMGHDIDETSMREDIFRYLNFGIHIEKIEDEEG
FT                   HMQRYLKEIVEFLPNGEVLTVFRCDLTNNGFEFVQGKVSSIFMNRMMEKRVDIQLQRKI
FT                   LDGWGVHEIS"
FT   gene            604289..605101
FT                   /locus_tag="BPUM_0566"
FT   CDS_pept        604289..605101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61259"
FT                   /db_xref="GOA:A8FAJ2"
FT                   /db_xref="InterPro:IPR020397"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009110.1"
FT                   /protein_id="ABV61259.1"
FT                   /translation="MKFRKKKLYSLEEIRAMSIAFGQPLQKREYAKFILIPFMCFAGLT
FT                   YLLFHYWWMAILAGLIGGSYGWFYQLRRKVKNDYEMAAYLERNRFLNNMTQLLTNDDMP
FT                   LIEAISACAQYAEGELKQKLIDLQITLVDSDEKEIVKAFKSLRNAYKNDVQFDQYIEQL
FT                   GIMFVEGRTSILTLKDTKDYHNKVLLKQQRFIEDKQQHKKDFRTMILYSIGFIVGIMLS
FT                   FTLKKYVDIYAHALVGMIANTVYLSIIFYVYHQFNQRYFDDAVTEVRI"
FT   gene            605106..605867
FT                   /locus_tag="BPUM_0567"
FT   CDS_pept        605106..605867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61260"
FT                   /db_xref="GOA:A8FAJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009111.1"
FT                   /protein_id="ABV61260.1"
FT                   /translation="MKNEKAKQTVEQKTVFSFWEKIGESNLREMLLYLNPELSFEGFQK
FT                   KRFFKAASIFLASLPLIAFKPVVAIVALALACFIYHMDYRKIKGWYEVEKFQRELVFFK
FT                   FSREVYIYLLENMSTVYQAFERLSSRLDEGLLKDALRKLLISMHEKPNDVQPFIDFAND
FT                   TSGGDSARLFMLTLYEYQQNSNDDSIIYELGKMTNEQLFMTVDDIIEYKLRKFGTFPTK
FT                   IAMPVMIVMFCFFITLLIDGVKSIQFINGGG"
FT   gene            605874..606233
FT                   /locus_tag="BPUM_0568"
FT   CDS_pept        605874..606233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61261"
FT                   /db_xref="GOA:A8FAJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009112.1"
FT                   /protein_id="ABV61261.1"
FT                   /translation="MIEGSVMKLFKIYIFCFCLVLVADVANYCIRLNQINDFKQYANYQ
FT                   IERRGGLTKDAFQAITKKNEDSYGGSFQIESSSLNQKYPYGTEITYSIKTTYQFLIGGH
FT                   KQEITARGGALSLVR"
FT   gene            606406..606573
FT                   /locus_tag="BPUM_0569"
FT   CDS_pept        606406..606573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61262"
FT                   /db_xref="GOA:A8FAJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ5"
FT                   /protein_id="ABV61262.1"
FT                   /translation="MIIMAVPENVDRFSWGTLAAVIAGAVGMALLAGLTDFVPWLMDFI
FT                   QTSIKGLAKK"
FT   gene            606832..607080
FT                   /locus_tag="BPUM_0570"
FT   CDS_pept        606832..607080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61263"
FT                   /db_xref="GOA:A8FAJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009114.1"
FT                   /protein_id="ABV61263.1"
FT                   /translation="MTFLKWIASIARYFLIALLFFIILIAFGGSLYRLFTHESIVIRHI
FT                   SVNSLGFALVVLALYCCIRLLKWSINVKEGKNEKEKE"
FT   gene            607061..608056
FT                   /locus_tag="BPUM_0571"
FT   CDS_pept        607061..608056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61264"
FT                   /db_xref="GOA:A8FAJ7"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009115.1"
FT                   /protein_id="ABV61264.1"
FT                   /translation="MKKKKNDGKMVIENNPLLSAFKKKLKGVKKPEKKSKSIPKDRSKM
FT                   IAIGIWSMIATLIFFAFLSVLLSINTRSVVNDIERNQVKNSKQKEEVSIVAGERFLSGF
FT                   IEQYINVKNERAAAEQRQNTLMKYLVADDEIDQETWFDTSGAQGDRVLNDYVLYNVKKG
FT                   DGDSLFQYKVNYENVVKVKKKEHKVEKQALLNIPVKHKGDKFAVNGTPYLSEIYDLKGD
FT                   IANTKEDREEYDGDQTAAIKEFLNTFFRKYAEESKDDMSYVMKTPETLNGHLVFGDVEN
FT                   IRIYKKGDGFEVSSVAVFKEKETNLPVKERFTLFIVKNSGQYYVNQLKHQ"
FT   gene            608068..608328
FT                   /locus_tag="BPUM_0572"
FT   CDS_pept        608068..608328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61265"
FT                   /db_xref="GOA:A8FAJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019744000.1"
FT                   /protein_id="ABV61265.1"
FT                   /translation="MEFLDFLVLGAKAGSDLPTLGDLKSWAKQVVEQAIYIVTIFVVCK
FT                   FLIKMSIGKIVGIIALASALVFAVRNWSMVTGWGGALLKLL"
FT   gene            608340..608807
FT                   /locus_tag="BPUM_0573"
FT   CDS_pept        608340..608807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61266"
FT                   /db_xref="GOA:A8FAJ9"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAJ9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009117.1"
FT                   /protein_id="ABV61266.1"
FT                   /translation="MTRMVFNYRKAMREPKKIQKITDNFSLPFAIELIPMINYFIFVAI
FT                   SFGFFLGVRKIFPSAFENTFLIVIFGIPLALTIFVSKVKPEGKNIYLYFWGVFKYLIMI
FT                   KFPKKKFCNDRDIRFINQKEIRFKPLKEVRNFESGNTNEEYIQQFDFDEIR"
FT   gene            608785..611241
FT                   /locus_tag="BPUM_0574"
FT   CDS_pept        608785..611241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61267"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009118.1"
FT                   /protein_id="ABV61267.1"
FT                   /translation="MILTRSGDVWAYYRIKSSSIPSQNQSKIEEYKDKWTSFYEDITEY
FT                   EDFHLMMYPNEFDLEGRLNVLKKDIHEDAFDVASYYMQETVSVMDQRLGRLTKPDFIIG
FT                   IKLNKTLLSMDADMKDNLVSMFDTATDTVVNMLGWEQEISSEFFKKYIEIEDDLASTVT
FT                   TVFAERLKESELKYINRYHFVRGLYHDVDEESQNGDIHSITNTVIDPTIPGSLKLVSDQ
FT                   DEGYISFVVVDEYFDNMVNSDLFFEVQALPFPVEVDIKAKVEGKGMTKAALNIKHQQLK
FT                   EEQNEKHSLGDESDQSTMTSAFLVKDLQNKIKKEEVSLINWLAVVVVDGRSKKECTEKA
FT                   RLVVRHLKGAGIKCRIPIADQLSLFYKMLPAQKLDLMDKNWIQKTTQNGLAECLLGVDS
FT                   FVGSKIGFFLGWGDRFDKHTDLESAIRSSRDFVLYHPFLANQQIKGSKTRSPHCLITGD
FT                   TGNGKSFLAKLLFQYISFMDVKALYIDPKKEMRKWITKIINNPQTRKDFPLYINHLEKY
FT                   HFITLDHEKKENWGALDPVSFMPASKAKDLIEVIFEQIYNFKDKDTISTAFLRAISNVL
FT                   ERKERGEQVGSLHIIYEMQQHKNEIVREAGDNLFESVKDSIMKLLIHDGSNPSLSLTER
FT                   MTILEIENMDLPEFGERIENFTKSQMKSSAVMFAVGKFCELFGMNADEKTAEFIDEAWI
FT                   FTASPQGRKVERQMRRIGRSYNNAEFFISQSTKDALHDDDKGNFGVAFAFDEPSEREDV
FT                   LKWMNLEPSEENQKMLGSMFQGQCLFKDIYGRTSKISIECLFEEWMGAFETINKSEVAY
FT                   AEEMYL"
FT   gene            612012..614393
FT                   /locus_tag="BPUM_0575"
FT   CDS_pept        612012..614393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61268"
FT                   /db_xref="GOA:A8FAK1"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009119.1"
FT                   /protein_id="ABV61268.1"
FT                   /translation="MKKRNLIITFLALVMLVSSVTLVFADDKEGDKTVKPKIEKVGGVD
FT                   LEISRFPLEHYQAHNQAEDGMIKGAIVSLSNVMLGTTQIIVLVVDKAMDLFMSAEPINN
FT                   FSDAITSVSKDMYNVLKKSFGEIIFVFLIGFLVYLFFIRGNFKEGMRRFALFFLVMIVA
FT                   GLWVNKAGYWVESLNALSIEGQGKLITVGNKLVDSFSGKTDSSLSMDDVKKGQELKGTT
FT                   AVLRNFYFDAALKSPYLVTNYGTPNEKKILKKGDGEGGLDRIDTLLSFKLNSEGQSAKK
FT                   KFINDKEVKEYKNQSIAEGSIYAQLGYSFIGLLAAISLGVPFFLIPFLNFLIQIIVLAI
FT                   ALFLPMAFILSYVPQFAYSGFVSLGRMLALFVMKAMLTFVLIFVYAICVITNKTIPPTN
FT                   LGMYFLNVAAISAILIVSFLKRDKIIKFVTAGKVQSVDANLLENTRKQVVQPSWEGAKK
FT                   VSSGIGEWKKKRDAANASAEQSLGDNKRSAPHNQSVGDSKIDRTSQNNPIKGDAAAKKE
FT                   LERKRQLAASNQLAEENKDNTDASNVMPKVDVERSEQLTKDQLKEEGDSNTSASNVMPK
FT                   VDVERSEQLAKDQLKEEGDSNSASNVMPKVDVERSEQLAKDQLKEEGDSNTSASNVIPK
FT                   VDVERNEQLAKDQLKEEGDNNTNAASNAIPKVDVERSDQIKEHIAEEEKTNSPKGSTSI
FT                   HEVDVERSDQGISEKTLTEENISNQNSVSPVPNTNVARNEQRQSEEKVSASVPKTENET
FT                   VKTSDTQAKTKRVIQQPKHVKIELDQIESRQSKNGRGDRS"
FT   gene            614390..615367
FT                   /locus_tag="BPUM_0576"
FT   CDS_pept        614390..615367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0576"
FT                   /product="endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61269"
FT                   /db_xref="GOA:A8FAK2"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009120.1"
FT                   /protein_id="ABV61269.1"
FT                   /translation="MKKLLTAFFSSLPIIFFGVMLLIVVLIFGGSNQKEEIGGGDEEFV
FT                   TNGIAPEIERLRHVFEKYARKEGVYDQLNIIMALTMQESGGRYLDIMQSSESIGLPPNT
FT                   ITNPEYSIQVGIKHFAAVYKKAGGDVRLTLQSYNYGGGFIDFVKKRGGKYTKALALEFS
FT                   KFQALKLGWRSYGDPNYVDNVFRYLKGGGSVKPVNGAVEGYEVIMNEALKYEGNPYQWA
FT                   GSTPDTGFDCSGLVQWAYRKAGISLPRTAQEQYGATKKIAESEAVAGDLVFFTGTYQGK
FT                   FITHVGIYVGEGRMFNSNDSGVQYSQLKKGYWRDHLVSFGRIKR"
FT   gene            615377..615868
FT                   /locus_tag="BPUM_0577"
FT   CDS_pept        615377..615868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61270"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009121.1"
FT                   /protein_id="ABV61270.1"
FT                   /translation="MKKILWLVGGVVLILGITSYYMTYNKLNDAKNQALKEKQKIENKM
FT                   NQVTNSEAADMNQKFFEAFFQYEDADDREGAVRKLATDKAMSFAFPSKAPKKHSVTMQG
FT                   DLLSLESYSKKVDEDRELYLNEVKIALTVNAITTQQTIIIQTELIKKENKWIVDNVQVK
FT                   "
FT   gene            615896..616105
FT                   /locus_tag="BPUM_0578"
FT   CDS_pept        615896..616105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61271"
FT                   /db_xref="InterPro:IPR021512"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009122.1"
FT                   /protein_id="ABV61271.1"
FT                   /translation="MGTTICKDDLIKIGYKKYQAVNLIREAKAIMVQKGCPYYNNKRLG
FT                   RVPRDVVESILGVSLSEEAGGASQ"
FT   gene            616102..616314
FT                   /locus_tag="BPUM_0579"
FT   CDS_pept        616102..616314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35537"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2VQ17"
FT                   /inference="COORDINATES:ab initio prediction:GeneMarkS+"
FT                   /protein_id="ALS35537.1"
FT                   /translation="MKKRTKYDDVYIDDNGVIFYQIECQSEGKRIRKKCKVGSDGKPFL
FT                   SAFEAHKEVTRLKRELNQRRSNDHL"
FT   gene            616311..617588
FT                   /locus_tag="BPUM_0580"
FT   CDS_pept        616311..617588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0580"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61272"
FT                   /db_xref="GOA:A8FAK5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009123.1"
FT                   /protein_id="ABV61272.1"
FT                   /translation="MKKKQEKTKYPGVYIDEKGRFFYQSEFGIDRITGKRIRKKGRKDA
FT                   NGKPFASAFEANKELTRLKREYHKVNNFSNYKMTYEQFMNQVYIPYYQTEVEESTFEVR
FT                   EGILEKIKDRFGSMSLRSISIEDVQNFRTWLLTSKKRGGAGYSQSYASMVFGVFRQSLD
FT                   KAVDMQYLEYNISKKVKAIPKGKAVVAYWTKEEFEQVINQIYIDDFYEHLNFVMIWVYY
FT                   MTGIRVNEGTALNWSDIDLKKKRMRVHHMLILKTRTEWKRNSYTKTEDGKRTIALDDDT
FT                   INILKVWRERQLTIGLGKVDDFVFSYDGLPMIKSTIGRMLSRYAKLAGVKKIQAKGLRH
FT                   SHASYLINEFNVSVLVLSQRMGHSSPEITLKHYAHMWTGADNTIAEMMAGNINIKTASE
FT                   TKLRFNGNQAINKQNPTKNPTKVAKG"
FT   gene            complement(617862..618920)
FT                   /locus_tag="BPUM_0581"
FT   CDS_pept        complement(617862..618920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0581"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61273"
FT                   /db_xref="GOA:A8FAK6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009124.1"
FT                   /protein_id="ABV61273.1"
FT                   /translation="MEKDKLEKHEAMQYLREYNEQEIFYQQYQQKKHDNQSLQLFLKDY
FT                   DQNTFMHKQIYIEEFLLKGQNEFEKEDTMWLGQEKDIEVRKYSRFMPQLSAIHDFFEMI
FT                   YVLENEMYVEVEDKKMALKSGDIAFIPPNTLHKPIVMENTIAIQIMIRKSTFQKVFFKM
FT                   LKGNHVISEFFLNALYIKENKNILIFHSHLDKNLVDCSLQLFTENYNRFPGYQLIMNNL
FT                   FEILLCLLLRFKPSHMNVNQVKQYRDIRMIQMLQYIQQCCEHITIQEMAEEFNLSPSYL
FT                   SKYIARKLGKSFREIRQEIRLEKACEMITSSNLQINDIATAVGYQNVEHFIRLFKKKYH
FT                   LTPHQYRLNNRS"
FT   gene            complement(618921..620582)
FT                   /locus_tag="BPUM_0582"
FT   CDS_pept        complement(618921..620582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0582"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61274"
FT                   /db_xref="GOA:A8FAK7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAK7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008344336.1"
FT                   /protein_id="ABV61274.1"
FT                   /translation="MFNHKKYEKKYFLPPNLTYDWVKNETLESAPIWCSVDLRDGNQAL
FT                   PIPMNLEEKLEMFQLLVEIGFKEIEIAFPAASDTEFRLLRTLIDHHMIPDDVTIMVITQ
FT                   AREHIIRRTFEAIKGVPKAIVHLYNSTSEAQRRQVFKKTKDEVKQMAMDGAILVKELAE
FT                   KTESDIYFQYSPESFPGTEVDYALDICNSVLDIWKPTPNHKAIINIPTTVEYSMPHIFA
FT                   SQIEYIHKNLSYRDSVTLSVHPHNDRGSGVSDAEFGVLAGAERVEGTLFGIGERTGNVD
FT                   LITLAMNMYSQGYDPKLNFNNLEAIRKQYEKLTNITVHERQPYSGEMVFTAFSGSHQDA
FT                   ISKGMKYRKEHHVDKWDVPYIPVDPVDLGRNYQTDVIRINSQSGKGGIGYILETNYGIQ
FT                   LPYQMNEAMGYEAKKVSDQSNRELSVEEIYHVFEKQYVDFHPHFQLLDYQFHKGEKQEV
FT                   TLTLLRDHQQIDIQGTGTGSLDAISNALKAYFHLEYDLEVYEQNSLGKDSQAKACAQIG
FT                   ISHQGKMHWGAGIDKDIIEATVKALVVAVNRLEVWM"
FT   misc_feature    complement(620639..620903)
FT                   /note="T-box leader"
FT   gene            complement(621146..622033)
FT                   /locus_tag="BPUM_0583"
FT   CDS_pept        complement(621146..622033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0583"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61275"
FT                   /db_xref="GOA:A8FAK8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009126.1"
FT                   /protein_id="ABV61275.1"
FT                   /translation="MSYQEHEKTIQETLNYIEQHLKDDLPLQTLAKHAGYSRFHFHRIF
FT                   KKVIKKSVVDYLRERRMTQAAKDLIHTDQRAIDIAFQYRFSSQESFTRAFKKIYDMSPA
FT                   RYRKLLRNVINEEETNMADHQNTPTGWIMTGDAPSDYETGLDNKIVHSGTNSAYLKSKD
FT                   KKAGGFATLMQQIKSERYKGERLQFSAFVKSEDVQGSAGLWMRIDHSSGEILAFDNMMN
FT                   RPITGTNGWNHFSVVLDVPVKSEVIAFGVLLQGPGHIWMDELSFKIVDESVPVTEQNTV
FT                   DHLEDEPVNLNFEG"
FT   gene            622243..623115
FT                   /locus_tag="BPUM_0584"
FT   CDS_pept        622243..623115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0584"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61276"
FT                   /db_xref="GOA:A8FAK9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAK9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009127.1"
FT                   /protein_id="ABV61276.1"
FT                   /translation="MDYYERIQHSIEFIEENLQNNISIKEISSKSCFSAFHFQRLFQAI
FT                   TGFSVQEYIRNRRLSEAARLLKETKQNVLHIAIAFQYGSQEAFTRAFVQFFGVTPGRFR
FT                   KEGVMLKKQNKMDFLAYQSKLDSELNMNKPVITQLGNFYIIGYEYQTNLQNEEYFTDIP
FT                   LFYMDFGKKEYYQQIQKKIAPHMAYGISTSFQDDGHFSFVVGEEVEDFDLELNEGFVKI
FT                   VIPEGKYAEFKVSGSHEMVQNTRRYIYGSWLPNSNYERTSGPDFEITDVLHSNGPNDIK
FT                   MKIYIPIKE"
FT   gene            623129..623704
FT                   /locus_tag="BPUM_0585"
FT   CDS_pept        623129..623704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0585"
FT                   /product="alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61277"
FT                   /db_xref="GOA:A8FAL0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009128.1"
FT                   /protein_id="ABV61277.1"
FT                   /translation="MQIESLFGTFPVVASKNILLKKVEEHHLPELFSIYDNDAVFQHCG
FT                   IIPKHNLQTVKKMIGHFERDYTKKSRVKWGIFQKNMPHTLVGIIEIMDLNQKVNAVTIG
FT                   YFLAEEHWGKGIATEAVSTLVTFLFEEIDINRIQAEVMPANEVSKKVLLKNGFIKEGLL
FT                   RQAVLWSGKGVVDLEIYSMLKADYIHGE"
FT   gene            complement(623841..624407)
FT                   /locus_tag="BPUM_0586"
FT   CDS_pept        complement(623841..624407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0586"
FT                   /product="alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61278"
FT                   /db_xref="GOA:A8FAL1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009129.1"
FT                   /protein_id="ABV61278.1"
FT                   /translation="MNKINFPQTFPTIHTERLILKQATIEDAEDMHIYLSNETVCRYMG
FT                   IDAHESIEDTKGEIKWYDNIFKEQTGIRWGISLKDDPAIIGSCGFLNLEKQHCRTEIGY
FT                   ELHHDHWRKGIMSEAIVAVLRYGFQEMNLNRIEAIIDPANTSSVQLLENFDFVREGLLR
FT                   EYDLGQHGFDDVFMYSILKRDYNTQ"
FT   gene            complement(624412..624597)
FT                   /locus_tag="BPUM_0587"
FT   CDS_pept        complement(624412..624597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0587"
FT                   /product="Fe3+ hydroxamate ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61279"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214201.1"
FT                   /protein_id="ABV61279.1"
FT                   /translation="MFRFEEPTCASCQKKIEGNEEVYVKLVYPKRKGMTEVKAWLRNEG
FT                   VFYCKACTEQKTSHGG"
FT   gene            624777..625322
FT                   /locus_tag="BPUM_0588"
FT   CDS_pept        624777..625322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0588"
FT                   /product="RNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61280"
FT                   /db_xref="GOA:A8FAL3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359830.1"
FT                   /protein_id="ABV61280.1"
FT                   /translation="MKQVRLIKKAQKGNVPAFEKLMLMYQERLYKTAFLYTRNKEDSLD
FT                   AVQETVIKAFKHLSGLKEPAYFSTWLTRILIHTIFAMKKKQQNVVPLEQQHESVERNDF
FT                   LEDKLDLKHALDVLDEQYQVVIQLFYFQDYSISMISQQMGMPEGTVKTHLYRARKLLKQ
FT                   TLEKEESVDGTKRNEKAL"
FT   gene            625291..626739
FT                   /locus_tag="BPUM_0589"
FT   CDS_pept        625291..626739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61281"
FT                   /db_xref="GOA:A8FAL4"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009132.1"
FT                   /protein_id="ABV61281.1"
FT                   /translation="MERKEMKKLYDEIEVPMVEVTSAVRQAIGDVKAEKKRLLFTWNWR
FT                   TPIYSVIILIVLYFSSGFLFPSLNTAMARVPIIGQFYMMFHDKVGMSLFQSELVKHVNE
FT                   GAESRGVTVKVNSVYYDAGRLVYTFTVENLNKKEDSVPFIVNNFDHKNETFQPSYDNQG
FT                   LKKMKDGRYVGQTEVYTNGQTIKQGQQVPLVISKIGDIVGNWRFKLPVVKQKTTLLAGQ
FT                   KDVSILNGRYQIRNVKVENGVNGSAIQYAIDYNGFAKDDKVSIHGMKDNLGNEYELEIG
FT                   TVLRKKQLTSDKNRKEHLTILNQPINPKATELTFDTSVDIEREYSHIIPLKTKLPVQFK
FT                   TKHHGIGIKINKIEQKDRSVILDYQFTGVDQKELDQDVMENIGEFIGLGDIEKMKSWPD
FT                   PQADYESGYYLKGNHAKVTNVKTASMQSIFEFDDKNLETLSLNHFSFKDYGLYLDLSEL
FT                   NMLAPHKEIKVTIPVKKETSKASQ"
FT   gene            complement(626758..627945)
FT                   /locus_tag="BPUM_0590"
FT   CDS_pept        complement(626758..627945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0590"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61282"
FT                   /db_xref="GOA:A8FAL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009133.1"
FT                   /protein_id="ABV61282.1"
FT                   /translation="MKNTSHQLLIILLAVGSFVTGTSEFVVSGILDMISVDLNISIPAA
FT                   GQLITVYSLFYAVGALFLVMATSKLNRKKVLLSAIFMFILGNVVAFFSHHFMLLLLSRV
FT                   IMAMSGGLYIVVATNYAAQIAPPEKKGSAMATVITGFTVSLVLGVPIGTFLSGHVDWHY
FT                   IFLIIALGTACLLFLLYQLLPRMEGHSHLPLKQQLHLLQDSRVISGLATTVFWILGYTM
FT                   VFAYISPLLRQTAGFSLEMTSIALLILGIAAFIGSRFGGFAVDQWGPNRTISISIMIQM
FT                   FTLFTLFFTQFSTISVLITLAIWGIATWTTTPAKQFYLISLKPQASETVLSFNTAIMNI
FT                   GMMLGSSMGGVIIQYTNVTNLSWIGGIASFAALMLIRYSFNRHRLVEQQTKSEHV"
FT   gene            628046..628942
FT                   /locus_tag="BPUM_0591"
FT   CDS_pept        628046..628942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0591"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61283"
FT                   /db_xref="GOA:A8FAL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009134.1"
FT                   /protein_id="ABV61283.1"
FT                   /translation="MSFVRFDIVAKVVELGSFTAAAEALNMTQSAVSHAVASLETEWDV
FT                   SLFIRDRKKGIMLTDIGQTLLPHIREVLNRLEKIQQEIALTKNIETGLIRIGTFASASA
FT                   CLLPKLLVSYQKKHPKIEFKFYEGTYEEILEWLDSGIIDVGFVVKGYADEAFDLLPLIK
FT                   DEMVVAYHPNHRFHQQSIVDITDLADEPFIMPTGMYQSHVEDIFAEAQLKPATLFEVHD
FT                   CTTIARMVGEGLGVTIGPELFLKTQQLVHIRQLNVSHHREVALACPSLSQASPAVKEFF
FT                   HVAEAVFAKEKDLEKGV"
FT   gene            629304..630629
FT                   /locus_tag="BPUM_0592"
FT   CDS_pept        629304..630629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0592"
FT                   /product="guanine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61284"
FT                   /db_xref="GOA:A8FAL7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214014.1"
FT                   /protein_id="ABV61284.1"
FT                   /translation="MKQFFQFDELGTNYRREIIGGLTTFLAMAYILFVNPITLALVSVP
FT                   DFPDKLRIDQGAVFTATALASAAGCILMGLIARYPIAIAPGMGLNAFFAFSVVLGMGIT
FT                   WEAALSGVFVSGLIFVALSLTGFREKIINAIPAELKLAVGAGIGLFITFVGLQGSGIIA
FT                   NNDNTLVSIGNIHSGPVLLTVFGIVVTVILMVLRVNAGVFIGMLVTAIAGMIVGLVPVP
FT                   TQIVGSIPSLSPTFGQALIHLPDIFSIQMLVVILTFLFVGFFDTAGTLVAVATQAGLMK
FT                   NNELPRAGRALLADSSSIVVGSILGTSTTTSYVESSSGVAAGARSGFASVVTGIFFLLA
FT                   MFFSPLLSIVTKNVTAPALIIVGALMVAPLAKIAWDRFEIAVPAFLTMIMMPLTYSIAT
FT                   GIAVGFIFYPITMIFKGKAKEIHPIMYGLFVIFILYFAFLNH"
FT   gene            631011..631811
FT                   /locus_tag="BPUM_0593"
FT   CDS_pept        631011..631811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61285"
FT                   /db_xref="GOA:A8FAL8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAL8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009135.1"
FT                   /protein_id="ABV61285.1"
FT                   /translation="MLEKDEEQSTSDLKIEEPSIDQETRQSRLSRSAAKRGRTSKAKAA
FT                   SDDERSTIQRMLQGVGGAFKRYSSYGLAMLKSPSQAINQAETLRMKYAWISIVLFSVFF
FT                   ALGNYVQLKASKTRLLGFGIHYSFGDAFLRVAIFTLILLTLMMLTVWLLGKYMLKGNIS
FT                   LKEVIMKFGAALVPVLVLSILWLVFAMLNIPYVTVILSVMMFFGLQLIAVVLFRSIQSD
FT                   HKTARGDLMYTGWVFLLVELVIIALLWAIVGEYLIPSLVPVRFG"
FT   gene            632051..632572
FT                   /locus_tag="BPUM_0594"
FT   CDS_pept        632051..632572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61286"
FT                   /db_xref="GOA:A8FAL9"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAL9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496907.1"
FT                   /protein_id="ABV61286.2"
FT                   /translation="MVLIILVINIVYVSFSTMRLILTMKGRRYAAAFAGTIEMLIYVIG
FT                   LSIVLDNLDQIQNVIAYALGYGMGIIVGMKIEEKLALGYTTVNVITKELDVDLPRQLRE
FT                   KGYGVTSWVAGGLEGDRTALQILTPRKYELQLYETIKTLDSKAFIISYEPKSIHGGFWV
FT                   KAVKKRRIKE"
FT   gene            632569..632769
FT                   /locus_tag="BPUM_0595"
FT   CDS_pept        632569..632769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61287"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009137.1"
FT                   /protein_id="ABV61287.1"
FT                   /translation="MTAKPKKKKFYVEDNMTIDQVLSQMAAEGYSPVRRMEEPIFQEKK
FT                   ENGSIQIIPIGKKIVFEGKIV"
FT   misc_binding    632851..632933
FT                   /bound_moiety="purine"
FT                   /note="purine riboswitch; BPUM_nc0006"
FT   gene            633120..633608
FT                   /locus_tag="BPUM_0596"
FT   CDS_pept        633120..633608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0596"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61288"
FT                   /db_xref="GOA:A8FAM1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496905.1"
FT                   /protein_id="ABV61288.1"
FT                   /translation="MKPLVGVIMGSTSDWETMKNACDILEELDIPYEKQVVSAHRTPDL
FT                   MFEYATEARGKGLKVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSKALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGATNAGLLAAQMISAFDETIAARLEKRREQTKQTVLESSDQLG"
FT   gene            633601..634743
FT                   /locus_tag="BPUM_0597"
FT   CDS_pept        633601..634743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0597"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61289"
FT                   /db_xref="GOA:A8FAM2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359823.1"
FT                   /protein_id="ABV61289.1"
FT                   /translation="MAKQTIFPNATIGIIGGGQLGRYMAVSAKQMGYRAAVLDPVTQSP
FT                   CGQVADTEITAAYSDLDGIRQLAEISDVVTYEFENIDYDALNQLKEEANLPQGSELLLL
FT                   TQNRETEKKGIVDAGCEVAPYRIIHDEKELEDAVDVLGLPAVLKTCRGGYDGKGQYVIK
FT                   EKGQLQEAAALLTHGTCILESWVPFQMELSVIVTRSIHGEIAVFPVAENIHKHNILFQS
FT                   IVPARVDESIQEKAKVLATTLAEKLGLVGTLAVELFLTNDGELLVNELAPRPHNSGHYT
FT                   LDLCETSQFEQHVRAICGLPLGGTALLSEGMMVNLLGDEVDIPLEHPELLKEAKLYLYG
FT                   KHEVKEGRKMGHMTFMKQLDDEWMTNITKIWTERDGGNGK"
FT   gene            634740..636035
FT                   /locus_tag="BPUM_0598"
FT   CDS_pept        634740..636035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0598"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="Catalyzes two discrete reactions in the de novo
FT                   synthesis of purines: the cleavage of adenylosuccinate and
FT                   succinylaminoimidazole carboxamide ribotide"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61290"
FT                   /db_xref="GOA:A8FAM3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359822.1"
FT                   /protein_id="ABV61290.1"
FT                   /translation="MIERYARPEMSAIWTEENKFNAWLEVEILACEAWAELGVIPKEDV
FT                   VTMRKNASFDIDRILEIEQDTRHDVVAFTRAVSESLGEERKWVHYGLTSTDVVDTALSY
FT                   LLKQANDILLKDIERFVDILKEKAKEHKYTVMMGRTHGVHAEPTTFGLKLGLWYEEMKR
FT                   NLERFKQAKAGIEFGKISGAVGTYANIDPFVEQYVCEKLGIKAAPISTQTLQRDRHADY
FT                   MATLALVATSIEKFAVEIRGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMTGIA
FT                   RVIRGYMLTAYENVPLWHERDISHSSAERIILPDATIALNYMLNRFSNIVKNLTVFPEN
FT                   MKRNMDRTLGLIYSQRVLLALIDTGMAREEAYDTVQPKAMEAWEKQVPFRSLVEAEEKI
FT                   TSRLTPEQIADCFDYNYHLKNVDMIFERLGLA"
FT   gene            636108..636830
FT                   /locus_tag="BPUM_0599"
FT   CDS_pept        636108..636830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0599"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="catalyzes the formation of
FT                   (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
FT                   carboxamido)succinate from
FT                   5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate and
FT                   L-aspartate in purine biosynthesis; SAICAR synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61291"
FT                   /db_xref="GOA:A8FAM4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496901.1"
FT                   /protein_id="ABV61291.1"
FT                   /translation="MTVKQELLYEGKAKKIYQTDDEHILYVEYKDSATAFNGEKKAEIE
FT                   GKGRLNNEISSLIFQMLHEKGINNHFVKRLSETEQLIQKVQIVPLEVVVRNVVAGSMSK
FT                   RLGIPEGTKLDTPLIEFYYKDDALGDPLITEDHIRILDAATPEQVEEMKQITRQVNEEL
FT                   KQIFSDCHVNLIDFKLEFGIDHENRILLADEISPDTCRLWDKETNEKLDKDVFRRNLGG
FT                   LTNAYEEIFKRLGGHKHV"
FT   gene            636823..637077
FT                   /locus_tag="BPUM_0600"
FT   CDS_pept        636823..637077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0600"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="With PurL and PurQ catalyzes the conversion of
FT                   formylglycinamide ribonucleotide, ATP, and glutamine to
FT                   formylglycinamidine ribonucleotide, ADP, and glutamate in
FT                   the fourth step of the purine biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61292"
FT                   /db_xref="GOA:A8FAM5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017419024.1"
FT                   /protein_id="ABV61292.1"
FT                   /translation="MYKVKIFVSLKESVLDPQGSAVQHALHSMSYQEVKDVRIGKYMEL
FT                   VIEKSDRDLDTVVKEMCEKLLANTVIEDYRYEVEEVVAQ"
FT   gene            637074..637757
FT                   /locus_tag="BPUM_0601"
FT   CDS_pept        637074..637757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0601"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="With PurL and PurS catalyzes the conversion of
FT                   formylglycinamide ribonucleotide, ATP, and glutamine to
FT                   formylglycinamidine ribonucleotide, ADP, and glutamate in
FT                   the fourth step of the purine biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61293"
FT                   /db_xref="GOA:A8FAM6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAM6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496900.1"
FT                   /protein_id="ABV61293.1"
FT                   /translation="MKFAVIVLPGSNCDIDMYHAIQDELGEQVEYVWHDETSLDGFDGV
FT                   LVPGGFSYGDYLRCGAIARFSNIMPAVKKAAAEGKPVLGVCNGFQILQELGILPGAMRR
FT                   NKDLKFICRPVELIVENNETQFTSGYQKGESISVPVAHGEGNFYCDEDTLAKLIENNQI
FT                   AFTYGDDINGSVNRIAGITNEEGNVLGMMPHPERAVDSLLGSADGLKLFQSIVKNWRDT
FT                   HVTTA"
FT   gene            637741..639972
FT                   /locus_tag="BPUM_0602"
FT   CDS_pept        637741..639972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0602"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61294"
FT                   /db_xref="GOA:A8FAM7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAM7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_007496899.1"
FT                   /protein_id="ABV61294.1"
FT                   /translation="MSLLLEPSHKQIKEEKLYQQMGLSDEEFALIESIIGRLPNYTETG
FT                   IFSVMWSEHCSYKNSKPVLSKFPTKGEHVLQGPGEGAGIVDIGDNQAVVFKIESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPIAVLNSLRFGELTSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVHFDQSYEGNPLVNAMCVGLINHEDIKKGQAKGVGNTVMYVGAKTGRDG
FT                   IHGATFASEEFSDESEEKRSAVQVGDPFMEKLLLEACLEVIKNDALVGIQDMGAAGLTS
FT                   SSAEMASKAGSGIEMNLDLIPQRETGMSAYEMMLSESQERMLLVIEKGREQEIIDIFEK
FT                   YDLEAVSVGHVTDDKMLRLLHQGEVVCELPVDALAEEAPVYHKPSSEPAYYREFLETKV
FT                   EAPAITDAAQTLKQLLQQPTIASKEWVYDQYDYMVRTNTVVAPGSDAGVLRIRGTKKAL
FT                   AMTTDCNARYLYLDPEVGGKIAVAEAARNIVCSGARPLAVTDNLNFGNPEKPEIFWQIE
FT                   KSADGISEACRTLSTPVIGGNVSLYNESNGTAIYPTPVIGMVGLVEDTAHITTKSFQQA
FT                   GDVIFVIGETKEEFAGSELQKMTEGRIYGKAPEIDLDVELARQEALLAAIQNGLVQSAH
FT                   DVSEGGLGVALAESTFGTDGLGADIQIDLDSEASLFSETQSRFVVTVKPEHREAFAAAV
FT                   KDAKEVGTVTNDGVFTVKNQEGQQWIHAAVNELERAWKGAIPCLLKSEA"
FT   gene            639948..641378
FT                   /locus_tag="BPUM_0603"
FT   CDS_pept        639948..641378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0603"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61295"
FT                   /db_xref="GOA:A8FAM8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAM8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020861289.1"
FT                   /protein_id="ABV61295.1"
FT                   /translation="MLAEIRGLNEECGVFGVWGHEEAPQITYYGLHSLQHRGQEGAGII
FT                   ATDGENLTSHKGLGLITEVFQNGELKDLKGKGAIGHVRYATAGGGGFENVQPLFFRSQN
FT                   NGSLALAHNGNLVNATQLKQQLENQGSIFQTSSDTEVLAHLIKRSGHMELKEQIKNALS
FT                   MLKGAYAFLIMTETEMIVALDPNGLRPLSLGMLGDAYVVASETCAFDVVGATYLRDVEP
FT                   GEMLIINDEGLKSERFSMNINRSMCSMEYIYFSRPDSNINGINVHSARKSLGKKLAEEA
FT                   HVEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQALREQGVRMKL
FT                   SAVRGVVEGKRVVMVDDSIVRGTTSRRIVTMLREAGATEVHVRISSPPIAHPCFYGIDT
FT                   STHEELIASSHSVEEIRQEIGADSIAFLSVDGLMDGIGRKYDDPQRGQCLACFTGKYPT
FT                   EIYEDTVLPHVKETVLTK"
FT   gene            641474..642514
FT                   /locus_tag="BPUM_0604"
FT   CDS_pept        641474..642514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0604"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61296"
FT                   /db_xref="GOA:A8FAM9"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAM9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359818.1"
FT                   /protein_id="ABV61296.1"
FT                   /translation="MSEAYKNAGVDIEAGYEAVKRMKTHVERTKRAGVMGALGGFGGMF
FT                   DLSELPYKKPVLVSGTDGVGTKLKLAFLMDKHDTIGVDAVAMCVNDVLAQGAEPLFFLD
FT                   YLAVGKADPVKIESIVKGVADGCEQSGSALVGGETAEMPGLYTEEEYDIAGFSVGVVEK
FT                   DEIVTGNSIKEGHLLIGLSSSGIHSNGYSLVRKVLLEDAGLDLHQTYEPFKRPLGEELL
FT                   EPTKIYVKPVLKQVKAGKVDGMAHVTGGGFIENLPRMLPEGLGVEIDNGSWPVPPIFSF
FT                   IQEKGQLKAEEMFNVFNMGIGFVLAVKEDDLVDVIRELEQDGEKAFLIGRVQKGEGVTF
FT                   GGGSLS"
FT   gene            642511..643080
FT                   /locus_tag="BPUM_0605"
FT   CDS_pept        642511..643080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0605"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61297"
FT                   /db_xref="GOA:A8FAN0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009146.1"
FT                   /protein_id="ABV61297.1"
FT                   /translation="MKKFAIFASGSGTNFQAIIDTLKEEGWQAEAAIVICDKPGAKVLE
FT                   RAEKEGIPSFAFTPKAFPNKAAFEQTIIEQLRLHEVEWVFLAGYMRLIGPTLLGAYKGK
FT                   IVNIHPSLLPAFPGLDAIGQAYQAGVKVAGITVHFVDEGMDTGPIIDQAAIYIDQGEEL
FT                   ESIEKRMHELEHTLYPKVIKSLLELS"
FT   gene            643096..644634
FT                   /gene="purH"
FT                   /locus_tag="BPUM_0606"
FT   CDS_pept        643096..644634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BPUM_0606"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="involved in de novo purine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61298"
FT                   /db_xref="GOA:A8FAN1"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214148.1"
FT                   /protein_id="ABV61298.1"
FT                   /translation="MTIKRALISVSDKTNLVPFVKELTELGVEVISTGGTHKLLQENGI
FT                   DVIGISEVTGFPEIMDGRLKTLHPNIHGGLLAVRENDEHMAQIEKHGIQPIDLVVVNLY
FT                   PFKETISKDDVTYEEAIENIDIGGPGMLRAASKNHQDVTVIVDPRDYDSVVQQIKEGGV
FT                   SLEKKRELAAKVFRHTAAYDALIADYLTNFVGETEPEQFTVTFEKKQSLRYGENPHQAA
FT                   TFYENALPSKGSLATATQLHGKELSYNNIKDADAALQIVREFSEPAAVAVKHMNPCGVG
FT                   TGETIAEAFDRAFKADETSIFGGIVALNREVDKQTAEVLHTIFLEIVIAPSFSQEALDV
FT                   LTAKKNLRLLTLDVEADLGKKEKQLTSVHGGLLVQDIDTYGLEEATISIPTKREPTEDE
FT                   WKDLKLAWKVVKHVKSNAIVLAKDQMTAGIGAGQMNRVGSANIAIEQAGEKAKGSALGS
FT                   DAFFPMGDTVEAAAKAGVTAIIQPGGSIRDEESIQKADEYGIAMVFTGVRHFKH"
FT   gene            644647..645921
FT                   /locus_tag="BPUM_0607"
FT   CDS_pept        644647..645921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0607"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61299"
FT                   /db_xref="GOA:A8FAN2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359817.1"
FT                   /protein_id="ABV61299.1"
FT                   /translation="MNVLIIGRGGREHTIAWKVNQSELVSQVFVAPGNDGMTDAAKLVP
FT                   IDEGDHEALIRFAKDNKIGLTIVGPEVPLIAGVVDAFEEAGLKVFGPNAKAAVIEGSKE
FT                   FAKDLMKNYDIPTAAYATFTSFEEAKAYVEEKGAPIVIKADGLAAGKGVTVAMTLDEAI
FT                   NCLHDFLEDEKFGDASASVVIEEFLTGEEFSLMAFVNGDKVYPMVIAQDHKRAFEDDKG
FT                   PNTGGMGAYSPVPQISDEVVQKAVEDVVKPAARAMVQEERPFTGILYAGLMLTPEGSKV
FT                   IEFNARFGDPETQVVLPRLESDLVQVFLDILDGKDVDLQWKDTAAVSVVLASEGYPEDY
FT                   AKGTPIGALQTTVSDVVTFHAGTKKENDQFVTNGGRVANVTAFDDTFEAARTRVYEAVE
FT                   EIIQPGLFYRRDIGARALKAAGKSV"
FT   gene            646193..649240
FT                   /locus_tag="BPUM_0608"
FT   CDS_pept        646193..649240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61300"
FT                   /db_xref="GOA:A8FAN3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_020802722.1"
FT                   /protein_id="ABV61300.1"
FT                   /translation="MSSIIWEQRSRISSKLRPYQIKAIETSLSYIKSSSDKQALIKMPT
FT                   GTGKTFVIGVLSLLIKGCNNVLIVSPSSAIREQLYKEIRKMWVKMDIDLEIKKSIERLF
FT                   PKNVSELLEKHGDKVFITTIQALTQIKLDDENKFNNLKDQVDLILFDEGHKEPANTWSE
FT                   AIRSFKQKTILFTATPIRNDYQIFNIDENFFFNYSIRQAFDDKIIRTPEFKSIEQNLSS
FT                   SEMKIKDFIKKTIEFKRRFEQENNYEPKVIIRFSSFIDLEIAIDYLEEEKEKAIAIHER
FT                   FKNTKNNNYKFKDVPNENDAIYWLAQNKLVEGIDDSKFAILSIYDGFDNARSLIQQIGR
FT                   TLRKESSDSKIDTSWVIINSTDRYLEDIWSTYLDYESDQSQRGKLPTNNYKNFFKSYLS
FT                   NQPDYIYGSQKFLKKFDDQIPLEFRDALYRYSLPLKVNIFSLKDKMTSDFEFSTLIDRI
FT                   ISQKELSNEFVVNKNINESESMYVVIYTKFGNSSILSNESFIEVKLGLFFIWINENYLY
FT                   YYDTNNYIPSVILDLSDPIDTNKLQLLFNEDTEFTQVTLRNGIVSENNIHRQVINSKNM
FT                   ERIAPNMTDKYNFCTTITGTVNEAGNKGRRYIGFSNSRVSDDSNYVKLADYLDWIKKIA
FT                   SKILNETGAANSFFQRYSPIVGIPENTNPILITFNFNDFADHLVNENGEKVNIEELNYR
FT                   IDDYKTQLKVNGENTCLMLSYENKRYHLSFEDTSLNNNYRFNEDITTNEYSLNKNETLI
FT                   SYLNRYQDFQIVTSDAAHIYYKKEFVKCEISHHDTRLNGIFREYELLDNKKIKSEKGNL
FT                   TVQREEWTEDSLFNLVSSLGKDLDEKNEMKKSLIEMDYLICTDLGSEIADFIGLNIKDK
FT                   KIYFIHCKAVNAFMSASAFQDIVSQIIKSLDYSHPLSNRKPKNVDNWDGDWKLKEVTRK
FT                   RIIKGDKEAKEIWDLIKQYQRDPESVTYIWALTGNMFSLERYNQQKQKSRDQVPEIIQI
FT                   DYLLMYTWAAVQSIGAKFILFFDKKV"
FT   gene            649391..649585
FT                   /locus_tag="BPUM_0609"
FT   CDS_pept        649391..649585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61301"
FT                   /db_xref="GOA:A8FAN4"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009150.1"
FT                   /protein_id="ABV61301.1"
FT                   /translation="MEIKAIIIFAIFMHILFLININSIMLFAMKRNKMKKASTICYMII
FT                   SIFSGIAISSFLIWTFFIN"
FT   gene            649607..650452
FT                   /locus_tag="BPUM_0610"
FT   CDS_pept        649607..650452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0610"
FT                   /product="beta-lysine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61302"
FT                   /db_xref="GOA:A8FAN5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022525"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359815.1"
FT                   /protein_id="ABV61302.1"
FT                   /translation="MVQLKKLANERFSALICIDSFNERIRLDDYSGRVRDVIQSVLQEA
FT                   SDCKASKVIVKVRREHVPLFLEKGFRLEGVFSHYFLGSDAYGMSLFLTEDRMNSSYWLE
FT                   EDEIVASIQAKEIKEDQGTWQDEYVMRKADPKDIHKLAKLYDTVFETYPTPMNESDYIE
FT                   KVMEEGTIFYVVEHDGHIVSAASAEINAPYGHAELTDCATLPSYRKLGFMHHLILALEK
FT                   ELQSMHIFVFYSLARALSYGMNQVFYQLGYTYTGRFQNNCYIFDKIEDMNLWVKTPNES
FT                   "
FT   gene            complement(650447..652105)
FT                   /locus_tag="BPUM_0611"
FT   CDS_pept        complement(650447..652105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0611"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61303"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017359814.1"
FT                   /protein_id="ABV61303.1"
FT                   /translation="MAILVKDALSLDIMKGTKLLAGENGLDRLIEWVTIVEIIEDTSRL
FT                   SEGELLVTTGFGLSDNQERCERIEELIQSQRLSAIAIYKGVYLSDIPPSLIQAAKNSGI
FT                   PLIEIPPHINFSDITKAVLEQIVSSQLHQLKYSSAIHQRLTQLNVRNKNVTQITEELAH
FT                   LTAANIVVLDVFLHQTAAHLIKDEVTYSPAFGFLTDREPIETMPLLKQAEEKGRLVYDT
FT                   CGSFVLAACPVIAMGDIFGFIVSLKKKDTWHHLDAIAIEHAGAVYAIEWLKQKAIQDTE
FT                   NQMQGHLLDDILQQQYTEESYVVEQATKLQYDMSDEQVVIYFQFQHQHTQLDHQMMQRL
FT                   SQLLTSIFERRHISFLLKTRLDSIFVLTPAGKKAFQEAEWYRAAEECRSTWSYFFPVHP
FT                   IVIGIGRAYDQISLFAKSAKEAQYAARLLPLLKTDESIIHYQKLGLYGMLLEMNEAGMN
FT                   LHDFYVELLSPLLYTKKQGADLIHTLEVYLAHNENIQKSAGELFIHRHTLSYRLKQIET
FT                   RTGCSLKSTDDRMKLQLSIMAYRLSGLLDQMRTIS"
FT   gene            652296..653660
FT                   /locus_tag="BPUM_0612"
FT   CDS_pept        652296..653660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61304"
FT                   /db_xref="GOA:A8FAN7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214187.1"
FT                   /protein_id="ABV61304.1"
FT                   /translation="METRDYLIKPMLNQHYPVAVKGEGIYLYDRDGKKYIDGSSGAVTA
FT                   SIGHGIREIIDAMTEQAEKVSFTYRSQFTNEPAEDLAYELSKLCPGNLNWSFFVGSGSE
FT                   ATETAMKIAIQHWQEQGKAEKNHIISRWMSYHGITLGALSMSGHIARRERFEPLLEKNP
FT                   VLSPPYSYRSWLPKEEGKQVEWYVQEFKTVIQRIGKERIAAFIAEPIVGASGAALVPPD
FT                   GYFEAMKRVCEENDILMIADEVMTGFGRTGKMFAMEHWGVVPDIMVLGKGMSAGYSPIA
FT                   AAVSADHVIAPILSGSGSVMAGHTYSGNPLSAAVSLAVIRYMKKHQLPERADLSGRYLM
FT                   NALKEVQTNHFIIGDVRGKGLLIGIEFVADRLSKTPFPAHAQMTHLVVETAKQNGLLVY
FT                   PASAGEDGVGGAAIMIAPPLSITQQEMDELIQLFEQTITQVEQEVINRGFFPSAM"
FT   gene            653670..654359
FT                   /locus_tag="BPUM_0613"
FT   CDS_pept        653670..654359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0613"
FT                   /product="CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61305"
FT                   /db_xref="GOA:A8FAN8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214184.1"
FT                   /protein_id="ABV61305.2"
FT                   /translation="MMNKTVNVDEVITHFRNDMTIMFGGFGGVGSPPSLIDAILEANIK
FT                   DLTLIGNDAGFPQIGVGRLITEGRVKKIIASHIGSNPIAGQKMQAGTLDVHFYPQGILA
FT                   EKIRAGGMGLAGIVTDVGMDSLNLDKKQLVPLNGKTYILEPALTADMAIVNALKADEAG
FT                   NLIFDKSARNTNPIVAMAGDWTIAEVEEIVPVGHLHPEEIVTPGVFVNQIVQSKGVNWT
FT                   WAWETSI"
FT   gene            654335..655000
FT                   /locus_tag="BPUM_0614"
FT   CDS_pept        654335..655000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0614"
FT                   /product="CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61306"
FT                   /db_xref="GOA:A8FAN9"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAN9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008344276.1"
FT                   /protein_id="ABV61306.1"
FT                   /translation="MGMGDIDLRHRIAKRAAQEIEDGMIVNLGIGIPTLAAEYIPAHYN
FT                   VWLHAENGIMGAGASPVQGEEDPNLCNAGGYPITLTKGGSYMDSTTAFGIIRKGMLDMT
FT                   ILGALEVSSQGDLANWIVPGKRVPGMGGAIELAQKAKKVVVVMSHLDKHGQSKVKSACT
FT                   LPLTAKSCVDLIITDMAVIEVKSQLLILREVMPPFQPEDVIRATEAPLILAPDVKSVV"
FT   gene            655015..656286
FT                   /locus_tag="BPUM_0615"
FT   CDS_pept        655015..656286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0615"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="catalyzes the formation of L-ornithine from
FT                   N(2)-acetyl-L-ornithine"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61307"
FT                   /db_xref="GOA:A8FAP0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR033687"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009156.1"
FT                   /protein_id="ABV61307.1"
FT                   /translation="MQPITRIRSWMREHQDEAIALLQQMVQCESTQGNEQKVQQIVANK
FT                   LSAIGFDVDVWEIGGEDLLEHPYFYSPRRSFKGSPNVAGRLKGKGDGKSILLNGHVDVV
FT                   PAGDTKQWTYPPYSGHIINGRLYGRGATDMKGGNVSLLFALEALHALQIPLKGDVVFHS
FT                   VVEEESGGAGTLAAILRGYTADAAIIPEPSHMKIFPIQQGSKWFRLHIKGRAAHGGTRY
FT                   HGVSAIEKSMVVLSHVAALEEERNQRITEPLFQHIPIPIPINIGKIQGGDWPSSVADLV
FT                   TMEGRLGVMPGETVEQAEKELENWMMGLGEKDEWFKEHPVEVEWFGARWLPGSIDTNHP
FT                   LLGLLKEQYEAVKKEPPKIEAAPWGTDGGLLSQAAGIPIIVFGPGTTELAHFPNESIDI
FT                   EHVIEAAEIIAGTMVEWCEAAEAE"
FT   gene            complement(656371..656592)
FT                   /locus_tag="BPUM_0616"
FT   CDS_pept        complement(656371..656592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61308"
FT                   /db_xref="GOA:A8FAP1"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_008344274.1"
FT                   /protein_id="ABV61308.1"
FT                   /translation="MKPNLGLMEALIRIACGMTICTVAGSLYARKPWSNMLLLGIMFGG
FT                   MKLGSGILRFCPVTYMCEQQDTHKEKAE"
FT   gene            656717..658459
FT                   /locus_tag="BPUM_0617"
FT   CDS_pept        656717..658459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0617"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61309"
FT                   /db_xref="GOA:A8FAP2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214450.1"
FT                   /protein_id="ABV61309.1"
FT                   /translation="MSERTFNWRNNDIRTQIDVVDSKIVPTLLLTNGLVLNPFLKQWVK
FT                   ANIWIHDDRIVYVGAELPQNKSAKRVIDCEGKYIVPGYIEPHAHPFHIYNPQSLAEYVS
FT                   QFGTTTMVSDNLFLLLQSNEKKALSTLCELKQQPFQYFWWSRYDLQTEVRYEDEMLPIN
FT                   YRKEWIDHPDVLQGGELTSWPRLMDGDDLILYCMQETKKQRKRIEGHFPGASEKTLTKM
FT                   KLFGADSDHEAMNADDVLKRLSLGYHVSLRHSSIRPDLVNILRELHERDFRHYDHFFYT
FT                   TDGAAPHFYEEGMINRLIAIALEEGVPIIDAYNMATFNIAKYYQIDDLLGVVGPGRLAS
FT                   LNVLDDPMNPNPETVISKGVILKLDGENQHQFQETKWENGGLVPLDLGYDLTTSDLQFS
FT                   MPLGVKMRNAVIMEPYTVEIDNSVNQLSCDHDQSFFSLIDRKGEWRVNTMLKGFANKVQ
FT                   GFVSSFSLTGDILVIGKNKEDMMLAHKRMKEIGGGIVLTENGEILHEIPLQLSGCASAE
FT                   PFETVLQQIQTLRELLIERGYPFDCPIDTLVFFQSTHLPYIRVTPRGIFDVMKKTVLFP
FT                   SIMR"
FT   gene            complement(658727..658912)
FT                   /locus_tag="BPUM_0618"
FT   CDS_pept        complement(658727..658912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61310"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP3"
FT                   /protein_id="ABV61310.1"
FT                   /translation="MSFERIMTGLFIRWKCRQFFRKPKLLYRIQIRQVLSFSLFDNLTN
FT                   LFASDIQITSTSLGLP"
FT   gene            659009..659323
FT                   /locus_tag="BPUM_0619"
FT   CDS_pept        659009..659323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61311"
FT                   /db_xref="GOA:A8FAP4"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214053.1"
FT                   /protein_id="ABV61311.1"
FT                   /translation="MQIDKLRGKSLDQLFNSILSLKDLEECYRFFDDLCTINEIQSLSQ
FT                   RLEVARMLREGNTYHKIETETGASTATISRVKRCLNYGNDAYTMALDRVAEQQANDETK
FT                   "
FT   gene            659383..659604
FT                   /locus_tag="BPUM_0620"
FT   CDS_pept        659383..659604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61312"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP5"
FT                   /protein_id="ABV61312.1"
FT                   /translation="MKSAEKTNKDWLKEASPVFYFSSPINHLSPFLSPSHSSSVSSCEP
FT                   FSLVSSNSPLHGHFYTRLSQNVNRKKGA"
FT   gene            complement(659622..661202)
FT                   /locus_tag="BPUM_0621"
FT   CDS_pept        complement(659622..661202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61313"
FT                   /db_xref="GOA:A8FAP6"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP6"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009161.1"
FT                   /protein_id="ABV61313.1"
FT                   /translation="MTTPFIVIVALLVIFFIIPIILFIWIWMRDEKQEEHSVLRNYPVI
FT                   GKLRFIFEKIGPELRQYLFLNDREELPFSRREYEQAVMSGKYKSRTMGFGSKRDFDKPG
FT                   YYIRNVLFPKQRDELRIDQSEKIQTKVYQIDQDNLLRRSEHTKEVEAKPYYLHQDDVQV
FT                   IGEHTCQKPFRVKGLIGQSAMSYGSLGDRAITALSSGLKMAGGTWMNTGEGGLSPYHLK
FT                   GGADIICQIGPGLFGVRTEDGAFSFEEFKKKSEHEEVKAFELKLAQGAKTRGGHIDGEK
FT                   VTEEIANIRKLPPHQSIDSPNRFEMFHSIPDMFDFIEQLRSIGGKPVGIKLVVGHKENI
FT                   EELAAYMKKSGKHPDFITVDGGEGGTGASFHELADSAGLPIFTALPMVHQILKEYGVRD
FT                   QVKLFASGKLLSPDKIAIALSMGADFVNIARGLMFSVGCIRAQVCHTNKCPVGVATTDP
FT                   KLQKGLSIEEKKYRVCNYILSLREGLFNLSAAAGIESPIHFNEKHIVYRQENGQTSEVP
FT                   IFSGTQPSV"
FT   gene            661342..661572
FT                   /locus_tag="BPUM_0622"
FT   CDS_pept        661342..661572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61314"
FT                   /db_xref="GOA:A8FAP7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP7"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009162.1"
FT                   /protein_id="ABV61314.1"
FT                   /translation="MNKRPNTYVLAGLGVGGAVLLAVKNKQHLKKWASMFRSDEKIPEK
FT                   AGHPDPLDIQDNKMVDEGAMTSVHYFNEARQ"
FT   gene            complement(661553..661966)
FT                   /locus_tag="BPUM_0623"
FT   CDS_pept        complement(661553..661966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61315"
FT                   /db_xref="InterPro:IPR016789"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAP8"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009163.1"
FT                   /protein_id="ABV61315.1"
FT                   /translation="MKRAITYDQTIDIGYIYLLPVGIGTIKETIELDVNECVNVDIDKE
FT                   GRVAGLELFAEETKVLKHAPVYEDELSLRFTDQEVLSTYHLSGIEFLFSTPDHEGLIGF
FT                   TIVDPLRYNIKKKTRKNRFEWSKRFFQTIVSLH"
FT   gene            662239..662931
FT                   /locus_tag="BPUM_0624"
FT   CDS_pept        662239..662931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0624"
FT                   /product="heptaprenylglyceryl phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61316"
FT                   /db_xref="GOA:A8FAP9"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAP9"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:SwissProt:A8FAP9.2"
FT                   /protein_id="ABV61316.2"
FT                   /translation="MYDVTEWKHVFKLDPNKEISDEQLEAICESGTDAILIGGSDNVTE
FT                   DNVLQLMSKVRRFLVPCVLEISTHEMIVPGFDLYFIPTVLNSSHPDWIVGLHKDAMKEF
FT                   GDLMSMEEIVPEGYVILNEECKAAKLTEANTALDIDDVRAYARVAEHLMKLPIFYLEYS
FT                   GTLGDIELVKETKAVLSDTVLFYGGGIENAKQAEDFAQHADVVVVGNVIYDNFKEALKT
FT                   VSAVKKSS"
FT   gene            662989..665211
FT                   /locus_tag="BPUM_0625"
FT   CDS_pept        662989..665211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0625"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61317"
FT                   /db_xref="GOA:A8FAQ0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAQ0"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_019743746.1"
FT                   /protein_id="ABV61317.1"
FT                   /translation="MNEISNHLLEGLNDAQKEAVKATDGPLLLMAGAGSGKTRVLTHRI
FT                   AYLMAEKHVAPWNILAITFTNKAAREMRERVQAILGPGADDIWISTFHSMCVRILRRDI
FT                   DRIGVNRNFSILDTSDQLSVIKNILKERNIDPKKFDPRSILGSISSAKNELIDAEEYAK
FT                   TAGDFYDQVVSDVYTDYQKRLLKNQSLDFDDLIMMTIRLFERIPEVLEHYQRKFQYIHV
FT                   DEYQDTNRAQYMLVKLLAQRFQNICVVGDSDQSIYRWRGADITNILSFEKDYPSSEVIL
FT                   LEQNYRSTKRILNAANTVIQNNSNRKPKNLWTENDEGAKIAYYRADNEFGEGQFVAGKI
FT                   HQLHQSGKRKLSDFAILYRTNAQSRVIEETLLKSNIQYNIVGGTKFYDRKEIKDILAYL
FT                   RLVANPDDDISFARIVNVPKRGIGATSVDKIAAYAEMNDLSMFEALAQVDFIGLSARAA
FT                   NALDEFKQLIDQMTNMQDYLSVTELTEEILEKTGYREALKVEKTIEAQSRLENIDEFLS
FT                   VTKNFEEQNEDKSLVTFLTDLALVADIDKLDENEEEDQDAVILMTLHAAKGLEFPVVFL
FT                   MGMEEGVFPHSRSLMEDAEMEEERRLAYVGITRAEEELYLSSAKMRTLFGRTNMNLESR
FT                   FIREIPADLLDNLNEKKETKTPFGQTRERPQRRGPVSRPQTQTIQNTGGGSIGWAVGDK
FT                   AAHKKWGVGTVVSVKGSGDSTELDIAFPSPTGIKRLLAAFAPIEKQ"
FT   gene            665256..667262
FT                   /gene="ligA"
FT                   /locus_tag="BPUM_0626"
FT   CDS_pept        665256..667262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BPUM_0626"
FT                   /product="aromatic ring-opening dioxygenase LigA"
FT                   /EC_number="6.5.1.2"
FT                   /note="this protein catalyzes the formation of
FT                   phosphodiester linkages between 5'-phosphoryl and
FT                   3'-hydroxyl groups in double-stranded DNA using NAD as a
FT                   coenzyme and as the energy source for the reaction;
FT                   essential for DNA replication and repair of damaged DNA;
FT                   similar to ligase LigB"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61318"
FT                   /db_xref="GOA:A8FAQ1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FAQ1"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017366765.1"
FT                   /protein_id="ABV61318.1"
FT                   /translation="MDKEAAKRRIEELHEILNQYNYEYHTLDRPSVPDAEYDARMRELI
FT                   SLEEEHPDLKAADSPSQRVGGAVLDAFQKVRHGTPMLSLGNAFNEQDLLDFDRRVRQAV
FT                   GDDIAYNVELKIDGLAVSLRYENGVFVRGATRGDGTTGEDITENLKTIRSIPLKIKRPL
FT                   SIEVRGEAFMPKPSFEALNEKRLQNEEEPFANPRNAAAGSLRQLDTKIAAKRNLDIFVY
FT                   SIAELDEIGVESQSEGLDLLDELGFKTNKERRTCQTIEEVIELIETLKTKRADFSYEID
FT                   GIVIKVDSLAQQEELGFTAKSPRWAVAYKFPAEEVVTKLLDIELSVGRTGVITPTAILE
FT                   PVKVAGTTVQRASLHNEDLIKEKDIRLLDQVIVKKAGDIIPEVAGVLIDQRTGEEKPFH
FT                   MPTECPECHSELVRIEGEVALRCINPECPAQIREGLIHFVSRNAMNIDGLGERVITQLF
FT                   KEQLVSRVSDLYRLTKEELIQLERMGEKSVENLLRSIEQSKENSLERLLFGLGIRFIGS
FT                   KAAKTLALHFGDIDQLKQATKEQLLEVDEIGEKMADAVVTYFEKEEILNLLNELKELGV
FT                   NMTYTGPKPVKVEESDSYFAGKTIVLTGKLEEMARNDAKAAIEALGGKLAGSVSKKTDL
FT                   VIAGEAAGSKLTKAEELNIEIWDEVKMLEELKK"
FT   gene            667278..668465
FT                   /locus_tag="BPUM_0627"
FT   CDS_pept        667278..668465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61319"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAQ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_003214281.1"
FT                   /protein_id="ABV61319.1"
FT                   /translation="MKKLLLLLTMLTLVLSACAPFGGKEDEEVTQKTDETKETAIIPMY
FT                   NISDSYYKMVLPFKQGAARGLTAERLNTRLDIDEFETGLMRLATESFNTNDYLFQEGQH
FT                   LDEDTVLGWLARKKTGSDLKKAEKADKDFKNLGLNPALPNSGSTKSKNENSPIYLASML
FT                   EHNYLIRKDKNSLQLGGVVIGLALNSVYYYRENIGDPQQEVTIDSSKNSKKLLSEGEKI
FT                   AEQVIKRIRQMDGLQKVPVMIALYKQAPKSSIVPGNFIAKTDVKAGSADIGNWDTIKEE
FT                   NVFFPSDNAKGNYKDDSERFDRFKTKVEDYFPNYTGVVGKGFYKDGNLQKMKVEIPMQF
FT                   YGKTEVVAFTQYLTGEVMDYYKSTNIEINITSSDQQEALITKNAEDKEPTVHIYD"
FT   gene            668599..669798
FT                   /locus_tag="BPUM_0628"
FT   CDS_pept        668599..669798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0628"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61320"
FT                   /db_xref="GOA:A8FAQ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAQ3"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009168.1"
FT                   /protein_id="ABV61320.2"
FT                   /translation="MKNKSFYFLLGGQSLANFGDSLYVLVLTILTYQLTNSTLIASMVA
FT                   VSQFVGQALGAVLIPFFMYQFKLKRLIIYLQICQIAFFGCLIFIYILQLSTFTIPLFFI
FT                   IVFFLSLIDGGTIPVRNSMIPRLVEKNFLLKANSYILTSDQLVLLLGWLLGGLFIGILG
FT                   PQFLLLTTLVLYSLSLISMLFIIDTGAAAKQEQQSESLATRVFSGWKLMYEKPTIRTLT
FT                   ILEMLSMSGRSIWTGAIILVYVTEVLHQPETWWGFINASYFGGTILGGLLVLRFAKHVE
FT                   QRLFEHIFYSSVIVAVLTLCLGLNHSAWMSLLFVFLLGPAFQLRSISIRTYVQDTLSEI
FT                   ELPKILSAQHTLSTFIYGMSILVMSTMTDLFGARVVFFINVALFTVSAFLASRLKNEHI
FT                   "
FT   gene            669947..674359
FT                   /locus_tag="BPUM_0629"
FT   CDS_pept        669947..674359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0629"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61321"
FT                   /db_xref="GOA:A8FAQ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAQ4"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009169.1"
FT                   /protein_id="ABV61321.1"
FT                   /translation="METFYPGTPINHIGGIIFVNGPLQLDKLKQAIASCIMLTESLRLK
FT                   LVEKDGETLQYVDPNADSSIPTYEFSAHEDMLEWAEKAFKTPFQLTETSLAEFAVLKIG
FT                   EQQSGYFIKCHHTVADGWSMKVIIDKISQLYTALTQSSSIEQEADNHSVFIDKESKYMN
FT                   SPRFKKDQQFWKEALSDVSDSYLVKGTDQIEGHRQSHYLDRQLSERIYEFIDTYHCSIN
FT                   SLFTLGLFVYLHKRYQQKDFIIGTPVLNRSGQKEKATSGMTVSTMPYRMKIDPHLSLLE
FT                   SLTDVQKSYKAYFLHQRYPYDALVKDLELAKAGYDQLFQIYINSYSTNMVQEMEGYKVE
FT                   YIELYNGFQPYGLQVAVKEWDEKGQIELQYDHKISDYSNEDIDFLHERMLLFVETILAQ
FT                   PKQLLKDVFLMTEDEQHRELYQWNDTVVQFPQKQKIHELITNMSTSSPDRMALQDGSHS
FT                   MTYGELERKTNQMAHFLQTNGLQRHEFVAVCMNHSPELIVLLLGVLKAGGAYVPIDPEY
FT                   PEERIQFILDDSQAKLFFTDDASAYQFKGVTYNINNVWNQLAQYNAEHPFTGNDEDVAY
FT                   MIYTSGSTGQPKGVMIEHRSLVNYIMSAKTHYTDSPDDHFALYSSIAFDLTVTSIYTPL
FT                   VIGSTVVIYRQEDQPGFLLEHILLDQKAKVIKLTPAHMALLTDAAISHSVVKRMIVGGE
FT                   QLSTALAKRIIEASDGRISIFNEYGPTEATVGCMIHQFHQDDGGTSVSIGVPMPNTEIY
FT                   LLDENQQAVLPGTVGEIYISGAGVGRGYWQRPDLQESRFLPNPFVNGRRMYRTGDIAKR
FT                   ANDGKIDYIGRIDHQIKLRGYRIELGEIELALMALEEVDKAAVIDLTDESGDKQLAAYI
FT                   ELKEKNMTSFLLRKKLSDQLPAYMVPAYFVVLDELPLTQNGKINRTALPDPLLSQVETA
FT                   VEWSKETADIEEIILDTAKDILGHETIEPADHFYQLGGDSIKAIQFIAKLKDKGLYLKT
FT                   KDLFTYPIFREMAQVVQQEPVIHISQEQAVGDVKSIPIIEWFWSQRLKDEHFWHQSIIV
FT                   HSKKKMNETILQEAFKELVIHHDGLRLKVHEATNTLYYDEDIHEIPLMIHDFTALSEEN
FT                   VEEALQEVGNQIKQRTHLYQGPLIQAALCQSHSQSHLIFAAHHLLADGMSWQILVEDLI
FT                   QLLHAENVTAEVLPSKTHSYQTFAEQVNQYAGSEGVKESISYWQKTVQNIQPLYPISSN
FT                   EGYVKDEVKLTKALSGELTNQLLNQANQAYQTQPHELLISALTQACYQQTNREWISLEL
FT                   EGHGRDAVEDEIDVSRTFGWFTTMYPVNVRVSESLSEHIRVVKETIREVPNKGADYGLL
FT                   SLINGQLPPHSAPQLRFNYLGEIDQVLRQSSNYEMSYFTSGIDSSLDNPLTTVIDLVAT
FT                   IKGGQLIFHLSFSEKQLCETDMAKLLQAVEKQIERLVQHCLEKEGIEFTPSDFETVDMS
FT                   LEEMDSLFT"
FT   gene            674356..675897
FT                   /locus_tag="BPUM_0630"
FT   CDS_pept        674356..675897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0630"
FT                   /product="serine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABV61322"
FT                   /db_xref="GOA:A8FAQ5"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8FAQ5"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_012009170.1"
FT                   /protein_id="ABV61322.1"
FT                   /translation="MRKNQRVIYLSFLLAILWISSFVGEIYAKEVISPKAIDQVIEEQM
FT                   ELGRIPGMSVVIVKKDEVVYQKGFGYADRKKKKQVTASTFFEIGSTSKAFTALAIVELE
FT                   KQGKLHVKDPVSSYIPGFFPTYNGKPQRLTVEQLMHHTSGIPFQSIALIQPDMTKDALK
FT                   KTVDQLKSIELNRKPGSSFEYATINYDVLGLIIEHVTGTSYEAYMKKLFKRHHLDQTEA
FT                   GPKRIKSGSVSEGFKLQFLAPHAYEAPEYRGNTPAGYIVMNSQDVGTWLQYQLTDSTWS
FT                   RFVINPDHLTVNVPEEGKHVYYNAGWYIKKADKQVDSLFHAGSNPNYSSFFLIHPKEEI
FT                   AIGVLANMNSSHTEQTARLIAKTITGTNEEVESSMDPFQLIDQLSLGATCLFILLQIVS
FT                   IVRFMKWKKRVKNGAFVRRDMSLGVWLKSSGWVLLLIGILLLPMIVAQLAFNGLPWKMT
FT                   FVWGPSSLIELAIAYYLFFMWFCTIGFIKGFMVTSPAGKRGKKDDRQTDFGHSSL"
FT   gene            675860..676840
FT                   /locus_tag="BPUM_03960"
FT   CDS_pept        675860..676840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BPUM_03960"
FT                   /db_xref="EnsemblGenomes-Tr:ALS35538"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U2LSZ2"
FT                   /inference="EXISTENCE:similar to AA
FT                   sequence:RefSeq:WP_017151591.1"
FT                   /protein_id="ALS35538.1"
FT                   /translation="MTVKQISGIHPYNDLFYRSCFFNCFFPIVKLHDQEVAPYLLNDQF
FT                   VYGITENGLLQIDWMSAHDPEKIMNLQGIQVEKVTYCPNLIEKVKQDVTSGRPVIVWVD
FT                   PYVQRGRKEYLTTHSRHSILITGFDENQQIFHVLENRHLDNLSYEHQVLSFKDVQKGYD
FT                   TFHEHFQPNDQFHSYAAFYFDSDKLSTELFNRKTTYFLRNMHGQIDEIEKGITALETFY
FT                   EQFSQWDDIDKLVASFNQIMNTKKVELYRLNLIKDDLPELVEWMERILAEWEKARHQAA
FT                   KLLFSGEMSSRYQANIKASLEQIIHDETHWLEALAIKCKRECGVS"
FT   gene            676837..677547
FT                   /locus_tag="BPUM_0631"
FT   CDS_pept        676837..677547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BPUM_0631"
FT