(data stored in ACNUC10043 zone)

EMBL: CP000816

ID   CP000816; SV 1; circular; genomic DNA; STD; PRO; 1297538 BP.
XX
AC   CP000816;
XX
PR   Project:PRJNA13914;
XX
DT   30-AUG-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Ignicoccus hospitalis KIN4/I, complete genome.
XX
KW   .
XX
OS   Ignicoccus hospitalis KIN4/I
OC   Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales;
OC   Desulfurococcaceae; Ignicoccus.
XX
RN   [1]
RP   1-1297538
RX   DOI; 10.1186/gb-2008-9-11-r158.
RX   PUBMED; 19000309.
RA   Podar M., Anderson I., Makarova K.S., Elkins J.G., Ivanova N., Wall M.A.,
RA   Lykidis A., Mavromatis K., Sun H., Hudson M.E., Chen W., Deciu C.,
RA   Hutchison D., Eads J.R., Anderson A., Fernandes F., Szeto E., Lapidus A.,
RA   Kyrpides N.C., Saier M.H.Jr., Richardson P.M., Rachel R., Huber H.,
RA   Eisen J.A., Koonin E.V., Keller M., Stetter K.O.;
RT   "A genomic analysis of the archaeal system Ignicoccus
RT   hospitalis-Nanoarchaeum equitans";
RL   Genome Biol. 9(11):R158-R158(2008).
XX
RN   [2]
RP   1-1297538
RG   US DOE Joint Genome Institute
RA   Podar M., Anderson I., Ivanova N., Wall M., Mavrommatis K., Lykidis A.,
RA   Chen J., Hudson M., Deciu C., Hutchison D., Eads J., Fernandes F.,
RA   Tamang D., Szeto E., Land M., Lapidus A., Kyrpides N., Chang C., Saier M.,
RA   Eisen J., Rachel R., Huber H., Keller M., Richardson P., Stetter K.;
RT   "Unicellular symbiosis at high temperature: Genomic insights into the
RT   Ignicoccus hospitalis - Naoarchaeum equitans relationship";
RL   Unpublished.
XX
RN   [3]
RP   1-1297538
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Martinez M., Zharchuk I., Schmutz J., Larimer F.,
RA   Land M., Hauser L., Kyrpides N., Anderson I., Richardson P.;
RT   ;
RL   Submitted (27-AUG-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 79c907f0ec62d4bfb32742efa0240660.
DR   BioSample; SAMN02598324.
DR   EnsemblGenomes-Gn; EBG00001166176.
DR   EnsemblGenomes-Gn; EBG00001166177.
DR   EnsemblGenomes-Gn; EBG00001166178.
DR   EnsemblGenomes-Gn; EBG00001166179.
DR   EnsemblGenomes-Gn; EBG00001166180.
DR   EnsemblGenomes-Gn; EBG00001166181.
DR   EnsemblGenomes-Gn; EBG00001166182.
DR   EnsemblGenomes-Gn; EBG00001166183.
DR   EnsemblGenomes-Gn; EBG00001166184.
DR   EnsemblGenomes-Gn; EBG00001166185.
DR   EnsemblGenomes-Gn; EBG00001166186.
DR   EnsemblGenomes-Gn; EBG00001166187.
DR   EnsemblGenomes-Gn; EBG00001166189.
DR   EnsemblGenomes-Gn; EBG00001166190.
DR   EnsemblGenomes-Gn; EBG00001166191.
DR   EnsemblGenomes-Gn; EBG00001166192.
DR   EnsemblGenomes-Gn; EBG00001166193.
DR   EnsemblGenomes-Gn; EBG00001166194.
DR   EnsemblGenomes-Gn; EBG00001166195.
DR   EnsemblGenomes-Gn; EBG00001166196.
DR   EnsemblGenomes-Gn; EBG00001166197.
DR   EnsemblGenomes-Gn; EBG00001166198.
DR   EnsemblGenomes-Gn; EBG00001166199.
DR   EnsemblGenomes-Gn; EBG00001166200.
DR   EnsemblGenomes-Gn; EBG00001166201.
DR   EnsemblGenomes-Gn; EBG00001166202.
DR   EnsemblGenomes-Gn; EBG00001166203.
DR   EnsemblGenomes-Gn; EBG00001166204.
DR   EnsemblGenomes-Gn; EBG00001166205.
DR   EnsemblGenomes-Gn; EBG00001166206.
DR   EnsemblGenomes-Gn; EBG00001166207.
DR   EnsemblGenomes-Gn; EBG00001166208.
DR   EnsemblGenomes-Gn; EBG00001166209.
DR   EnsemblGenomes-Gn; EBG00001166210.
DR   EnsemblGenomes-Gn; EBG00001166211.
DR   EnsemblGenomes-Gn; EBG00001166212.
DR   EnsemblGenomes-Gn; EBG00001166213.
DR   EnsemblGenomes-Gn; EBG00001166214.
DR   EnsemblGenomes-Gn; EBG00001166215.
DR   EnsemblGenomes-Gn; EBG00001166216.
DR   EnsemblGenomes-Gn; EBG00001166217.
DR   EnsemblGenomes-Gn; EBG00001166218.
DR   EnsemblGenomes-Gn; EBG00001166219.
DR   EnsemblGenomes-Gn; EBG00001166220.
DR   EnsemblGenomes-Gn; EBG00001166221.
DR   EnsemblGenomes-Gn; EBG00001166222.
DR   EnsemblGenomes-Gn; EBG00001166223.
DR   EnsemblGenomes-Gn; EBG00001166224.
DR   EnsemblGenomes-Gn; EBG00001166225.
DR   EnsemblGenomes-Gn; EBG00001166226.
DR   EnsemblGenomes-Gn; EBG00001166227.
DR   EnsemblGenomes-Gn; EBG00001166228.
DR   EnsemblGenomes-Gn; EBG00001166229.
DR   EnsemblGenomes-Gn; EBG00001166230.
DR   EnsemblGenomes-Gn; EBG00001166231.
DR   EnsemblGenomes-Gn; Igni_R0001.
DR   EnsemblGenomes-Gn; Igni_R0002.
DR   EnsemblGenomes-Gn; Igni_R0003.
DR   EnsemblGenomes-Gn; Igni_R0004.
DR   EnsemblGenomes-Gn; Igni_R0005.
DR   EnsemblGenomes-Gn; Igni_R0006.
DR   EnsemblGenomes-Gn; Igni_R0007.
DR   EnsemblGenomes-Gn; Igni_R0008.
DR   EnsemblGenomes-Gn; Igni_R0010.
DR   EnsemblGenomes-Gn; Igni_R0011.
DR   EnsemblGenomes-Gn; Igni_R0012.
DR   EnsemblGenomes-Gn; Igni_R0013.
DR   EnsemblGenomes-Gn; Igni_R0014.
DR   EnsemblGenomes-Gn; Igni_R0015.
DR   EnsemblGenomes-Gn; Igni_R0016.
DR   EnsemblGenomes-Gn; Igni_R0017.
DR   EnsemblGenomes-Gn; Igni_R0019.
DR   EnsemblGenomes-Gn; Igni_R0020.
DR   EnsemblGenomes-Gn; Igni_R0021.
DR   EnsemblGenomes-Gn; Igni_R0022.
DR   EnsemblGenomes-Gn; Igni_R0023.
DR   EnsemblGenomes-Gn; Igni_R0024.
DR   EnsemblGenomes-Gn; Igni_R0025.
DR   EnsemblGenomes-Gn; Igni_R0026.
DR   EnsemblGenomes-Gn; Igni_R0027.
DR   EnsemblGenomes-Gn; Igni_R0028.
DR   EnsemblGenomes-Gn; Igni_R0029.
DR   EnsemblGenomes-Gn; Igni_R0030.
DR   EnsemblGenomes-Gn; Igni_R0031.
DR   EnsemblGenomes-Gn; Igni_R0032.
DR   EnsemblGenomes-Gn; Igni_R0033.
DR   EnsemblGenomes-Gn; Igni_R0034.
DR   EnsemblGenomes-Gn; Igni_R0035.
DR   EnsemblGenomes-Gn; Igni_R0036.
DR   EnsemblGenomes-Gn; Igni_R0037.
DR   EnsemblGenomes-Gn; Igni_R0038.
DR   EnsemblGenomes-Gn; Igni_R0039.
DR   EnsemblGenomes-Gn; Igni_R0040.
DR   EnsemblGenomes-Gn; Igni_R0041.
DR   EnsemblGenomes-Gn; Igni_R0042.
DR   EnsemblGenomes-Gn; Igni_R0043.
DR   EnsemblGenomes-Gn; Igni_R0044.
DR   EnsemblGenomes-Gn; Igni_R0045.
DR   EnsemblGenomes-Gn; Igni_R0046.
DR   EnsemblGenomes-Gn; Igni_R0047.
DR   EnsemblGenomes-Gn; Igni_R0048.
DR   EnsemblGenomes-Gn; Igni_R0049.
DR   EnsemblGenomes-Gn; Igni_R0050.
DR   EnsemblGenomes-Tr; EBT00001732675.
DR   EnsemblGenomes-Tr; EBT00001732676.
DR   EnsemblGenomes-Tr; EBT00001732677.
DR   EnsemblGenomes-Tr; EBT00001732678.
DR   EnsemblGenomes-Tr; EBT00001732679.
DR   EnsemblGenomes-Tr; EBT00001732680.
DR   EnsemblGenomes-Tr; EBT00001732681.
DR   EnsemblGenomes-Tr; EBT00001732682.
DR   EnsemblGenomes-Tr; EBT00001732683.
DR   EnsemblGenomes-Tr; EBT00001732684.
DR   EnsemblGenomes-Tr; EBT00001732685.
DR   EnsemblGenomes-Tr; EBT00001732686.
DR   EnsemblGenomes-Tr; EBT00001732687.
DR   EnsemblGenomes-Tr; EBT00001732688.
DR   EnsemblGenomes-Tr; EBT00001732689.
DR   EnsemblGenomes-Tr; EBT00001732690.
DR   EnsemblGenomes-Tr; EBT00001732691.
DR   EnsemblGenomes-Tr; EBT00001732692.
DR   EnsemblGenomes-Tr; EBT00001732693.
DR   EnsemblGenomes-Tr; EBT00001732695.
DR   EnsemblGenomes-Tr; EBT00001732696.
DR   EnsemblGenomes-Tr; EBT00001732697.
DR   EnsemblGenomes-Tr; EBT00001732698.
DR   EnsemblGenomes-Tr; EBT00001732699.
DR   EnsemblGenomes-Tr; EBT00001732700.
DR   EnsemblGenomes-Tr; EBT00001732701.
DR   EnsemblGenomes-Tr; EBT00001732702.
DR   EnsemblGenomes-Tr; EBT00001732703.
DR   EnsemblGenomes-Tr; EBT00001732704.
DR   EnsemblGenomes-Tr; EBT00001732705.
DR   EnsemblGenomes-Tr; EBT00001732706.
DR   EnsemblGenomes-Tr; EBT00001732707.
DR   EnsemblGenomes-Tr; EBT00001732708.
DR   EnsemblGenomes-Tr; EBT00001732709.
DR   EnsemblGenomes-Tr; EBT00001732710.
DR   EnsemblGenomes-Tr; EBT00001732711.
DR   EnsemblGenomes-Tr; EBT00001732712.
DR   EnsemblGenomes-Tr; EBT00001732713.
DR   EnsemblGenomes-Tr; EBT00001732714.
DR   EnsemblGenomes-Tr; EBT00001732715.
DR   EnsemblGenomes-Tr; EBT00001732716.
DR   EnsemblGenomes-Tr; EBT00001732717.
DR   EnsemblGenomes-Tr; EBT00001732718.
DR   EnsemblGenomes-Tr; EBT00001732719.
DR   EnsemblGenomes-Tr; EBT00001732720.
DR   EnsemblGenomes-Tr; EBT00001732721.
DR   EnsemblGenomes-Tr; EBT00001732722.
DR   EnsemblGenomes-Tr; EBT00001732723.
DR   EnsemblGenomes-Tr; EBT00001732724.
DR   EnsemblGenomes-Tr; EBT00001732725.
DR   EnsemblGenomes-Tr; EBT00001732726.
DR   EnsemblGenomes-Tr; EBT00001732727.
DR   EnsemblGenomes-Tr; EBT00001732728.
DR   EnsemblGenomes-Tr; EBT00001732729.
DR   EnsemblGenomes-Tr; EBT00001732730.
DR   EnsemblGenomes-Tr; Igni_R0001-1.
DR   EnsemblGenomes-Tr; Igni_R0002-1.
DR   EnsemblGenomes-Tr; Igni_R0003-1.
DR   EnsemblGenomes-Tr; Igni_R0004-1.
DR   EnsemblGenomes-Tr; Igni_R0005-1.
DR   EnsemblGenomes-Tr; Igni_R0006-1.
DR   EnsemblGenomes-Tr; Igni_R0007-1.
DR   EnsemblGenomes-Tr; Igni_R0008-1.
DR   EnsemblGenomes-Tr; Igni_R0010-1.
DR   EnsemblGenomes-Tr; Igni_R0011-1.
DR   EnsemblGenomes-Tr; Igni_R0012-1.
DR   EnsemblGenomes-Tr; Igni_R0013-1.
DR   EnsemblGenomes-Tr; Igni_R0014-1.
DR   EnsemblGenomes-Tr; Igni_R0015-1.
DR   EnsemblGenomes-Tr; Igni_R0016-1.
DR   EnsemblGenomes-Tr; Igni_R0017-1.
DR   EnsemblGenomes-Tr; Igni_R0019-1.
DR   EnsemblGenomes-Tr; Igni_R0020-1.
DR   EnsemblGenomes-Tr; Igni_R0021-1.
DR   EnsemblGenomes-Tr; Igni_R0022-1.
DR   EnsemblGenomes-Tr; Igni_R0023-1.
DR   EnsemblGenomes-Tr; Igni_R0024-1.
DR   EnsemblGenomes-Tr; Igni_R0025-1.
DR   EnsemblGenomes-Tr; Igni_R0026-1.
DR   EnsemblGenomes-Tr; Igni_R0027-1.
DR   EnsemblGenomes-Tr; Igni_R0028-1.
DR   EnsemblGenomes-Tr; Igni_R0029-1.
DR   EnsemblGenomes-Tr; Igni_R0030-1.
DR   EnsemblGenomes-Tr; Igni_R0031-1.
DR   EnsemblGenomes-Tr; Igni_R0032-1.
DR   EnsemblGenomes-Tr; Igni_R0033-1.
DR   EnsemblGenomes-Tr; Igni_R0034-1.
DR   EnsemblGenomes-Tr; Igni_R0035-1.
DR   EnsemblGenomes-Tr; Igni_R0036-1.
DR   EnsemblGenomes-Tr; Igni_R0037-1.
DR   EnsemblGenomes-Tr; Igni_R0038-1.
DR   EnsemblGenomes-Tr; Igni_R0039-1.
DR   EnsemblGenomes-Tr; Igni_R0040-1.
DR   EnsemblGenomes-Tr; Igni_R0041-1.
DR   EnsemblGenomes-Tr; Igni_R0042-1.
DR   EnsemblGenomes-Tr; Igni_R0043-1.
DR   EnsemblGenomes-Tr; Igni_R0044-1.
DR   EnsemblGenomes-Tr; Igni_R0045-1.
DR   EnsemblGenomes-Tr; Igni_R0046-1.
DR   EnsemblGenomes-Tr; Igni_R0047-1.
DR   EnsemblGenomes-Tr; Igni_R0048-1.
DR   EnsemblGenomes-Tr; Igni_R0049-1.
DR   EnsemblGenomes-Tr; Igni_R0050-1.
DR   EuropePMC; PMC2237900; 18286179.
DR   EuropePMC; PMC2614490; 19000309.
DR   EuropePMC; PMC2873002; 19571240.
DR   EuropePMC; PMC3149612; 21826220.
DR   EuropePMC; PMC5557295; 28591626.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000816.
DR   SILVA-SSU; CP000816.
DR   StrainInfo; 701767; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000336
CC   Source DNA available from Mircea Podar (mpodar@gmail.com)
CC   Archaea available from DSMZ: DSM 18386
CC   Contacts: Mircea Podar (mpodar@gmail.com)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1297538
FT                   /organism="Ignicoccus hospitalis KIN4/I"
FT                   /strain="KIN4/I"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:453591"
FT   gene            complement(143..1972)
FT                   /locus_tag="Igni_0001"
FT   CDS_pept        complement(143..1972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0001"
FT                   /product="translation initiation factor aIF-2"
FT                   /note="TIGRFAM: translation initiation factor aIF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81185"
FT                   /db_xref="GOA:A8A8D3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8D3"
FT                   /protein_id="ABU81185.1"
FT                   /translation="MLNLSAEQRPRLRQPIVAVLGHVDHGKTTLLDKIRGTVVALKEPG
FT                   QITQHIGASLVPTDVIEKVTEPLKKIIPTVKLELPGLLFIDTPGHEIFSNLRRRGGAVA
FT                   DLAILVVDLNEGFQPQTYEAVEILKQRRVPFVVAANKIDRIPGWRSYPDQPFLISYRKQ
FT                   SEEVRERLDNKIYEIMGELAKLGFDSERFDRITNFTRQIAIVPISAKTGEGIPELLAVL
FT                   AGLAQRYMKGRLKYVEGPAKGVIMEVKEEPGYGSTIDTIIYDGIIRQGDTIVVGGIEGP
FT                   IVTKVRALLVPAPLTEMRATKRFEPVEEVSAAAGVKIVAPGLEKAVAGAPVYVVDSPEK
FT                   LEELKEQVKREVEEVMIETDKEGVIVKADTLGTLEALVQFLKNRGIPVRMARVGPVTKR
FT                   DIVEAMTVKSKNKEYGVILAFNVKVLPEAKELAEKEGIKIFQHNVIYRLIEEFEEWLKA
FT                   LREEEKRKVLETLVRPGKIRILPGFVFRRSDPAIVGVEVLGGVIKPKYPLMKEDGSRVG
FT                   SILQIQDKGQSVPEARAGQQVAISIKGRVMVGRHIHEGDVLYTDVPAEHAKLWLTKFKN
FT                   ELSDDEKFVLQEIIKIKRKQNPLYGVVLPSPSS"
FT   gene            complement(2006..2096)
FT                   /locus_tag="Igni_R0001"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(2006..2096)
FT                   /locus_tag="Igni_R0001"
FT                   /product="tRNA-Thr"
FT   gene            complement(2130..3431)
FT                   /locus_tag="Igni_0002"
FT   CDS_pept        complement(2130..3431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0002"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81186"
FT                   /db_xref="GOA:A8A8D4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8D4"
FT                   /protein_id="ABU81186.1"
FT                   /translation="MACPPLDVLCIDDESLLRAYLTDASPLRGNLPQAVLFPSDAAEVA
FT                   KVIRWANKEKVAVYPYGGGSSLVGSPLPFDGIVVDTSLLLDLEVFEKDKLVLAGAGWRL
FT                   SELNHVLRRYGLWFPVDPGSVEWATVGGVVATNAGGIRAVKYGLTSDHVRALEFVTPVG
FT                   EVVWSGAWAKKSSTWLRVHQLLVGSEGTLGIVTKALLTLSRVPERREAVLLLFEEAEEM
FT                   GEAVLDILELAPSALEFMDPKTVRAVNSRTDMSLKMPEKYLLLVEFDDERSSEKTKLIL
FT                   DKYEGIKEDPETLWKYRKLAGPSLTLVKGSRSDWDVAVPVSLLPEAIKFVYENARDWEV
FT                   AVFGHAGDGNLHVNLLHPPGEEWVRKAIEKAKEIICEMSKRYKATVSGEHGIGLLKLAL
FT                   LGCEVDEPALELWKAIKKALDPNLILNPGKKIPL"
FT   gene            complement(3442..3864)
FT                   /locus_tag="Igni_0003"
FT   CDS_pept        complement(3442..3864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81187"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8D5"
FT                   /protein_id="ABU81187.1"
FT                   /translation="MPFFIKFKEYSLKLDVSGNALIVADSIVLDARSVTLPKDSEVRYS
FT                   EPTVKTRAFYAFYARLPTLTRPPAVDMVANDRRVYRGFEIRAVDLDVQQYLTVVTPGSF
FT                   LYDYVIITPNKMGIYMNSKREGYLEETSKSKILYLV"
FT   gene            3936..4012
FT                   /locus_tag="Igni_R0002"
FT                   /note="tRNA-Met1"
FT   tRNA            3936..4012
FT                   /locus_tag="Igni_R0002"
FT                   /product="tRNA-Met"
FT   gene            4026..4610
FT                   /locus_tag="Igni_0004"
FT   CDS_pept        4026..4610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0004"
FT                   /product="tRNA splicing endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81188"
FT                   /db_xref="GOA:A8A8D6"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8D6"
FT                   /protein_id="ABU81188.1"
FT                   /translation="MRLIEVRITEEGLGIPTGVVPSSVVGIRKGDLLFLHPLETLYLVL
FT                   EGEAKVLIDDEEIKDFKEALSRIIEIVKTWCIKERKGCYLANAFWSMFTTYYKLRRKGR
FT                   KVLPEGRREGTLIEIRKNKWWAEYLVLEEGIKISIAQLLEWVEEVRANDLKAIIAVVDR
FT                   NGSVTFYEASRVTLRAPDKRSEGGRVASTAP"
FT   gene            complement(4549..5286)
FT                   /locus_tag="Igni_0005"
FT   CDS_pept        complement(4549..5286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0005"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81189"
FT                   /db_xref="GOA:A8A8D7"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8D7"
FT                   /protein_id="ABU81189.1"
FT                   /translation="MYDPVELGKKVASSVCRGEERLYYRFRGTRFYGGISTADVVGCNL
FT                   RCAFCWSWKATRGIPRTAKFYSPSEVAEKLIRIARERGFELARVSGGEPTLCPTHLLKV
FT                   IDLVNEAGLTFVLETNGILIGYDKSLAKDLVKRKVFVRVSIKAPTPEAFSRVTGAKKEA
FT                   FELQIRALKNLIEEGVDPKMVRAAVVLGYGTPQEYADLIKRLEEIHPLLGDVEFEVLTL
FT                   YPPIMERLKRLGLLPSVYRAPSR"
FT   gene            complement(5291..5671)
FT                   /locus_tag="Igni_0006"
FT   CDS_pept        complement(5291..5671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81190"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8D8"
FT                   /protein_id="ABU81190.1"
FT                   /translation="MSSGLTFQGRAVPEEGQASGEQRLGITKITRIRLFGRWFPALFWA
FT                   RLLDEIRILVGDDRLVSIRSFRTPRGVILTDVDIAGELDPDTRLELEKKVLEVMDETKV
FT                   NPRRFLKIEVRERPATLAVSQD"
FT   gene            complement(5710..7683)
FT                   /locus_tag="Igni_0007"
FT   CDS_pept        complement(5710..7683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0007"
FT                   /product="DNA topoisomerase I"
FT                   /note="TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain
FT                   protein; DNA topoisomerase, type IA, central domain
FT                   protein; SMART: DNA topoisomerase I, ATP-binding; DNA
FT                   topoisomerase I, DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81191"
FT                   /db_xref="GOA:A8A8D9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005739"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8D9"
FT                   /protein_id="ABU81191.1"
FT                   /translation="MKGHILVIAEKPKAAEKIANALGKPIVKRKYGVPYWELTNGKKIV
FT                   VVPAAGHLFGLAPLGKGFPVFDYEWRPLYEIEKGASHTKKYIALISSLSPGSSLYVNAC
FT                   DYDVEGSVIGYIIIERFGDPRRSKRMVFHALTPDEIRRAWNSLRPLDWEMINAGLARHE
FT                   LDWIWGINVSRALMHAYRVATGKSKSLSAGRVQSPTLKEVVERELAVQCFVPEPYFSVS
FT                   LSAKGVSLEPTLKFETKDEADHFISNCLGKVVDVIVNDERLSPPHPFNLPDLQMEAARL
FT                   YGFSPSKTQSIAEELYLDAYISYPRTNSQKYPKDLDYANILKGIASVPQYRPLTKALFK
FT                   ETRGRFSPNNGPKDDPAHPAIYPTGKPPKNLSPDHMKVYDLIVRRFMATLASESVYEVT
FT                   KVVIEVNGQTFKAVGRRVKWKGWTLYYPFSAPQEKSLPSFTKGESLQVKCTRRLQYTKP
FT                   PERYTKAKIVKWMERVGIGTEATRARIVETLFKRGYLKNVGSKVYATDLGIGVALVLSK
FT                   FFPEIVSVELTRRFEEDMKKIMMGVERKEKIVEEAKKFMRMILAKYKPHMREVGEYLAY
FT                   SLGEMEPPGRCAVCWRVAEEDGLCVVHKRARDELYAKYPVWRRRLGLSFEEYLKKVTTL
FT                   KQAGTAAKEVAKALLSEPTFKG"
FT   gene            7738..8553
FT                   /locus_tag="Igni_0008"
FT   CDS_pept        7738..8553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81192"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E0"
FT                   /protein_id="ABU81192.1"
FT                   /translation="MKRKWIVELPGHIYDTKIIEDQVLLANENRVVSVDDEGKATIIFT
FT                   HDAPIYSVKKTGDALLMAAEDKRLIIVDNNEINEVNTDFGLFSLDYKDGKAVAGGCCGA
FT                   LYLISDGTIVKKTNVGGHVYDVSWWSDKVLAASFDGHLYLFDSDLNFIKRVKMAENVNT
FT                   VRPCGGLVAVGTFEPGGVFVLDEDLEVVWSKGGYLDVRLVAWREGCKGLYVGSWDGVLS
FT                   LYDEHGNEVLAGKGPRGVESGDWRDGRLAVSGWGRTELYEEEGDELGER"
FT   gene            complement(8558..10516)
FT                   /locus_tag="Igni_0009"
FT   CDS_pept        complement(8558..10516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0009"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KH, type 1,
FT                   domain protein; RNA-metabolising metallo-beta-lactamase;
FT                   SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81193"
FT                   /db_xref="GOA:A8A8E1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E1"
FT                   /protein_id="ABU81193.1"
FT                   /translation="MSKVDDNLVNLADKIKSLLPKELEIVKIEYEGPEVVVYAKNLLPV
FT                   YEDPEMIRKVARAVRKKIVVKPDESARKPRKEAAELINKIVGEGGEIVELQFEPSTGEV
FT                   IIITNKPGYVVGKGGHRLRKILTATGWKPVVMRNPPLKSNVISTIRAFYRENTKRRLEA
FT                   LLEIGNRIHRPLLFKTNYVRITALGAFKEVGRSAILLETKESKVLLDFGANVGSYDPQK
FT                   HFPKVEEVPIDELDAVIVTHAHLDHCGLVPWLYKYGYRGPVYVTQPTRDLMYLVQKDYI
FT                   EVARKEGKPVPYTESDINSMLLRTIALNYGEVTDVAPDIKLTFYNAGHILGSAMAHLHV
FT                   GEGLFNLVYTGDFKYGYTRLLDKANTQFPRVEAVIMESTYGTQDLPPRELAERLLIDII
FT                   NKTIEKGGFVLIPVLAVGRAQEILLLLVDAVQNKLIKSPEGGAVPIYLDGMVYEATAIH
FT                   AAYPEWLAKSVKERIIKGENPFLADFVHKVESVSIEGGISREEVLESEPGVILATSGML
FT                   TGGPSLEYFRKLAPDPKNSIVFVAYQAAGTLGRTLKEGADRVEIAINEDGKSKLYQLEV
FT                   RSHVFSVEGFSGHSSRSELINWVKSVTPRPKNIILNHGEPSRIEGLARVLSRTVARGMK
FT                   IYTPNIRDSIVFVENDI"
FT   gene            complement(10527..10958)
FT                   /locus_tag="Igni_0010"
FT   CDS_pept        complement(10527..10958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81194"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E2"
FT                   /protein_id="ABU81194.1"
FT                   /translation="MMEENEVHEAEIVAEEDEERVEDDEVVIAYPQSDVKMDEEEALII
FT                   AYDSLKWLSKLEKLEKILREELVVKPWMSDVINDELREVRREVERTLWRLGRALSSVKL
FT                   EGEVPQELINRAREAARGSEPKGPTRPWLIVELLRRYKV"
FT   gene            10984..11508
FT                   /locus_tag="Igni_0011"
FT   CDS_pept        10984..11508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0011"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81195"
FT                   /db_xref="GOA:A8A8E3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E3"
FT                   /protein_id="ABU81195.1"
FT                   /translation="MHEHERFGPERVRFGIVVVSDAVYEGRREDVSGKLAKKIITESGH
FT                   EVTYFSLIPNDKGAILNVLEEAKESPVDVIVFVGGTGLGPNDLTVDVVDRVADKEVPGF
FT                   GELFRYITFQKRGSIAILTRAGLWVYSKLLILVTPGSPDAVETALQLFLPVARHAVAEA
FT                   RGLRHGMPKGV"
FT   gene            11486..11920
FT                   /locus_tag="Igni_0012"
FT   CDS_pept        11486..11920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0012"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81196"
FT                   /db_xref="GOA:A8A8E4"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E4"
FT                   /protein_id="ABU81196.1"
FT                   /translation="MACPKEFEYLPHTADIIVVGYGETLEEAFANAAKGVFNIITDVKK
FT                   VEPKECREVIDEADDLEQALYKWIDDLLLYFDAEGMVFSKFELELKEEEGKVKIHGKAC
FT                   GEKFDPSKHEYGTIVKAMTYAEMEIKKEGECWKVKFVVDI"
FT   gene            complement(11946..13400)
FT                   /locus_tag="Igni_0013"
FT   CDS_pept        complement(11946..13400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0013"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81197"
FT                   /db_xref="GOA:A8A8E5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E5"
FT                   /protein_id="ABU81197.1"
FT                   /translation="MRKAKIGLEVHIQLTKLKTKLFCSCPSDYRDKPPNTVVCPVCLGL
FT                   PGALPKLNEEAVKMALTLCLSLNGKVSRKVVFARKHYFYPDLPKGYQITQFTSLGSSPV
FT                   CQGGQLVMRVDGREKVVRIRRLQLEEDPGRIVWPRGKASEYVLVDYNRSGIALIELVTE
FT                   PDMETPEEARAFVEKLRSLVEHLGICDCELEGAMRVDANVSVEGGERVEIKNIGSIKDV
FT                   EKALKFEITRQSTLLDQGGRVERETRHWDAERRVTVGARSKELEEEYRYMPEPNIPPYL
FT                   IEEGLLEQAKRELPELPDQRIKRMIKEYSLSEYLASVLVIRDKRLADLFEEAAKLYTNY
FT                   KRLASLLVVDYLRWVEELGLPLGKCVKPEWLAELLSYVDRGKITLEQARETVLPSMLRE
FT                   CKEPSRVIEEKGLGVVRDVDKILSIVRKVLRENPKAVEDAKKNPKAINFLVGQVMKALR
FT                   GKADPRTVRQMIESELGMSARHGSDG"
FT   gene            complement(13348..13752)
FT                   /locus_tag="Igni_0014"
FT   CDS_pept        complement(13348..13752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0014"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, MarR; regulatory protein,
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81198"
FT                   /db_xref="GOA:A8A8E6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E6"
FT                   /protein_id="ABU81198.1"
FT                   /translation="MSKCRELIKEFGSLKVTTTRLAILFYLMVNKWSKLGDIAKHLGLT
FT                   KSTVWKHLKEMQEEGLVKVKYSLGRHPQMNVALTEKGAKLVLQYAGLLEKVIECLEGEG
FT                   EKSEKGESEGVEGHEESEDRSGSTHSTDQT"
FT   gene            complement(13731..14405)
FT                   /locus_tag="Igni_0015"
FT   CDS_pept        complement(13731..14405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81199"
FT                   /db_xref="GOA:A8A8E7"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E7"
FT                   /protein_id="ABU81199.1"
FT                   /translation="MFHPGVLGASIMAIGPLSKTIAQISKLEVCRNASSYWSFVITLVL
FT                   LLDLLITPSLAEGSSLVGILVFLVLRVLLLFALAVDRVAENVSYAIRVNWELVKLLEDK
FT                   ASLNKLYTLTTVGLFLVAATLLVLSYISLATGMWNLTTLSLVIVLIISNSLLYSLIIRP
FT                   KSMALGALFASLASIIDVIAMYFIAKRPSELIVSGALSISDVFVILGINVVGVTLCQSA
FT                   ES"
FT   gene            14447..16678
FT                   /locus_tag="Igni_0016"
FT   CDS_pept        14447..16678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0016"
FT                   /product="Uncharacterized membrane protein required for
FT                   N-linked glycosylation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81200"
FT                   /db_xref="GOA:A8A8E8"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E8"
FT                   /protein_id="ABU81200.1"
FT                   /translation="MKYILKEHKKTVVLIVTILIIASSFYVRLIPYFKYSRYGIWLQYD
FT                   DSMFEYWLSKTLYEKGVGYWYQLTPENTRHLWWWPEGRDVRRTETPGLSFTGALLYPVA
FT                   KAFNLRLVDWVGIIPAFYGTLATAASALLGYTIGGPALAVLMATSTGYQYAFMQRSISS
FT                   FVEKMAPCMFFGTLFLVTLALLLKRSNLDVPAAALLGALGGGALMLASAFWGGFLAFLA
FT                   VTLIFSMLVLFFTDNEAVLKNLIIFLAASTITFLVTSKWITTIWMHKTWAFTLLLYSLS
FT                   MVFAAAELLVLKKFDEEKRLKLWSVTLIASIIAMILIVTHPYVLRTYLNARYIMMVMPW
FT                   TRRIESPLARSVAEHQGIFNVFAPNDLINVLGIGLAAPLALLIAVYYYFKGQKDELLHA
FT                   LPIIALGVFATYLVLTNVSVYMLTTVGYLSAIAGALALYWALKSTTLDTGSLAKLLWST
FT                   IALIAAVLLISGSYTGINYALNYPPPSFLSAGTAFYSPLFPDTMKVIESKCKFVLAWWD
FT                   YGYMIGTVANRTTVVDPATLNSTKIAQVAKALIGNENDLLKVLNEFYLPKENTCIFTYE
FT                   VFPLLSDKTVILIPQAGDFAKSVWMFRIAGFDDTTIFSKYIRLKYVVIGTTEDGRRVTL
FT                   IVDSPNDVVPTQRGVLVRTPQRGSVLLRSVEAVTSRPLYDIEEVNLYKMIYLGLKKKGF
FT                   TVLDSLGRKLNMNVDFRHLKLEEVVVDRLYLSNNRTLPFVGVAVVYKFR"
FT   gene            16698..19751
FT                   /locus_tag="Igni_0017"
FT   CDS_pept        16698..19751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81201"
FT                   /db_xref="GOA:A8A8E9"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8E9"
FT                   /protein_id="ABU81201.1"
FT                   /translation="MKAEAAGVAWKEVMRLALLLILMTFSVFASQYSVSLSNLTPVKIT
FT                   NAYEYKVLDGTIGSPEKFWFSRPNVIFTYANGELNKYTITDRGVSLVSSKKLDNVVWAL
FT                   QQNETRVIIVTNSSILITNNALDVLHKIDFDAEGFRAAGKSERCSWFSSSGKLLKVCPS
FT                   NLKVYDLPRGTFGVLKPGGISFYPLWKLAGACKVNVTSFQESFINNITFVLLKSERSSK
FT                   LAKIVWRGGPRLLNCKELGREAYLSNTSLVLTLGGSVGIKYVDLAENVTFTLFGASLAK
FT                   LLGLSRSPLGYEAYVLLVKPQGGGDLLLSLRAKDSNPMFATFSENMFCTPLPSFICFPE
FT                   ELAYRPISFQDVASPHSAVEVALTKRFVEVAGESSVEVNLKPLSAPNKAYTLRLSIQEP
FT                   SKTVLLPSDTYELNVKSKIGRVVLFVGAPPPGTDFDPPVIRVEITPDVIIPYVYKLKIK
FT                   VVDEQTGNPLPGALVYVSGVTVRGKRLQLGPQVTDANGTVVLHLEKGTYMIRVVKDYYK
FT                   PVVIRNLVLDNDKSIAVKMIIKGTDVKIKVMSKGAPPFIPKGPIANATVSIQGRIALEK
FT                   KTDKNGLAEVVLLPGTYTLRASAPLHKPHTETLNVVPSNKPLVKEVTLDPILYNLTLVI
FT                   KDSLTGRLVIPSLISITSLTSGLSKVIKNPATGTVLVTLPPDVYSIKVLAKNYLPFEET
FT                   YNISKSMTLTIPLKLKTVKVRIMVFDELKNLVPAFNITLVNQALGLKFEFSLTSENNTV
FT                   SVPPGTYRLTISAKGYEPLTTTVTISENTKVLQLTIAHKSFNVVIKAKTDDKLLYEFIF
FT                   YCEGQVQGGPLFEPLPLPRMTKPSLQATIRVPRGTYMATLTCYSATKEKAATGSATFTV
FT                   PTNAVVEVPLTPTKTSVAVTVLDVRTNKPVVRATVKLYYGQNKLLIGEGMTDATGRAII
FT                   NVNTYYMGKPVEIVITAPGYQEYRSSVILTRQLPVVYLKPAPTIIETILGNPVLLIAVV
FT                   LVGAAGAYLASMFVGRGGEEEEIFEELV"
FT   sig_peptide     16698..16787
FT                   /locus_tag="Igni_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.882 at
FT                   residue 30"
FT   gene            19735..20838
FT                   /locus_tag="Igni_0018"
FT   CDS_pept        19735..20838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0018"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81202"
FT                   /db_xref="GOA:A8A8F0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F0"
FT                   /protein_id="ABU81202.1"
FT                   /translation="MRSSSRLEVPITEEHTYKVIIGRNVFKEVESALPENVKPCLAVVG
FT                   EGVAKGARWVLKEASAVFPHWEILKDGEAAKDLSVALNIIRKLWELKADRWCALGVIAG
FT                   GSLGDTASFAASVYMRGIPLIQFPTTLLAMIDSSLGGKTAVNFEGFKNVLGSFYHPWLV
FT                   VDDLRFLDTLPDRVFKSSMAEAIKYGITLNPEFLKYLKDNSSKILARDDEYVSKVIAES
FT                   VKTKLEVVRKDPRERKGVREVLNFGHTVGHALESASKFELLHGEAVALGMVVETLYAER
FT                   VGACSSCYEALEGALSAYSLTQVKAPKMTIEEYKAMILKDKKRVGDRLRLPLLEGVGRW
FT                   RLELVPLDEFVETTFKIMEEVFWSEDF"
FT   gene            complement(20824..21534)
FT                   /locus_tag="Igni_0019"
FT   CDS_pept        complement(20824..21534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0019"
FT                   /product="ProFAR isomerase family protein"
FT                   /note="PFAM: ProFAR isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81203"
FT                   /db_xref="GOA:A8A8F1"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F1"
FT                   /protein_id="ABU81203.1"
FT                   /translation="MIIRRAGSGFVVHHSKYALCLDVNDDVCNYAVGIFDEGDSYYACP
FT                   LGKICQRPTEGWLDLLPFSVLITPRGAVVTDGRTSAGFWKVPEAVHVDFVVGESPYRGD
FT                   APFQDVRLLEEDDHIEPFGAAVLRSDDVHRMKLEERWFELIASGEKVVEGRVYDEKRKR
FT                   LRVGHVIQFKSVQSGKLLYAKVKKLVMYKNFKEMLESEDRVLPGLSVEEGLKVYEKYYG
FT                   PEAGPALAIGLEVL"
FT   gene            21592..22017
FT                   /locus_tag="Igni_0020"
FT   CDS_pept        21592..22017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0020"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81204"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F2"
FT                   /protein_id="ABU81204.1"
FT                   /translation="MPFKVYQKILTFSSTKRKELIDITREVERAVAESGVEEGTCMVFV
FT                   PHATAAVIANEHEHGLMSDILRALTELVPPDKGWEHNKIDDNADAHILASIIGPSRCFP
FT                   VSGGRLVRGTWQNVFLVELDGPRHSRKVIVTVMGEGK"
FT   gene            22014..23168
FT                   /locus_tag="Igni_0021"
FT   CDS_pept        22014..23168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0021"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81205"
FT                   /db_xref="GOA:A8A8F3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F3"
FT                   /protein_id="ABU81205.1"
FT                   /translation="MRLYVASEEDILSGNATDIYFKRTVEVVKKSGKDKKVRMEFHAYS
FT                   LPKGYEWGVFAGLEEALYVLRGRDVTVYSLPEGTLFFRKEPIMVIEGKYSEFGELETAL
FT                   LGIIRHSTSIATKAARIKLAAGDKKVLFFGLRALHPAIQPVADRAAFIGGVDGVAGALS
FT                   EKFLGLKPQGTMPHALIVIFGDEESAWKAFDEALPEEVPRIALVDTFCDERESALKAAR
FT                   VLKEKLKGVRLDTPSSRRGNMRAIVEEVKWTLRLHGLEVPIIVSGGLDEEKVEELRDLV
FT                   DAFGVGTSIAFPPSVDVSADIVEVLEGDKWVPRSKRGKLPGFKQLFRDRCFKDEVLPWG
FT                   SEGKGTPLLTKVMEGGEVVTKLPKITEIRDYVLRQLEELKTCRA"
FT   gene            complement(23149..23751)
FT                   /locus_tag="Igni_0022"
FT   CDS_pept        complement(23149..23751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0022"
FT                   /product="RNA-binding protein, containing PUA domain"
FT                   /note="PFAM: PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81206"
FT                   /db_xref="GOA:A8A8F4"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015266"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F4"
FT                   /protein_id="ABU81206.1"
FT                   /translation="MLSRYRLGVGSRRRILLHQVVQSPNGSSSPEGLHPTVKGMRLLRR
FT                   PLSKKEKKLLLKKVEGLPWARFTVDQKVEEVKVRTETEKEYVVYFVEGKPTFWVKDDKY
FT                   LPVLCGNDVEGPSVVVDKGAVPYVTRGADVMRPGIISFEGDFKKGDVVLVRSENLKFPI
FT                   AVGLALYDKEEAEKMERGKVIKNLHYLGDDLFKLCKS"
FT   gene            23816..24517
FT                   /locus_tag="Igni_0023"
FT   CDS_pept        23816..24517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81207"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F5"
FT                   /protein_id="ABU81207.1"
FT                   /translation="MEAAHTKGVECLELERYGSEVCHIASIPLEALKDYLKCEDLKECG
FT                   GLVQSAFLLRGISYKSLNELASACNLPLLQEGPRATELRILEALGAKTFSEAREKILEL
FT                   SSDFKYIEDTVNRLFVVPQGKITETLDKYCLKFGLNLNDEFCEMALMNEFFYFQALVRF
FT                   VECRANGNALPTCEYLLPKSLRVEGVLALKLDDLECLEKVAMKPEVSEETREVVRAILS
FT                   LIERKYGVVLP"
FT   gene            24570..24944
FT                   /locus_tag="Igni_0024"
FT   CDS_pept        24570..24944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81208"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F6"
FT                   /protein_id="ABU81208.1"
FT                   /translation="MCNPTLAQPVVVMRSSYDGSWWIVEGKSVRKLREDDLVGALSDCE
FT                   VRGSATYCPKEALLLVWSRNGSCAVGLKGVIPEDPDAWCNLARLAELLREKLPEPVIVE
FT                   DVYAAAAQLIWSSEGVTAST"
FT   gene            24979..26793
FT                   /locus_tag="Igni_0025"
FT   CDS_pept        24979..26793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0025"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81209"
FT                   /db_xref="GOA:A8A8F7"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F7"
FT                   /protein_id="ABU81209.1"
FT                   /translation="MERKILFIDLSRTRIDEVEVDDYLHTRFLGGKGFCTYFIYKYAQP
FT                   CADPYGPRNVAVIAAGALAGYAPASGKTCFGAVSPLTGLIHDSYAGEVLGPKLRMAGYD
FT                   AIVITGKSEEPVYIYVTEEGTEILSADDIWGHSTSKATKVLKERHGKKSSVAVVGPAAE
FT                   NKVRYASVIVDYHRAAGRGGIGAIWASKGLKAVVVKAAKPLPEPALGRKAWREVATKLY
FT                   KKFQALGSSFSRYGTNNGLVTADKLGMAPHYNFKYPHLGDVGELKGENVVKLAKGPHEV
FT                   EDQSVFGYMCPIKCSKVVKDEGIKSEYEHLGMLGAADGIYKLMDVLKAIKIVNDLGLDS
FT                   ISSGNVIGWTAESEEKGLLNGVMKWGDGEKQRKLLEEIAYRKGIGAVLAEGVKRASEIL
FT                   GFGKEWAVHVKGLEAPAWDPRGLLGFGLSYATADVGASHLRGWPRPHRPPTDSALKALD
FT                   SLLYDRDKTSVADHMGTCVFLAYDFPDWSELLKVVYGLDYDTEELRKLSQRTESLARLW
FT                   ALKVGYTSDDDTVPPRWMEPVPKGPNAGLKAFISWEDLEVSKREYYKRRGWSPREGVPL
FT                   PSTLKSLDLHFAVEDAELLLRKLEPEYY"
FT   gene            27333..27749
FT                   /locus_tag="Igni_0026"
FT   CDS_pept        27333..27749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81210"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F8"
FT                   /protein_id="ABU81210.1"
FT                   /translation="MAPEDEVREEVVEETHKKVMEELEKIYEDEEIEVFAAPDDSELEK
FT                   LLLEILKEKPMKFKELKEVFSATAGEDRLRRSLMKLLEEGRIRELEDGTYTAIDVEDIY
FT                   STVEDEELIEDVLENVEGEEEEEELEELEFDEEF"
FT   gene            complement(27791..28123)
FT                   /locus_tag="Igni_0027"
FT   CDS_pept        complement(27791..28123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81211"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8F9"
FT                   /protein_id="ABU81211.1"
FT                   /translation="MKPDFLRQIFNVVLASHLLDERTTKEARKLVWAAENKYKFSSFDN
FT                   PDPTENLKKYLESSDFDEVLRLLKRKKEVVEDLVTAIETYYGTQLAEIVRRKLAELTQE
FT                   GSESSS"
FT   gene            complement(28207..28446)
FT                   /locus_tag="Igni_0028"
FT   CDS_pept        complement(28207..28446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81212"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G0"
FT                   /protein_id="ABU81212.1"
FT                   /translation="MERVRDALVREVVGKKVVNDKLYKYTYYTLPLNIYIPKHVVHKYG
FT                   REYIVIINSETGEIRAMPKALYEQKRNKQRVQEE"
FT   gene            28586..28894
FT                   /locus_tag="Igni_0029"
FT   CDS_pept        28586..28894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0029"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81213"
FT                   /db_xref="GOA:A8A8G1"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8G1"
FT                   /protein_id="ABU81213.1"
FT                   /translation="MSDFLSELWLVIKKRIEEKPQGSYTAEIVKRGLPFAARKFGEESV
FT                   ELIVASLSEPRDSVIYEAADVIYHLMVLLALRGVDWAEVIKELERRSRAKSGAGGNS"
FT   gene            28875..29468
FT                   /locus_tag="Igni_0030"
FT   CDS_pept        28875..29468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0030"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81214"
FT                   /db_xref="GOA:A8A8G2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G2"
FT                   /protein_id="ABU81214.1"
FT                   /translation="MLAAIVNYGIGNLFSVKKGFERAGFRVVVSNDKEVLKGSDVIVLP
FT                   GVGSHKAAIANMTSLGIVDVIKEVDNFKFGICLGMQLLYEESEEGGLKGLGILKGKVIR
FT                   LRGVPKVPHMGWNTVVGESPLLEGLSGEYFYFAHSYYKEYEGRKEEEAVSDYEGVKITA
FT                   LVCSGKVCATQFHPEKSYVNGVRLLKNFYTYARR"
FT   gene            complement(29465..30049)
FT                   /locus_tag="Igni_0031"
FT   CDS_pept        complement(29465..30049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81215"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G3"
FT                   /protein_id="ABU81215.1"
FT                   /translation="MWASEILRRIEVKEDIASIRRDLNLNEYEFRAAIRTLKSLGLPLV
FT                   RRGKYYEIVEREPQRLSYKGVVDLLIVMKETVKVLRFLYGDDVRYLWPNKALKGKEVLM
FT                   EVSEDEVFHNLPSYVYSLITVRANASLKRRRRFSEVIKTLNALLYAEEVSVRLKRGDVL
FT                   NGKMTNIDIGGYARMGALRLSPEEVEEVLPL"
FT   gene            complement(30100..30224)
FT                   /locus_tag="Igni_R0003"
FT   rRNA            complement(30100..30224)
FT                   /locus_tag="Igni_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            30286..30687
FT                   /locus_tag="Igni_0032"
FT   CDS_pept        30286..30687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81216"
FT                   /db_xref="GOA:A8A8G4"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G4"
FT                   /protein_id="ABU81216.1"
FT                   /translation="MKYCLVLSVGYGVALLTLWTALSLAWGLVDFNALGFLPYGAILSA
FT                   LVAILGALVNCTFEALGNLLGVEPPTSVLAGWTLVMFTYFVITNPPPAGLGEFVWAVGR
FT                   AAMFVSNAFPASDLFYELGNFTLTAVGLR"
FT   sig_peptide     30286..30363
FT                   /locus_tag="Igni_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.920 at
FT                   residue 26"
FT   gene            30684..31172
FT                   /locus_tag="Igni_0033"
FT   CDS_pept        30684..31172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81217"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G5"
FT                   /protein_id="ABU81217.1"
FT                   /translation="MIEPLEDPETPVVLLSIKPRYAQRILSGMKKFELRTWIGLNLYSG
FT                   MLVVMYASGNVKAIVGEFRVGKVYKGRPEFVWGRLIEEGGEEKTGVGEEDYLYIARAKK
FT                   AMALEVLEPKVYKRPPKLEEIRMIIPGWLPPMSHTLLGTGDPLWEMVIKPVREVSEIP"
FT   gene            complement(31169..32383)
FT                   /locus_tag="Igni_0034"
FT   CDS_pept        complement(31169..32383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81218"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G6"
FT                   /protein_id="ABU81218.1"
FT                   /translation="MASSTRGALIRSAQSIDIESMGKIVKSYLKCRILEKSCGANHLYV
FT                   GPPGIGKSETVVEAAKGAAEEAGLKFWEYENSAEPEDYNKAFVMVLFRLDMVKPEDLSG
FT                   FPLPDKNDKSFDYAIPRWAKVLRKAKAGLVILDEFTNINDDTVLSAAYDIVLSEKVNLY
FT                   YFRKPVIALGNPPEYSSIARPLPLPLLNRLAVFNVKEPSVDMWCNYMQKRYNDSWAKEV
FT                   CAFLKSFRDYLIKLPEETELLEPYPTPRSWSSLALALYNAYPDLYDALRSGNKELRKEL
FT                   TTLVSAYVGPEAAHAFVSWAFSKSISVEELIEKPDLVLQLSEDQAALVLQALAHYSHPH
FT                   WKSRTTKVVKRLLEEPGGTRYVAMLLRFMEPSRRNEFIDYLKSKNKMLLYEIKKKIGGK
FT                   ELFED"
FT   gene            complement(32522..33181)
FT                   /locus_tag="Igni_0035"
FT   CDS_pept        complement(32522..33181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81219"
FT                   /db_xref="GOA:A8A8G7"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G7"
FT                   /protein_id="ABU81219.1"
FT                   /translation="MPAAGGIGALALLDPATLLQLGLIVGIAELVVAILAFWRAKVLGL
FT                   DWLRLFGLGVLLLSLAQLLCKVIARGIFHLPFTYPVGVPFKTAGLILVLYSMLRAIDHP
FT                   KTKLLTLLGLGAGVYFFVGSMIAFMYRLRFEWWSFHVPHLLFLVAGPLIIGYYIFKAYL
FT                   ETRDRSALFFAVGLWIYAVASLVVIVGVQLTHINVALSYTLIARAIAMIIILLGTV"
FT   gene            complement(33252..35234)
FT                   /locus_tag="Igni_0036"
FT   CDS_pept        complement(33252..35234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0036"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81220"
FT                   /db_xref="GOA:A8A8G8"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G8"
FT                   /protein_id="ABU81220.1"
FT                   /translation="MIRPKHSNTKRRPRMARVGDHLTTLGFTNVKKPRNVLEEMMGRSV
FT                   NSNEYQGPNKLLLEAAERYLWEHVVEDVMPKDMISAHKEGVVYVHKLPQSVFLPYCNGN
FT                   DYSRVLKKGLKTPTIVAGPARHYQVAMAHAANFLAMMQQYWTGAQAFGSVELWVAPFIA
FT                   KEHLSDEEIRQGIQTLYYELNLPWRPGMQTPFTNITVTYTESKYMLDQPVIIGGASTGD
FT                   LLGDYLDEARRWLIQLGKVLQRGDSLRQPFTFPIPTLMPTAKDFYNDAELFDAIFVTAA
FT                   KMGSYYWLNTKVIDPDSAFAMCCRYVVKKDEVNKAFMGGLRLKKLEDQRKEELEKLAKG
FT                   RLGGMWAIPDITGSIGVVTVNLPRIALDARGDVETFFEILEERVELVAKWLSWWRNHYL
FT                   RLMKTYRNFYSMVWEYSPEWTRTHFNTIGAIGMPEAAAILLGDPEVWTSEDVGAKEKAI
FT                   ELEDKMIKTMADIASRLTIEMGEPFNVEEVPGETAAAKLFLNDLKHYPEVREYVPEGVD
FT                   MYSTSVVPYYDHGITLWQRIKWEGKVQQRFTGGVMMHIFLGEQPDPEALAKLTQKIMDA
FT                   GVVYWSYTPAISVCENGHKTVGLYTRCPRCGAKTEIWSRIIGYYRPVSNWNPFRQKEFR
FT                   MRTHYDNSLNKGKLAVYSLEDGRPM"
FT   gene            complement(35355..35714)
FT                   /locus_tag="Igni_0037"
FT   CDS_pept        complement(35355..35714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81221"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8G9"
FT                   /protein_id="ABU81221.1"
FT                   /translation="MGVDEYVEASERQSELLEELKKIIKSLEEAPADFELNQRIREILD
FT                   ELGVLRKKLLELSKLEPVGDAALLQEFYKLVGVFDERDALEELLKLALKGKVDVSPDEI
FT                   ASHIKEIKKFEKSLE"
FT   gene            complement(35720..37534)
FT                   /locus_tag="Igni_0038"
FT   CDS_pept        complement(35720..37534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0038"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; ABC transporter related; Possible metal-binding
FT                   region in RNase L inhibitor, RLI; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81222"
FT                   /db_xref="GOA:A8A8H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H0"
FT                   /protein_id="ABU81222.1"
FT                   /translation="MERTVPRVAVIDKELCKPDKCNYECIRFCPINKTGRNKAIELGED
FT                   GKPIIHELVCTGCGICIKKCPFQAIHIENLPEEVEEKLVHRYGKNGFALYGLPVPKRGQ
FT                   VTGIIGRNGAGKSTSLKILSGLLKPNLGKEEASWDEVLKRFRGTELFNYLKDLANGKIR
FT                   VAYKLQYVAEAAKLLKGTVGQLLARVDERGIAREVAQALNIAHLWERDVRKLSGGELQR
FT                   FLIAAVLSKDADLYAFDEPAAYLDVKERINMARAIKKFVPPNRYVLIIEHDLAILDYLS
FT                   DLVHIVYGVPGVYGIVSQPYSTRVGINHYIRGFLPSENMRIRDKPITFVNPELREKVVS
FT                   TEVYLEWPFMTKKLGDFVLEVNPGEIHRGEIIGILGPNGIGKSTFIKLIAGILKPDNAD
FT                   FVLPQLRLAYKPQYVTHEMFGKNETVKDVLRKVRSDFLDTSSWYYVEVVKRLGLNRLLE
FT                   KEVKHLSGGELQKLAVAVTLGKEADLYLLDEPSAFLDVEERLAVGDAIRHIVEGSGAAA
FT                   FVVDHDLVMIDLITDRVMVFKGEPGKHGVAEPPTSLRRGMNEFLKELGITFRRDPETGR
FT                   PRVNKEGSRLDRMQKSIGEYYYTLPARE"
FT   gene            37776..37943
FT                   /locus_tag="Igni_0039"
FT   CDS_pept        37776..37943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81223"
FT                   /db_xref="GOA:A8A8H1"
FT                   /db_xref="InterPro:IPR020906"
FT                   /db_xref="InterPro:IPR038647"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8H1"
FT                   /protein_id="ABU81223.1"
FT                   /translation="MPKCPKCGAEVKEPIKTWVLAPKGRKGVIIGLFRCPNGHYFRAKV
FT                   GEAPPKKEAA"
FT   gene            38018..39262
FT                   /locus_tag="Igni_0040"
FT   CDS_pept        38018..39262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0040"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81224"
FT                   /db_xref="GOA:A8A8H2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H2"
FT                   /protein_id="ABU81224.1"
FT                   /translation="MGFKVKDISLADQGKLKIEWAENHMPVVVGLRKLCEEKKVFEGKR
FT                   ISAVLHVTKETAALVRSLKFCGAEVYLAGSNPLSTQDDVAAALAQEGINVYAWKGETEE
FT                   EYWWAIKKIIEEGDPDLVIDDGGDLHATIHKEYPKLAEKIIGGTEETTTGVIRLKAMEK
FT                   EGVLKYPVIAVNDAFTKFLFDNRYGTGQSTIDGILRATNILLAGKVAVVAGYGWVGRGI
FT                   AMRLRGMGARVVVTEVNPLRALEAVHDGFDVMRMDDAAKIGDLFVTATGNIHVIRKEHI
FT                   LKMKDGAILANAGHFNVEIDVKALEEIAISKRRIRPYVDEYKLPDGRRIYLLAEGRLVN
FT                   LVAAEGHPSEVMDMSFANQFLSLKYLLEKAGELAPKVYKVPAEIDEEVARRKLEAMGIK
FT                   IDSLTEEQVRYLNSW"
FT   gene            39256..40149
FT                   /locus_tag="Igni_0041"
FT   CDS_pept        39256..40149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0041"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81225"
FT                   /db_xref="GOA:A8A8H3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H3"
FT                   /protein_id="ABU81225.1"
FT                   /translation="MVRIVVIGNINIDIIAFLDELPSIDEGREAKDWRVLPGGSGANFS
FT                   VAARSLGADVELYAAVGTGTFSKKVVEELERAGVKVFGPLKEGEQSMVFIASTPKGKVM
FT                   YSLKGVSHSLRPEELPERFGADVVHVATKPPSFVEKYLSTERLSYSPGTYAFEETESVK
FT                   RLVGRVDFLFLNKSEAMRLGLYPEPEVLPREALVITLGGKGSLVYTRGGRAYYVESLKV
FT                   EVVDTTGAGDVYAAAFLVTYLTEGDIIKAAKAASAAGALAVTVPGGQIMLDVQSLKLAA
FT                   SKVGVREMRKSPTPEG"
FT   gene            complement(40502..41164)
FT                   /locus_tag="Igni_0042"
FT   CDS_pept        complement(40502..41164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0042"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81226"
FT                   /db_xref="GOA:A8A8H4"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H4"
FT                   /protein_id="ABU81226.1"
FT                   /translation="MSFKVEEVLRSRKLAKGIYETFVSYHGEAPPPGTFFMVWVPGHEA
FT                   IPLSVAGYRGDAVRFIVEVRGRTTAALYTAHKVGLLGPLGRQAPVPSGKPLLVGGGVGI
FT                   APLLYMKELWGGELLFGAKSAEKVPKIDGIDEVATEDGSLGFKGTVVDLLKLRPQKRDV
FT                   YACGPPSMISSLKVLAKEMGLKGYYSTEKMIKCGIGICGSCVLEGKLLCKEPWLRLG"
FT   gene            complement(41171..41644)
FT                   /locus_tag="Igni_0043"
FT   CDS_pept        complement(41171..41644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0043"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81227"
FT                   /db_xref="GOA:A8A8H5"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8H5"
FT                   /protein_id="ABU81227.1"
FT                   /translation="MKELKVSKINNGTVIDHLPPGRALKVLRLLGIDGSEGFMVLIAMN
FT                   VYSKKLGGRKDIVKIENVYLSDEQTKALALIAPTATINIIRNGEVVEKRGVTLPDVVEG
FT                   ILTCPNSSCISRSKREPIKSKFLVVSKRPLKLKCHYCGEIIEEKEVSNYINLR"
FT   gene            complement(41646..42563)
FT                   /locus_tag="Igni_0044"
FT   CDS_pept        complement(41646..42563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0044"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81228"
FT                   /db_xref="GOA:A8A8H6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8H6"
FT                   /protein_id="ABU81228.1"
FT                   /translation="MPDVVDVLDLDKKDMIKIFELAEDIEYKKLHKSKWCALENKTVSL
FT                   LFVEPSTRTRLSFEESAKRLCAHTLTIVGEEASSFVKGESLYDTIKVLDKISDIIVIRH
FT                   NLDGSAKYASEVAANPVINAGDGKNQHPTQSLIDLYVVRKRKGGLEDLRYAVVGDLRYA
FT                   RTARSFLLALTKFKPRSVYLVAPEVLKPSIKFLEELKSMGLNVFEVDRLEDVIPNVDVI
FT                   YVTRIQKERFPDPSEYEKVKGSYKITLDLIKRGKGDLIVLHPLPRVDELDVRIDSTPHA
FT                   AYFDQVAASVPVRMATLAWSAGVV"
FT   gene            42586..44703
FT                   /locus_tag="Igni_0045"
FT   CDS_pept        42586..44703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81229"
FT                   /db_xref="GOA:A8A8H7"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H7"
FT                   /protein_id="ABU81229.1"
FT                   /translation="MGGRKTRFFVKLSKTLQISTKEPREVMKWLVPYLLISLFTQHHYD
FT                   FTVFYYSVLLMLMGVSPYDVNSTAPWIYSNPVTYPQWYAYPPFGLIALSVPSFLLYELG
FT                   LLNMMTFRIILKIILLLSAFWIAKRLEEVRKGSGLVFIKNPLVFFVTAVHGMIDVLAAA
FT                   LLLEALYKLNGKGRYWWAFFALAITTKQTTWIVIPALVGLALRLRLYKDLIKGFALAAL
FT                   IVVPFISQGFIDNVLTFHGSRPPASLGYTGIPLITVAGDLATFHIANLVAPCFGKPVPR
FT                   SGWGSLVLTAALASAMIYSFIISYRGRFARSLVISSFAFILFSKVVSPQNLLVPLVIFM
FT                   ILGVPSSFMYLMGLLATLVDAFLGTAYSVLGYLPEDALNELGTSIVILYRSSLWLSNLS
FT                   GFVGLFALVLYHLIIVTILFYILRERIGIRRFALLYVIYLILVLNSVTIGGNVQRVAGV
FT                   HGELVNARGAVVWIWLNPFNGFRSGDYARLPGATAYWEYTYPLALQTVKWLKDHGFSYV
FT                   VFPFTLDRYRLYEYVPWLFALVSERMPFAWLVVISDDVEEYLSGHASAPPGTNVTEVLN
FT                   EAFRATPYYLNMKILETSKRLNDIFKEANASRAVNVIWKEMRCPISYLRDERGLPVIFL
FT                   IDKTHSGKVLSNGTRYAVVHPKNVVFINDYYEGNVVYGTPITPVSKVGLEEWLLQYAKK
FT                   SSLYSLLCASR"
FT   gene            complement(44652..45074)
FT                   /locus_tag="Igni_0046"
FT   CDS_pept        complement(44652..45074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81230"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H8"
FT                   /protein_id="ABU81230.1"
FT                   /translation="MRVLDERELERLKRRLVIADTSVLLLIAEGIDVIGQIEEMGGLCA
FT                   VTPSVLRELERISEEQSKRGRAARLVLPIVLEQCPILNANLERRTDDDIVSIALRYGLA
FT                   VATADKGLRRRLLRKVPTIYYREAQRRLYSEDFFAY"
FT   gene            45142..46239
FT                   /locus_tag="Igni_0047"
FT   CDS_pept        45142..46239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0047"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81231"
FT                   /db_xref="GOA:A8A8H9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8H9"
FT                   /protein_id="ABU81231.1"
FT                   /translation="MKALVYILALLMVADGILSSYIALRAPYPAAVPLGSPMAYRNVYL
FT                   HVPIAWATYVLFIIAFILSILYLVTQDKKYDKYAALFVYTALVYAFMVLATGSAWAQES
FT                   WGSFWNWDPRETGVLILFIAYLVYVAIRKSVQDPDRRATISAVYSIAAFATVPISFIMP
FT                   YVMEGSLHPTLQATKGFITQPQVSKFFFAKVLLTVIEAVLIPVVVGMGYSREFFKAAVA
FT                   TAAILLVGAALAYPWGLTGRVVEAKLQSGTAELTAIYKGEKIKIKGSLELVINNNGQKI
FT                   KVVVKDTEGLPKPEFVTVPGFAKGSNLTVNYEGRELWPTALGHLVKVENERAVALNPFC
FT                   IPWTLFIYAIGFLILAYVLPREIAY"
FT   gene            46305..46700
FT                   /locus_tag="Igni_0048"
FT   CDS_pept        46305..46700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81232"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I0"
FT                   /protein_id="ABU81232.1"
FT                   /translation="MVCPYAKVKSIFRKKVICELLGSEVNHKKYPCLSGNYERCPIYEE
FT                   FKHREGAKETELIAPTGKEAESDEPLEKMVNEEVVKAKRFYDPKKGEEPPTCYDCLYFS
FT                   PTTRYCLLLRKKVPNPEEPECRRSKAS"
FT   gene            46676..47461
FT                   /locus_tag="Igni_0049"
FT   CDS_pept        46676..47461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81233"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I1"
FT                   /protein_id="ABU81233.1"
FT                   /translation="MSPLEGFLAVYRGFVWVVKGVDVCEEGVIAYPRYDLKGRKLEKDV
FT                   VDNLVRSALELTDCAPRPVPLLPLGETELVDPRHLLEADPAAKDFASLFPCEVGLTGSR
FT                   ALGMGGGDVDLVVYDESCFNDVIETLRELKAKGEIGPYEGKWDALGPRARRKRKEYSVL
FT                   EGVWKGIPYSIRLVKGPRSPRRPVAVAQVIRRGVVVRSDPYTPTQIVLHDGTVVESLRL
FT                   QHAELPRGYEVVIEGILEVRADGVRVSLPPGGRLEILAP"
FT   gene            47461..48195
FT                   /locus_tag="Igni_0050"
FT   CDS_pept        47461..48195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81234"
FT                   /db_xref="GOA:A8A8I2"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I2"
FT                   /protein_id="ABU81234.1"
FT                   /translation="MSLAVALEAGICKPGNVCPERAGSFSYPDILVDAFELQWACRLSQ
FT                   RGAPLGLVYREALGAQRSTLTGYVILAVPLMRHLSKGLDATKRALEDLKASKVYDAQLF
FT                   LKSLSETGLSHYKKVEGFVDADEWWTFEGNLWDLFLYLSKFDDLFREIVKGYPLSLEGA
FT                   LRLIREGYSKRTLEGLQRFVLSNIIDSLVARKHGYRVALGLNRAAKEGYHSWYIEDKGI
FT                   NPGTAADIIAVSILLALAEEAR"
FT   gene            48192..49349
FT                   /locus_tag="Igni_0051"
FT   CDS_pept        48192..49349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0051"
FT                   /product="SAM-dependent methyltransferase"
FT                   /note="PFAM: protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81235"
FT                   /db_xref="GOA:A8A8I3"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I3"
FT                   /protein_id="ABU81235.1"
FT                   /translation="MKVEVTSEAIRKAKLVGPVIYQKHVKGKAEVGELVEVEGEGGKLC
FT                   ALWDETGPVRLRVLFWHECPGSVEDAIREALIRAYRTREANGSASWEAYRLVNSDGDSF
FT                   PGLIVDVYKDLAVLQSSSLAIDKHIMTIAKIVKDVTGAEAVAEKSSQRVRAKVGLPPRE
FT                   GLLIGNKKETVVDEEGVKFKVSIEGQKTGLYLDQRENRVYAERFSSGSKFLDAFSYTGG
FT                   FGLHALKAGAREVTFVDEDPWALRVLRENLRLNNFDEGKVRVVREDIWSYLRARLKRRE
FT                   TTEVASYDPPAFIPTKEKLEEGMRDYMRLYVYALKLADPSSVVMLSSCSQPFTRDMFLW
FT                   TIAKASYFSNRESRVFAVRGASRDHVFPPGSTYMEYLKFAALSVF"
FT   gene            complement(49321..50190)
FT                   /locus_tag="Igni_0052"
FT   CDS_pept        complement(49321..50190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0052"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81236"
FT                   /db_xref="GOA:A8A8I4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I4"
FT                   /protein_id="ABU81236.1"
FT                   /translation="MMEKLRGRTEGLLKLAARPLSKLSPNVITLLSIPFAATFTYLVWK
FT                   GMVLEALPFLLLSTLFDALDGAVARLTGKTSKAGAFLDSAVDRLNDTIIFYSLPALGVP
FT                   WTVTYLWITGSIIISSVRAAAESEGVALAGKGIMERGDRLLALFSLILVYLIEQHFTTM
FT                   ENFRYVPAVAAGITALIWLTIAQRLYYSNSLRSFWVGFNLSAITIVLFFYGWWDPVGTL
FT                   GVSGGLALVYLILKVTALGEKFPLSKADSVIDSAALLSFIVGKGLASWLLWFVRCCYYF
FT                   KILRGRRT"
FT   gene            complement(50209..51969)
FT                   /locus_tag="Igni_0053"
FT   CDS_pept        complement(50209..51969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0053"
FT                   /product="DEAD_2 domain protein"
FT                   /note="PFAM: DEAD_2 domain protein; SMART: helicase c2"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81237"
FT                   /db_xref="GOA:A8A8I5"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I5"
FT                   /protein_id="ABU81237.1"
FT                   /translation="MLRPWQQYFVNRSLEELKEGKKVIAINSPTGSGKTLTALKIIESA
FT                   IELGIAKKSLFAVRTVTQLLPPLRDVERFGLRLKAVPLIGKEKACPAGYAGVNLCPQCS
FT                   WRDRVGEPPASWTEVFSWIESTIRSFKCPYVTLKELSKDADLVVLSYQYLSPDILPKLG
FT                   TDLKEALIVVDEAHNLLKFVRERKFKLDRAIGLLSSYPKLFKSLNSTEGVKEVVEVMKT
FT                   FSTTILSLINVLRRLKGFSVVERPLRVTNFFEVSTSEIKIIVEALERALPKLVLEAHPA
FT                   ADLAVQIRDVLEAFTLLESGHGAAYLEGDSLVIRELKPWISKYVNESKGLILLSGTLHS
FT                   KQFLETVLSAEVVYLDLFDNEYLRNSYFNLFNPNNVMYLFITDYSSKYKLRNDPVMMER
FT                   RKRIELACYRMVARSGGTCLMVYPSYSALSLAKPHLSELSERGEVNVIVSERGLGHKVL
FT                   EAAKRGASLVAAVAGDQLTEGVELVDEGGSSIIRAVAVLGAPFPSPSPYLEDFSKAVSK
FT                   GDWKKTLEKLYEEEMLVKVKQAVGRLVRSPSDSGVVILADTRFLNYKEVLAKWYPKRFL
FT                   SSSELLEMVS"
FT   gene            complement(51990..52433)
FT                   /locus_tag="Igni_0054"
FT   CDS_pept        complement(51990..52433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81238"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I6"
FT                   /protein_id="ABU81238.1"
FT                   /translation="MGSTGLPREVSRVSGQKAFELFEKAKTALARAMLSSKVVDPDKVT
FT                   AIRYDDDSVLWIFELENEDKAKGLVNWVYNTLTALKDMMDIEKVTKTKVGNKDVIMVYT
FT                   TYPNFKESYPSAFWSSGNKFFWLESGHDTESFEELLWELLGRS"
FT   gene            52482..53213
FT                   /locus_tag="Igni_0055"
FT   CDS_pept        52482..53213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81239"
FT                   /db_xref="InterPro:IPR007366"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I7"
FT                   /protein_id="ABU81239.1"
FT                   /translation="MFRYFGILSPGSSIKEGEWTVELRCSKEGNCIYRRQSSETGESVE
FT                   EILGGVDELRLYPDIYGGENVYYLYLDLERELLLAPDSETMITVGVPIAIRVVMIKRFM
FT                   FRDVSTGKEWVEERKYEVDRIPLSKVTYALYGSPERGILARYYKAKVGSWLILKEAPME
FT                   VYIFNNTQRVEKVKRIVFPTLLPKLFFVPGSGKVDVSPIAVEIERGVATIRRLRDTPRK
FT                   QGYVEVPDTGKVPRWVAIFGL"
FT   gene            complement(53197..53970)
FT                   /locus_tag="Igni_0056"
FT   CDS_pept        complement(53197..53970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0056"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81240"
FT                   /db_xref="GOA:A8A8I8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I8"
FT                   /protein_id="ABU81240.1"
FT                   /translation="MTPVDVLSIVVLLSIYLIIRKVGEDKLSELLVRSLGDENLAFMGV
FT                   RIITYLIYALLIMAFLSAIGVPIQNLLMAGGILTLAISFAAQTVISNAISGLFLMIERP
FT                   LKIGDFVELKNSGISGKVQSFNIFSTMLLTIDGELARIPNSTFFNDIIINKTGTVARRL
FT                   QVRVGVSYSDALKALDVFRSYFSKHPDVLQVPEPEIFIEDFGDFYVLIRLNLWVPTKKW
FT                   YDMYKSIREEIFKVCQKYNIEIPFPIHVVYLKDQK"
FT   gene            54109..54954
FT                   /locus_tag="Igni_0057"
FT   CDS_pept        54109..54954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0057"
FT                   /product="L-2-aminoadipate N-acetyltransferase"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   lysine biosynthesis enzyme LysX; PFAM: protein of unknown
FT                   function DUF201; RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81241"
FT                   /db_xref="GOA:A8A8I9"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8I9"
FT                   /protein_id="ABU81241.1"
FT                   /translation="MKVGIAYDHPRWEEKHIIELLRSRGHEVIEYPLRHSSFEIGVSSE
FT                   LPDVVVQRAVSSARAISFTAHMESMGVPVVNSLHTQLVCDNKVLTDSALNKENVPRPRT
FT                   FIAYDLESALEAARELGFPLVVKPLQGSWGRLQALVKDEDALKAIIEHREAMPSPQFKV
FT                   HYLQEYINKPNRDIRVFVVGDSVPVAIYRISEREWRTNTALGGRAEKAEVDEELEELAI
FT                   KAARAVGGGVLGVDVVEDPERGYLVIEVNSNVDFKNTYKVTGFDMGEAIIDYALSLVKR
FT                   "
FT   gene            55001..55720
FT                   /locus_tag="Igni_0058"
FT   CDS_pept        55001..55720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0058"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81242"
FT                   /db_xref="GOA:A8A8J0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR040825"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J0"
FT                   /protein_id="ABU81242.1"
FT                   /translation="MTLNKGDIVVLDYTLRLADTGEVITTTSEEEAKKAGIYKEGEKYE
FT                   PVIVVVGEGSLLPGLEEAVVEMKEGEEKEIEIPPSKAYGERDPAKVKVYSLREFKKAGV
FT                   KNVYPGMVVRIGNELGIVRSVDGGRVRVDFNNPYAGKTIKARVKVIKIVKEPKDKVEYL
FT                   IKRRLPEAEMKYEDGAVTITLPLKYILADNIQAVKVVLADEIFKWVPEVKEVKFVEPIK
FT                   RPEGEPEGEQESEGTQS"
FT   gene            complement(55751..56284)
FT                   /locus_tag="Igni_0059"
FT   CDS_pept        complement(55751..56284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0059"
FT                   /product="putative transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81243"
FT                   /db_xref="GOA:A8A8J1"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J1"
FT                   /protein_id="ABU81243.1"
FT                   /translation="MTIVRIPLDVICVKTGVLCPSCQRKVDEGIVKPIEVDIMRVLLNL
FT                   ENEIKELRNATYEKTYQVDNTLIVVIKVDKASNELAKKIRQALVKELGRDYRIRVLLKS
FT                   EEDPRQLVSQLLIPLTVKGINIMWLPDGTQKYVVNVRGPLRRLAIPKEQVEKILEEILG
FT                   APVEIRVETPRRSF"
FT   gene            56438..56542
FT                   /pseudo
FT                   /locus_tag="Igni_R0004"
FT                   /note="tRNA-Pseudo1"
FT   tRNA            56438..56542
FT                   /pseudo
FT                   /locus_tag="Igni_R0004"
FT                   /product="tRNA-OTHER"
FT   gene            56585..57256
FT                   /locus_tag="Igni_0060"
FT   CDS_pept        56585..57256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0060"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81244"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J2"
FT                   /protein_id="ABU81244.1"
FT                   /translation="MRILVVSDVHCEEKDNVRKYLEAYNKSSPDVVLGAGDWGDCEDYS
FT                   FLEGQEVITVYGNHDKVYELKKYAKVLDGDVVELGGLKIGGVSGIVSPKGTPSKSNTPR
FT                   KRPEEFVKVAERIKGVDLMVMHEAPYMPMVFGKMWRSVGPLTALTAVQEVKPKVLVVGH
FT                   LHKAPSLHAKVDRCHVFHVDTSSGGYVILDTDTMVAEGFVNNIRTFKVKMEELLKQDAI
FT                   I"
FT   gene            57314..58639
FT                   /locus_tag="Igni_0061"
FT   CDS_pept        57314..58639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0061"
FT                   /product="TOPRIM domain protein"
FT                   /note="PFAM: TOPRIM domain protein; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81245"
FT                   /db_xref="GOA:A8A8J3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8J3"
FT                   /protein_id="ABU81245.1"
FT                   /translation="MVKYIIKALVEVDGPVDEHDIIGAIFGQTEGLLDDFDLRELQEKG
FT                   RIGRILVKLQRRGNKAVGEIYVPSNLDRVETALVAAMLESVDKVGPYPARISVVEIIDV
FT                   RAEKIKKIIERAKEILKKWSQEKSVDIREILKEISETTKKSQLIEYGPEKLPAGPGVER
FT                   SDTIIIVEGRADVLNLLRYGYDNVIALGGATTKVPETIKKLAKEKIAIAFVDGDRGGLM
FT                   VLKNLLSQADIDYVARAPPGKEVEDLTAREIAKSLSNLIPASKMKEELLKVEKLQKEEV
FT                   KEVAEKAEKVEAEEVVKKEEVAERGEEMESKAEGAEQPTATALEKAAAKEEVKQEVKTE
FT                   EEKVKEYVMFIPDSVFEKAKEITGTLRSVLYDSQWNIVAEVPAKDVVSAIEEKGAYAVL
FT                   HDGVITQRMLDVMSLKGGRLILGRRVARVSKRPKGVFVVLLS"
FT   gene            complement(58650..61010)
FT                   /locus_tag="Igni_0062"
FT   CDS_pept        complement(58650..61010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0062"
FT                   /product="replicative DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase Pol2; PFAM: DNA polymerase
FT                   B, exonuclease; DNA polymerase B region; SMART:
FT                   DNA-directed DNA polymerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81246"
FT                   /db_xref="GOA:A8A8J4"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J4"
FT                   /protein_id="ABU81246.1"
FT                   /translation="MKFYVLDVSYELEGNKPVILIWALDENERRVLLKDKRFRPYFYVL
FT                   LKENADLERLKRKLSLLSKPKSPIISLEVLKKKLIGREKTVIKVTTVIPESVREYREEV
FT                   KRLEEVADVLEADIRFSMRYIIDTGLRPCGWAEFEVKELGPEKSYRVETVYEVLNGPEA
FT                   LNIDVKPKLKTLAFDIEVYNKSGTPRPERDPIISIALASEGSVVSKLSQDKNDKDLIVW
FT                   FKKEMLERDPDVVVGYNSNSFDWPYLIERSKVVGVRLDVGRKVGVIPTTGAYGHVSVPG
FT                   RLNVDVYDFAKEVYEVKVKTLENVADYFNVMKKDERPLIPHHLIYQYWEDPQKRDVLRK
FT                   YNEADALSTLMLAELFIPFGEQLSYLTGLPLDQVMAASVGYRVEWYLMRVAFVTNELVP
FT                   NRVERKVASYKGAIVLRPLKGVHENVAVLDFSSMYPNIMIKYNVGPDTLVRPGEKVSPD
FT                   EVYVSPAGYMFKKRPDAFFKRSLVTLLNLRKEIKERMKSLSPEDPLYKLLDNRQKAVKV
FT                   LANAHYGYMGWPHARWYCRECAEAVTSWGRELILKAIQMARELGLKVIYGDTDSLFVIY
FT                   DKEKVEKLIERIEKELGFEIKIDKIYKKLFFTEAKKRYAGILEDGRIDVVGFEAVRGDW
FT                   AEVAKEVQEKIIEIVLKEGDVNKAVEYVNSIIEKLRRGEVPIEKLVIWKTLEKSLDEYK
FT                   SEPPHVAAAKRAIERGYEVKKGDKVGYVIVKGVGKLSSRAWPWFLVQKEMIDYNYYIDH
FT                   QVIPAAMRILGYFGITEARLKGRKDGLWKFINK"
FT   gene            complement(61050..61421)
FT                   /locus_tag="Igni_0063"
FT   CDS_pept        complement(61050..61421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81247"
FT                   /db_xref="GOA:A8A8J5"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J5"
FT                   /protein_id="ABU81247.1"
FT                   /translation="MSIDLTLLYVGIVLAVIVLNVAAYFLIYQSMISAYREATHAIISE
FT                   YDKVTSLYLQLYIEYLKMLRTYLNATISNGFVPTSLPSPPSVSLPQLPLSITVSTPSQV
FT                   SVPISSWPPFPPAANSSTT"
FT   gene            61482..62123
FT                   /locus_tag="Igni_0064"
FT   CDS_pept        61482..62123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81248"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J6"
FT                   /protein_id="ABU81248.1"
FT                   /translation="MAIHARAIRLGIPVFDDRVGNVSLGSLEVLVGDKDSYVHLFNYLI
FT                   AKAWVDRGERVAFVIDKGFVNVHRVVAESFGIDAMGLEESNMWKYEEVDNSDDAMTKAI
FT                   ELFANFALVLVDATSWFDPDLTLLHRTISTLINSNSIMVITLIDERVKPEALGILEANA
FT                   EYVVRFETYWANLRVERIMKLCRSRHPTNPFAAYYSVTSDGIEIEELKRL"
FT   gene            62158..62478
FT                   /locus_tag="Igni_0065"
FT   CDS_pept        62158..62478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0065"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81249"
FT                   /db_xref="GOA:A8A8J7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J7"
FT                   /protein_id="ABU81249.1"
FT                   /translation="MPPKNMARIKMWSTDVKSIEEVAKQIREIAERSGVEVRGPVPLPV
FT                   KRLEISTLRLPHGEGTKVFDHWEMRIHKRLIDVELNDKVMRNIMRIRVPSNVYIEIQIK
FT                   KV"
FT   gene            complement(62806..62894)
FT                   /locus_tag="Igni_R0005"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(62806..62894)
FT                   /locus_tag="Igni_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(62924..63997)
FT                   /locus_tag="Igni_0066"
FT   CDS_pept        complement(62924..63997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0066"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81250"
FT                   /db_xref="GOA:A8A8J8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J8"
FT                   /protein_id="ABU81250.1"
FT                   /translation="MKVAIVGNGFAALSAAHAAEKLGVEVVQIGPKKFEYLPSITKVLS
FT                   GRKSAEELEVVPKFRWEHVDALVKAVRETNSGVEIVLKDDKTITADYAVVATGASAWVP
FT                   VEGAFPLYRVEHARKLKKELERLGGEATIAVVGTGLVGLEAAGELVWTREAGFTKYKVI
FT                   MLEAAPVISPTLPCEKVRAVVPKLLKKHKVEYHLNAMVSKIKNGKVITKDGKEYDADLV
FT                   VWAAGVKGPEVEIPCGEKDKRGFYLVDEHLRAKGCKRIYVTGDSSSGPSLKMAEEALRH
FT                   GWYAILHIAGKKTSPYKPFLTKDNPFCFITFGPNDGISVMKRVVVPGRLAPIVKEILER
FT                   IMIRWAREAKMRPPVPV"
FT   sig_peptide     complement(63941..63997)
FT                   /locus_tag="Igni_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.992 at
FT                   residue 19"
FT   gene            complement(64061..65041)
FT                   /locus_tag="Igni_0067"
FT   CDS_pept        complement(64061..65041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0067"
FT                   /product="ribosomal RNA methyltransferase NOP2"
FT                   /note="TIGRFAM: putative RNA methylase, NOL1/NOP2/sun
FT                   family; PFAM: Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81251"
FT                   /db_xref="GOA:A8A8J9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8J9"
FT                   /protein_id="ABU81251.1"
FT                   /translation="MKHQEILKKLKDLKITKEDKLLARKYGYLPYMVRRYREMLGDPLP
FT                   LLEAFEVPPKPTIRCNFLKVGCGKLKERLESRGFVLKQVLWCPHAYEVLREPFSLSSTP
FT                   EHLDGWFYIQDKASTLPPLVLGPKPGETVADLASAPGGKATHLAQLMGNSGRLILIERR
FT                   RDRAKALMSNLERMEILNANVIIDDAYNASKYGPFDKALLDAPCTGEGVIARDPSRKRS
FT                   RRPEDLALMHKVQAMLLNRALDSLKPGGELVYSTCSIAPEENELVIETILKTRDDVEVL
FT                   DGGEAGSPGIEEYLGWEFPFAYKCRRLWPHVHGSEGFFVCKLRKL"
FT   gene            65081..65857
FT                   /locus_tag="Igni_0068"
FT   CDS_pept        65081..65857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81252"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K0"
FT                   /protein_id="ABU81252.1"
FT                   /translation="MWVVVGNTMAARCVGGTVIDPVQSEPYPLRKARVGGKEVPMIPML
FT                   VPQCPDPLVCVEVKGDPVVLKDGSHGKACGDLRCQAPWPLRWKDMEKRYLVLGIKSRGA
FT                   EVNIVPGRVKWLKEGKLKVGWKVIEFERLIWTAPYPYLASLLGLPSPKWKEATVALFSS
FT                   EAEWSLAYHLADSNPFYSILRVGEVTWALGPGTFDALSAVKHLERKGYLKLKGNIVSYV
FT                   IDYYALEEYEPSPPKWVELLGRTAEWKEKSLIETIC"
FT   gene            complement(65854..66576)
FT                   /locus_tag="Igni_0069"
FT   CDS_pept        complement(65854..66576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0069"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81253"
FT                   /db_xref="GOA:A8A8K1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K1"
FT                   /protein_id="ABU81253.1"
FT                   /translation="MIVISFLISVLTGIVASLFGVGGGVLAIPVMVLLLGLSPPEAVAT
FT                   NSVIIIVSTLLSAFFHWRQGTLRKEGVWIGVGGVLGTLLGNALFLYISKVGAMKTVLGI
FT                   SFILIGILMMLDITKRSQTKSFTAKSLAVIGFFGGTFAALVGMSGGVLLNPILVLLGVD
FT                   IKYAIGMSVTALPLITVASAIPKVLAGYAKLDVAAVWIPGLIIGTKIGARLMKTMKSKT
FT                   LKRAFGIFMILIGIKLLL"
FT   sig_peptide     complement(66493..66576)
FT                   /locus_tag="Igni_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.700 at
FT                   residue 28"
FT   gene            66725..68026
FT                   /locus_tag="Igni_0070"
FT   CDS_pept        66725..68026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0070"
FT                   /product="rRNA biogenesis protein Nop56/Nop58"
FT                   /note="PFAM: Pre-mRNA processing ribonucleoprotein, binding
FT                   region; NOSIC"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81254"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K2"
FT                   /protein_id="ABU81254.1"
FT                   /translation="MTKKYLVQHALGAFLLDPQGNVERYELNTKDVDEAAEQALVMEGW
FT                   VRGMREGEEKRAGLAAPARKLLENLKNENFEGVLVFETDSESREAAKLGFEVAVEPANE
FT                   PARALRSQVASLAVKYGFVDSEKEFYEWLRRVDIEVVRRKLRSVAQKRDLLAAQAVRSI
FT                   DDIDKVVNLMVARLREWYSLHFPELDKLVKDHEAFVKIVAELGGRDNITKEKLLELGFS
FT                   EALAEKIAEAAKKSTGADLTETDIEQLQKLASIIMSLYNLRRDLVDYISYIMKEVAPNV
FT                   TALVGPVLGARLISLAGSLENLAKMPASTIQVLGAEKALFRALRTGGKPPKHGVIFQYP
FT                   DIHRSPKWQRGKIARALAAKLAIAARTDYFTGRNIGERLREELRARIEEIKRVYAKPPK
FT                   KTEEEKKAPPAKRAKKRPPRKGGKKGPRKGGRRK"
FT   gene            68032..68724
FT                   /locus_tag="Igni_0071"
FT   CDS_pept        68032..68724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81255"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K3"
FT                   /protein_id="ABU81255.1"
FT                   /translation="MPRRLEDWRDARAPLFCHVSEVIDEFGEVVHWKGPFDEESLALYS
FT                   VFGIEPSRARANLNVGEPVAVVRVPPPHSKFNAVRNLMKLEHDPALVVKKGDRIFVEPA
FT                   LRHPKGFASLREPLKVAKEMSREVGQPVVLLKEVPGHCCWFVAPLAWTALPLNDAGAFR
FT                   GGVPIGVSVPLFQPLEGCWEYEVEMEEVEGEGFPPDVLNRIKVNLSDKIKMKLVPLRKV
FT                   MIRMFGKP"
FT   gene            complement(68721..69644)
FT                   /locus_tag="Igni_0072"
FT   CDS_pept        complement(68721..69644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0072"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; SMART:
FT                   serine/threonine-specific protein phosphatase and
FT                   bis(5-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81256"
FT                   /db_xref="GOA:A8A8K4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K4"
FT                   /protein_id="ABU81256.1"
FT                   /translation="MKLEDLPIEDLGAFAEAVETLTEDEVTKLLEEAKKHLEGEWPFVV
FT                   TQPDARTVFHGDLFGDLVSVYDVWNVLGLKEVLENYKLVFLGNYVDRGPKQLETLLLVL
FT                   SLKARRPSEVFVLRGNHEPYRGLEPLPHDFPQHLAKRFKGWKDVLRAARSVFEALPFAL
FT                   VVDGAVVAYHGGPATVLLRRGCRGLECVFGEPRAEVVEEILWNDPANICGWEDGPEACW
FT                   APSPRGRGFLWGPGATRYLLEALEVSYVVRGHTPVDGVKFFHRKRVVSVFTRVGSPFFN
FT                   KRAGAWAPDFLDPSWELEPERWAVIV"
FT   gene            complement(69864..70889)
FT                   /locus_tag="Igni_0073"
FT   CDS_pept        complement(69864..70889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81257"
FT                   /db_xref="GOA:A8A8K5"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K5"
FT                   /protein_id="ABU81257.1"
FT                   /translation="MNFLFTTSWYKFKFWYGFQYPVFLITMMVVAAILNTSKLKNYLCA
FT                   GVWGAQLALVLALAAVADPLAYWAMIYEYYYYYASEGKPAPYPIYPWMSLTTYRPIAPN
FT                   NLHCFWKALELYEVASKYLKPGERVSVPDTLMALFSCKYKPDHTGNMAMKDWYWNAHLT
FT                   PQKIAAILTTWLNARVFVNMYGTVRTMDIPKYIWSEVVNEAIMVRDAGYVFIMNLTKLA
FT                   KLNSLLNKRVIWLNNGTFVIVETNKNVNGTKLFRAKYGLSSEDGKLVPALYDYVPKYGI
FT                   NNITWLEGYIYVDVNGTYAFYGSPSVLEIRIDNITLKPTKRVEVMQDFVHASYFGSLEL
FT                   N"
FT   gene            complement(70886..71686)
FT                   /locus_tag="Igni_0074"
FT   CDS_pept        complement(70886..71686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0074"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81258"
FT                   /db_xref="GOA:A8A8K6"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K6"
FT                   /protein_id="ABU81258.1"
FT                   /translation="MQLRKLALPTYIILISVVFGSYSVLRFLDLRFYGDAPTSILAICQ
FT                   YPHHKGVLNVHFSYALLLFKPLCMVLPCWLFVATLAFLQGVGLGLATYAVYALARELLG
FT                   SWKLALVASLAYALHPAMHGIVSFDIHPEAYALPLIALGVRYLVLDTSPLKGYFLMIFA
FT                   ILFKETAAFPLLGVMLWRVATKKVKHNVEKAFVLLVLVAAPLLLALILELGLVHLQFDR
FT                   WAIFFEKSSARFNDVKVQFLVVALLSVFPRWSPTPTRCSGSRTS"
FT   gene            complement(71690..72067)
FT                   /locus_tag="Igni_0075"
FT   CDS_pept        complement(71690..72067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0075"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81259"
FT                   /db_xref="GOA:A8A8K7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K7"
FT                   /protein_id="ABU81259.1"
FT                   /translation="MANVRFGVALPKELAERLDEVAERLNVSRSKVIEMATSAFINYLE
FT                   ALEDPNKATIFVVIAPASELEKVVRALEPLEAPAFACVIMKSKYVILLINVNGQEVSVL
FT                   ETLRKLKGAVYPIVYPGSNGV"
FT   gene            complement(72129..72314)
FT                   /locus_tag="Igni_0076"
FT   CDS_pept        complement(72129..72314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81260"
FT                   /db_xref="GOA:A8A8K8"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K8"
FT                   /protein_id="ABU81260.1"
FT                   /translation="MADALRVTIAAVLLLTAIGIISQVGNFLALILKFPQLAKWTNVLT
FT                   VVLSALVISWWVLEVG"
FT   gene            complement(72307..74220)
FT                   /locus_tag="Igni_0077"
FT   CDS_pept        complement(72307..74220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0077"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /note="TIGRFAM: putative aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit; PFAM: GatB/Yqey domain
FT                   protein; GAD domain protein; GatB N-terminal region; GatB,
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81261"
FT                   /db_xref="GOA:A8A8K9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004414"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8K9"
FT                   /protein_id="ABU81261.1"
FT                   /translation="MNLNYEELGLKVGLEIHQQLKTERKLFCHCKPELAEEEEDFDVIE
FT                   RRLRPVRSELGEVDVAALFEWKKGRTYVYRAPVGHSCLVEADEEPPHEADRDSIIIALA
FT                   IAKAFNSKIIDEIHVMRKMVIDGSNTSGFQRTMLVALGGELNLGDKKIGIETICVEEDA
FT                   ARKVEEKEKVTVFNLDRLGIPLIEIATEPTITSPQEAKRVALRIGQMLRLTGRVKRGLG
FT                   TIRQDLNVSIKGGTKTEIKGVQKLQIIDKVVEYEVIRQLRLLEIRDELKRRGVKEEEIL
FT                   SQPIKDVTEIFKDTESKLIKRSLSKGSRVYAIKLPKFKGLLGKEVQPNRRFGTELADYA
FT                   RFWAGVGGIIHSDELPGYGISEDEVEDLKEALGCGEEDAFVMVIAPPPDAKKALEAVKE
FT                   RAAYALKGVPEETRAANPDGTTRFLRPRPGSARMYPETDVPPIVVTEDMLTKAEKLKPK
FT                   NPIELIQELITDYKLSKDMAEKVISSERFDLAYRLIKKYKNKLSANLVARTVVDTLREL
FT                   EREGLETDKISDEAIEKVLDEVAEGKVAKEAIPEVLRKVAGGASVEEALKEFVTASQIN
FT                   VEEVVKKVIQQNIEEIKKRGVERSFGLVMGKAMAELRGKVDGKVVAETVKRLLKELGEE
FT                   GG"
FT   gene            74402..75472
FT                   /locus_tag="Igni_0078"
FT   CDS_pept        74402..75472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0078"
FT                   /product="DNA primase large subunit"
FT                   /note="PFAM: DNA primase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81262"
FT                   /db_xref="GOA:A8A8L0"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L0"
FT                   /protein_id="ABU81262.1"
FT                   /translation="MLYARYPFVGSVSKLSKRMFGVEMDVEELLDLYPNAIDLAKAMVE
FT                   GRGPAEDAGCDDLCAVLAYRIALVLVAAARSNWLRNNFAVNVAKRASEFFKKEGIETVV
FT                   GVLKACGFWAEVLREPLRVPLRQQRGAVYAEEYLVRTTLMDYVRLAKRFLSDPTWKVVN
FT                   KALLGGFVYLKEEELRRLAEEAVVIKVLEDLRELGDVDPQALPERFKGVLEELKTKYMA
FT                   KRSSADIKIKGFEPRALPPCVRSIYERALQGDNLSHQERFTLATFLLNVGKDVEDVLEV
FT                   FKNMPDYNERIARYQVEHLAGLRGSHKKYSPPSCKTLVSWGLCPGKDECKGDHPLKEYW
FT                   RRLRRLTKAPSREPRP"
FT   gene            complement(75438..76121)
FT                   /locus_tag="Igni_0079"
FT   CDS_pept        complement(75438..76121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0079"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81263"
FT                   /db_xref="GOA:A8A8L1"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L1"
FT                   /protein_id="ABU81263.1"
FT                   /translation="MSPMIYIEGVEVSWLGHDGFKLTDGELTVAIDPFRIVSASNQKAD
FT                   VLFITHEHFDHCSPKDIAQVISPETVIVAPPIAEDCLSVFPNEKVFVAPFEEGEVVGVK
FT                   FRTVPAYNVNKFRAPGVVFHPKEDGRVGYVFELGGVTFYHAGDTDVIPEMAEVVTDVAM
FT                   LPVSGVYVMTAEEAAEALKIIKGVQVAIPMHWGTIVGSIDDALRFKELAEALGVKVVVP
FT                   EREPW"
FT   gene            complement(76162..76518)
FT                   /locus_tag="Igni_0080"
FT   CDS_pept        complement(76162..76518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0080"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81264"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L2"
FT                   /protein_id="ABU81264.1"
FT                   /translation="MVCKPKVVKWDEVEAKEVPREVATKTTIRWVIGPGEAPTFYLRVF
FT                   EVEPGGEIFEHSHPWEHEIFVLNGKGIVRINGEEYEVGPGTVLYIPPCSKHYYKNTGDE
FT                   VLRFICIIPKEGAK"
FT   gene            76719..80897
FT                   /locus_tag="Igni_0081"
FT   CDS_pept        76719..80897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81265"
FT                   /db_xref="GOA:A8A8L3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L3"
FT                   /protein_id="ABU81265.1"
FT                   /translation="MDCGPLPKRAPSITGKDVSNLLKELWEAGVKIREEVENVVRSFLN
FT                   MVANAEETVSMFVIGEWGEGKTSVFDGYMKALKPPNVVLMETSVKRVVSSIRNMKHQPG
FT                   QSSAATFLAALLHSLAMEYMEKGEKLIEPYEGGPVHEYAKKALDELASKFPGKKFVVFI
FT                   DEFEEIVSPSNKDVVKEIINGLIELINGQFGYMQEKYPGILHLVIAMTPYAYHKALSLA
FT                   DIDESLKGRAERRLHFKLELRSLTRSEAYKLVGSLFKYSYGEEFSPVPPQFVNTIYTAS
FT                   QGNPGALTSLTNFVMSSLVKDGCTVPSKNPEELVSILSGATVFTYVGSSKALDKLYYEK
FT                   ALLPLTYGEEDKRKVLAALAAYYYPLSERELDELSGVKGAKEALEVLDQRASLSSEPLV
FT                   STVWRTSDYQKAFNVFRTTLKSLIPDIDDDTLKMLVEELTYPKGLWSEEYYLVLPGEGE
FT                   ESVLEDVLSKEKAVVDARKLVNFLKRKMEEEGVTFEKAYMLSRKHALNLYPPPAVAAAS
FT                   FIKDPQLRAKAWKEALNALIKGDINLDKVFAEVIINSFKGTIVGRLVNVALGDVQLRIY
FT                   PKVILSLDSKALEEVAKEAKRDGAHLMIILTKPELYETIKDKASLLPVDAVVLEAREAK
FT                   LVQMAVYELYARKPERRAFVDAEKAALTLKQIGDEIGVPKAIEKWIDKARQEGVIVEDF
FT                   KRPSGASEEAISDAYAFYLAYPKDVLTTEDVFEHVIKTVRRFIIYGRGSRRKAPFSSGL
FT                   DIENVRGLKRFEEDLVSAGLLERLEDNKLRITISKVEERLLKLLKEKGGKAAWRELEKE
FT                   FIVVSHNKRILSDFYLKILERRGLVRVDRRGNDPYFVSLVNTKSLVEELENWLEKINEI
FT                   WSSNGEAWKSYAHIVVSKKKEDNVIVLDEIKDYVTKGVVSLRSEASKATVARRAAFLIS
FT                   LSRYLVETLYPVTHKAWTEANDLMDSTSSSVTSTISKIRSVLSKASGEVGVPVLDAEEM
FT                   KESVMIKKMLRKMDELADKYFTREELEKLVAEMRKEGVLPDKFYFERFYDPREWKKASY
FT                   FNVKYYILERHAEEIKNELEKINILIKEIDNMISRMVEGRRRVEEKLKELSLKSYNSEL
FT                   ASKAYEVLLRQVMMPKEVLPDDLTVDSLEELRSTLDRALSSVSMTDQKILSVIVKLGEV
FT                   AREEEELEKELRRLKSWCSFASKFYSGTPYWDDFEGLCERLNSLRLAYESASKEVREPA
FT                   SVSELSAVLEGIKEELRKLKREAEGLLREMKEVHERAMKELERNLSELKRISRVAIKLG
FT                   LNIEDINKALSSVELKMKSVKPPGVVENVTYQTLYDALEKTRTLLTIKLRTKISQNEEK
FT                   VLSVLEKGKLDLVKLIEECKKLKLGEEEVVKALVQLAEKGLVRVVVELS"
FT   gene            complement(80811..81365)
FT                   /locus_tag="Igni_0082"
FT   CDS_pept        complement(80811..81365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0082"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="PFAM: Protein of unknown function DUF359"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81266"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8L4"
FT                   /protein_id="ABU81266.1"
FT                   /translation="MRTLLASPRGALVKDDRLLPFLLRGKTLVTVGDVTTKRCLELGLV
FT                   PRTAIFDGKTRRSQWVELRAPNGVLKAFNPPGQICLDAAKVVKKAILTSTWVKVEGEED
FT                   LLAIPALLSSENGWALLYGQPKAGVVLVEINKYTKLHFLEIIKMFDGDVEEFLREFDYD
FT                   PNQPLLGELDERLYDLLFPEL"
FT   gene            complement(81380..81592)
FT                   /locus_tag="Igni_0083"
FT   CDS_pept        complement(81380..81592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0083"
FT                   /product="DNA-directed RNA polymerase, subunit E''"
FT                   /note="PFAM: DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81267"
FT                   /db_xref="GOA:A8A8L5"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L5"
FT                   /protein_id="ABU81267.1"
FT                   /translation="MKRKPFLACMNCRFLVPRRPEVTRCPRCGSTDLTENWEGMIILIK
FT                   TDSELVGKVEYLKEPGRYAVEVGRE"
FT   gene            complement(81589..82122)
FT                   /locus_tag="Igni_0084"
FT   CDS_pept        complement(81589..82122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0084"
FT                   /product="DNA-directed RNA polymerase, subunit E'"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase; PFAM: RNA
FT                   binding S1 domain protein; RNA polymerase Rpb7-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81268"
FT                   /db_xref="GOA:A8A8L6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L6"
FT                   /protein_id="ABU81268.1"
FT                   /translation="MYRIYRFKDMVRIPPERFGEDLKKVALELLREEYEGVIDEELGII
FT                   LTVTDVDISPEGYIVPGDGGTYHEATFTLLAFKPLRNEVVEGIVVNVTKNGIYVNIGPI
FT                   DGMVHKAQLGDERFEYDAATGSMVGTSTKTVIKRGDLVRARIVQISTRRGLKVGMSMKG
FT                   PYLGKIKDAEEVKQ"
FT   gene            complement(82186..83076)
FT                   /locus_tag="Igni_0085"
FT   CDS_pept        complement(82186..83076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0085"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: oxidoreductase domain protein; CoA-binding domain
FT                   protein; ATP-citrate lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81269"
FT                   /db_xref="GOA:A8A8L7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8L7"
FT                   /protein_id="ABU81269.1"
FT                   /translation="MVVLVDENTRVVVQGITGRYGKFHAEQMMKYGTKVVAGVTPGKGG
FT                   QEVLGVPVYDTVKEAKENHPEINTSIIFVPAGGAADAIIEAADAGLDLIVVITEGIPVH
FT                   DSMRAIRYARSKGSTVVGPNCPGVISPGKAKVGIMPEKYFVPGRVGIVSRSGTLTYEIA
FT                   YQLSKRGIGQSTAIGIGGDPIIGLDTVEAVKLMDKDPETDLIVVIGEIGGDAEERLAAA
FT                   IKRGEIEKPVVAYVAGRTAPPGKRMGHAGAIISMGAGTAESKVRAFREAGVPVADIPSQ
FT                   VPDLVVEKLKELGKL"
FT   gene            complement(83094..84224)
FT                   /locus_tag="Igni_0086"
FT   CDS_pept        complement(83094..84224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0086"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81270"
FT                   /db_xref="GOA:A8A8L8"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8L8"
FT                   /protein_id="ABU81270.1"
FT                   /translation="MNLLEYEAKAIAKKYGIPTPEGVLIERPEQVNEAVEKLGLPVVLK
FT                   AQVPVAGRGKAGGVKLARDPDEALELAEELFSKEIKGFPVLSLLVEKAENIQKELYLSF
FT                   TIDRTNRKVVMLASAEGGMEIEELAKEKPDAIVKLPIEPEVGLKAHEAREVGKRIGLSG
FT                   QLLRQFEGIAKTMYKIFEDYDAELVESNPLAITDRGLVALDFRMIVDDNAIFRHPELEA
FT                   SRERELSELEKEAARWGFFYVELDGDIGIIGNGAGLTMATMDVVNYYGGRPANFLDIGG
FT                   GARRDRVKAAVNVLLKNPKVKVIFVNIFGGITLASEVAQGIVDALSESNVKKPIVARIV
FT                   GTAEEEGKKILKEAGIPLFESMDEAAQEAVKLAKAA"
FT   gene            84340..84822
FT                   /locus_tag="Igni_0087"
FT   CDS_pept        84340..84822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0087"
FT                   /product="prefoldin, alpha subunit"
FT                   /note="TIGRFAM: prefoldin, alpha subunit; PFAM: Prefoldin
FT                   alpha domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81271"
FT                   /db_xref="GOA:A8A8L9"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8L9"
FT                   /protein_id="ABU81271.1"
FT                   /translation="MSSANPSRPVEGVAEEKAQVGVEAKGGEEKVKLLQDELRSLLAQI
FT                   EYLRDQIEAVNTVIDDLYASLEVLDYLTKEGKGKVVLVPIGAGNFIKAKIEDTNTVITS
FT                   VGGRLSLEVPSDEAKKAIESRIAALEQVRLTLLRKLEELNRKVNELLPRVREEGGQ"
FT   gene            84833..85045
FT                   /locus_tag="Igni_0088"
FT   CDS_pept        84833..85045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81272"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M0"
FT                   /protein_id="ABU81272.1"
FT                   /translation="MKVFGPKGRGAEPPEVKAAELEEALKLIKEGKAKTAYKVFGRVIL
FT                   EVPLEEAERTIRAELEELKKRLEGG"
FT   gene            85094..85840
FT                   /locus_tag="Igni_0089"
FT   CDS_pept        85094..85840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0089"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81273"
FT                   /db_xref="GOA:A8A8M1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M1"
FT                   /protein_id="ABU81273.1"
FT                   /translation="MKGKVYLVGAGPGGAWLAPAAAFGLLRSADVVLYDKLVDKSLLSS
FT                   AFKAEKVYVGKAPGAHALSQEEINELLIKYAKEGKVVVRLKGGDPFVLGRGDEECEALR
FT                   AAGVECEVVPAPTSATAVPACAGIPVTRRNLANTFAVATGWAAEGSERPRYGEILKVVD
FT                   TLVVLMGVTKVNEIVSDILKVRDVPAAAVTNGCTEEQKVVVARASKLPEVMVRNGVKPP
FT                   AVLVFGEVVEWACKAGTVRDVVECSL"
FT   sig_peptide     85094..85162
FT                   /locus_tag="Igni_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.609 at
FT                   residue 23"
FT   gene            85828..86532
FT                   /locus_tag="Igni_0090"
FT   CDS_pept        85828..86532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0090"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81274"
FT                   /db_xref="GOA:A8A8M2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M2"
FT                   /protein_id="ABU81274.1"
FT                   /translation="MLTLSPHGPPPFKDLEVTNVPALELVDVADASQIKEAIKEGEAVV
FT                   FTSKTGVRLVFEKLGDEALELLKGKDVVAIGPKTAAELEARGLSPIVPEEYHSGALAKL
FT                   LKRYNKVVALRSDKASKTLKDELGDKLIEVVIYKTLRRPSPKIVEAAREADAVAVSSAE
FT                   VARALIESFQKYSSIDELKKLKIAVIGPEAAKPLKELGLNFVVAPEATFEGLEEAVKRI
FT                   IRGGPGESPEER"
FT   gene            86553..86711
FT                   /locus_tag="Igni_0091"
FT   CDS_pept        86553..86711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81275"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M3"
FT                   /protein_id="ABU81275.1"
FT                   /translation="MRVKSFEGFPVEAEGVEDPEMVAAVLGEIGELMKKLNIKVVKLDG
FT                   EMVVGEG"
FT   gene            complement(86708..87322)
FT                   /locus_tag="Igni_0092"
FT   CDS_pept        complement(86708..87322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0092"
FT                   /product="DNA-binding protein containing PIN domain-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81276"
FT                   /db_xref="InterPro:IPR014856"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8M4"
FT                   /protein_id="ABU81276.1"
FT                   /translation="MIKFVIDTSAVTDPRLRQLFGVNELWEVVEKYLELMALAKLKLGF
FT                   SFYTTPSVMKEIKGFLERSMCPSEIISKLGVWILVKDVSQTEAKIPARVFLEYVAEVKR
FT                   RLDKGLRVAEESTRRAMEGGEIGEHIRNLREKYREATRKGLLDSVADLEAAILALELGA
FT                   VLVTNDEGLCKLASKLGVSCIDPLTFVKTIEEYLNLIKRHG"
FT   gene            87386..87462
FT                   /locus_tag="Igni_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            87386..87462
FT                   /locus_tag="Igni_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(87471..88118)
FT                   /locus_tag="Igni_0093"
FT   CDS_pept        complement(87471..88118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81277"
FT                   /db_xref="GOA:A8A8M5"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M5"
FT                   /protein_id="ABU81277.1"
FT                   /translation="MFTTLVVKDIKEEMRKKHELVALLSLTAALALPTSYAISGPGSVR
FT                   PYDAPFLVVIAQQAVSLIITTVLGFVLVLREAERGTIYALKLAPVPPELTVASKITSLF
FT                   LFLLPFNLVFTILTSFFSSEVFLTQGYLVYLLSLSLYMASLGALVSFMIIYTDAGTLLS
FT                   SVALAALSAPFLFSTLPQAVDALRGSPNAPFLMSSITFALVSTLLGKFLVEI"
FT   sig_peptide     complement(88005..88118)
FT                   /locus_tag="Igni_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.614 at
FT                   residue 38"
FT   gene            complement(88150..88554)
FT                   /locus_tag="Igni_0094"
FT   CDS_pept        complement(88150..88554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81278"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M6"
FT                   /protein_id="ABU81278.1"
FT                   /translation="MKTKPNVRYLLMSVSLLALFAVVGFYAGASSSYTDVSDLVKSRPG
FT                   TYLVRGDVVKWTVTPDRQLLVLYLKGKDGSTIEADVPVSYIEKKYGPLSQVIITNGEMV
FT                   VKGYWDGKVLHVEEILKGCHSAYEQPAVNS"
FT   sig_peptide     complement(88465..88554)
FT                   /locus_tag="Igni_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.506 at
FT                   residue 30"
FT   gene            complement(88603..88929)
FT                   /locus_tag="Igni_0095"
FT   CDS_pept        complement(88603..88929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81279"
FT                   /db_xref="GOA:A8A8M7"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M7"
FT                   /protein_id="ABU81279.1"
FT                   /translation="MISANPMLGENPLKIPKDRKFKKVEVAQALRWGIIAELDAINFYE
FT                   QLAEAIEDERVKKVFLNVAREEKEHVGEFLAMLLEYDEELKEMIAKGYKEVEEEVGVVP
FT                   KSIP"
FT   gene            89714..91390
FT                   /locus_tag="Igni_0096"
FT   CDS_pept        89714..91390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0096"
FT                   /product="thermosome"
FT                   /note="TIGRFAM: thermosome; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81280"
FT                   /db_xref="GOA:A8A8M8"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M8"
FT                   /protein_id="ABU81280.1"
FT                   /translation="MAAGVPVLILKEGATRTYGREALRSNILAARIIAEALKTSLGPRG
FT                   MDKMIVDAFGDITVTNDGVTILKEMDVQHPAAKLIVETAKAQDAEVGDGTTSVVVLAGS
FT                   LLEKAEPLLDQNIHPSIIIEGYKKAMEKALEELSNIAVKINPKDKEYMRKLVYTTLSSK
FT                   FVGQEAEEIRNKLLDMIIEAAYTVAVEQPDGTLRMSLDDIKIEKKKGGSLLDSQLVKGI
FT                   VLDKEVVHPGMPKRVENAKILVLDAPLEVEKPDITAKINITDPRQIEAFLEEQTKILKE
FT                   MVDKIAETGANVVITQKGIDDVAAHFLAKKGIMAVRRVKRSDIEKVAKATGAKVVTSIK
FT                   DVSPEVLGEAKLVEERRVGKDKMVFIEGAKNPRAVTILLRGASDMALDEAERNITDALH
FT                   VLRNIFMKPMIVGGGGAVEVELAERLRKFASTVGGKEQLAIEAYAEALEEIPVVLADTA
FT                   GMDTLEALMELRKLHREGKIWAGVNVVEGKIEEDMTKLGVVEPVRVREQVLKSATEAAN
FT                   ALLKIDDVIAAAPPKEGKKGKKEEGGEEEEEGGSSKFGSEF"
FT   gene            91438..92253
FT                   /locus_tag="Igni_0097"
FT   CDS_pept        91438..92253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0097"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81281"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8M9"
FT                   /protein_id="ABU81281.1"
FT                   /translation="MKWREECVRCLLDARIYDSFKGGATDKELQFILSATVGSMQLPKS
FT                   KAFRFSWKALKSVVGNVYALEKKRLLEETLSRELKVPQTFEEALRMATLGNLYDTAVGG
FT                   EYRLGKVKYGTLVTEGAEVLLNPAGTLVYAVDNLPELPYDIMVAKYFKYMGWDVILVAR
FT                   EEDYEIDATYPELAEVAQLLGWDGKLDSLPGDCTIFDPCEDAKRLRRESDLVFAKGLLN
FT                   ADAYVDYKPSEPAVLAYAAKCKPLAEAVGAEIGDGVVVLGEVLLRSFRR"
FT   gene            92257..93321
FT                   /locus_tag="Igni_0098"
FT   CDS_pept        92257..93321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81282"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N0"
FT                   /protein_id="ABU81282.1"
FT                   /translation="MRVAIVSSYPPMPCGIGIYSRDLARALAKRGHEVVVIATEYADAP
FT                   REEGDNPRVLRAWTRGGERFHYQILEALEREGPFDVIEFQYEYGLWPVIPLDSRGIWLL
FT                   RNAKAYGSVVATLHTVRFSPDPWWRRLHEELLKTSDAIIVHHFMMENALYRMLGKLKKT
FT                   FIVPHGSASLPGEKRELGYERPVYLLYGLLRKDKGLEVAVKAYELVGKGTLLLAGKPLS
FT                   EADEELVKRAEELGAARVQGFLSDELLGTLIKSSDFVLLPYEDLPNDFGVSGAFHTTVA
FT                   TGGYPLCSRVQRLAECWERAPELTFRPGDEAALAALMKAPKLPDAWGRLQSFARQTSWD
FT                   NVAKLRERIYSLLM"
FT   gene            complement(93303..93716)
FT                   /locus_tag="Igni_0099"
FT   CDS_pept        complement(93303..93716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0099"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81283"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N1"
FT                   /protein_id="ABU81283.1"
FT                   /translation="MVRAEGPAREVLELVKRCLSELESIDESLQKEDIDLNEVKKRIEE
FT                   IRPFVSAVSAKWIPEILYALALKREMSFNELKNTLGISSRVLSDKLKELRELGLVEKVE
FT                   VEGKRGAYVLTEKGKKVVYALTPFLIAVYINKE"
FT   gene            complement(93710..94735)
FT                   /locus_tag="Igni_0100"
FT   CDS_pept        complement(93710..94735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0100"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81284"
FT                   /db_xref="GOA:A8A8N2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N2"
FT                   /protein_id="ABU81284.1"
FT                   /translation="MASSKRSYSRKRELFLDCTLILHPSNVRWLTGFDAGIVLMGKDED
FT                   YLIVPELEYERALEVVDWLNVVKGPRGALWKKALELCNGPFFADLSYLNFRTAITLMTE
FT                   LGAGDASKTVRRARMSKDEEELSRIKKALEIAERAFLETWKELEEGTTELAAAGALEAH
FT                   MREFGAQEFAFPTIVAFGPNSSKPHAVPGEAQLSFGSVALFDFGAVYGGFRSDITRTYV
FT                   PDKEPYASWYHAVLEAVNAALKALKPGARGKDVDAAAREVLAEYGFEKAFVHGLGHGVG
FT                   ADIHEPPFLSPSSEDVVSKGAVVTVEPGVYFKGQGGVRVEQLVYVDYNPIVLNSTPVMW
FT                   W"
FT   gene            complement(94754..95290)
FT                   /locus_tag="Igni_0101"
FT   CDS_pept        complement(94754..95290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81285"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N3"
FT                   /protein_id="ABU81285.1"
FT                   /translation="MGLRVKVVEALRKTHRTRRRLEAYLYKAKAKERELMEKLVEAQKN
FT                   GDELRAKVYASEVAKLRKFVESIAALDVKLEHTELKLQSVLMLGDAGAALKPVVNEIKA
FT                   LAAPVRRLLPEIEEEMNDLIETVDELAEEELVGGAYVDVFLDHEAEKILKEAQLIAQKR
FT                   LEESLAVASEEGSKA"
FT   gene            complement(95361..96416)
FT                   /locus_tag="Igni_0102"
FT   CDS_pept        complement(95361..96416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0102"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81286"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N4"
FT                   /protein_id="ABU81286.1"
FT                   /translation="MLYELLSNSCVACDLCASRCPWYPVFKPSQRNLGIREAVESCTMC
FT                   GNCVLGCPLKVPTHKATFERKVKGLIPNDLKKLRERVEEKGSTFGIKMDWGALKGFPLD
FT                   ERAEWLVLPGGFDPLPTSRNDFLALLWTLRELGVDFTLSTEVPEGFGNFYFDYADPQYF
FT                   KKKAIKIIKVAKALGVKGLLLSECGADYKVWPRVTSYLKIKHDLRVEMAVNLISKKLRP
FT                   RHVVRKVPWKTSYHDPCGLSRYNFLTEPPRKILKIISENYEEREPGGRDQLCCGGGGGV
FT                   SLSEAWKRRAVEAVGRKKVEQFKGVEIVATACAKCKSMLLTYSLLLRGGFRVHRIGYLV
FT                   AWSMGKPLPPP"
FT   gene            96488..96697
FT                   /locus_tag="Igni_0103"
FT   CDS_pept        96488..96697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0103"
FT                   /product="SSU ribosomal protein S27E"
FT                   /note="PFAM: Ribosomal protein S27E"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81287"
FT                   /db_xref="GOA:A8A8N5"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023407"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N5"
FT                   /protein_id="ABU81287.1"
FT                   /translation="MPRKRKLYKILTPEPRSKFLKVRCPTCHNEQIVFSHATYPATCLM
FT                   CGTPLVRPRGGKAEILGEIVRILD"
FT   gene            96780..98099
FT                   /locus_tag="Igni_0104"
FT   CDS_pept        96780..98099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0104"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81288"
FT                   /db_xref="GOA:A8A8N6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8N6"
FT                   /protein_id="ABU81288.1"
FT                   /translation="MTIYKDARNGRITEEMKKIAEVEGVDPEFVRRGLAAGRIVLLRNL
FT                   KRADRVKTVAVGEGMLTKVNANIGTSNTLIDVNMEVEKAKIAKKYGADTVMDLSTGGNL
FT                   DVIRRKIMEAAEPLPLGTVPIYQAFMDVATRKGAGLYMTEDDILNTIEKHLKDGVDFMT
FT                   LHAALTRDLAAKAVKSDRAEPIVSRGGSILAAWMLEHGKENPLLSNFDYILEMFKEYDA
FT                   VISLGDSLRPGALEDAHDEYHLSELMVNARLVKRAREAGVQVMLEGPGHVPLDRVVADV
FT                   KLAKRLTEGAPYYILGPLVTDIAAGYDHIAGAIGGAIAAAHGADFLCYVTPAEHLNLPN
FT                   PEQVREGVIAFRIAAHAADIVKYPDRAMKVDIEMGRCRGRLDWECMIRLSLDPDKAREI
FT                   RNQYGPTSIKSCNMCGSLCVFLLLDKWRRKKDEELHAPLA"
FT   gene            complement(98081..99205)
FT                   /locus_tag="Igni_0105"
FT   CDS_pept        complement(98081..99205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0105"
FT                   /product="protein of unknown function DUF763"
FT                   /note="PFAM: protein of unknown function DUF763"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81289"
FT                   /db_xref="InterPro:IPR008482"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N7"
FT                   /protein_id="ABU81289.1"
FT                   /translation="MVSWSELPLHGGKVPPHLLVRMKGLAKAIVEVMVEEWGPDELVYR
FT                   LSDPFWFQAFNNVIGMDWDSSGSTTVVLGVLKEISWKEDLGFLVLGGKGKKMLKVKEEA
FT                   EVAAKRLNVDPEELRRVSKASARLDSALLQDGYEVYIHSLIVSERAWTVVQQGMNEELA
FT                   LARRYQLNHLNAPWEVPHSAVAGRRGEALDLTSKASIKTIDISLDIIDEGPKRVLSLLK
FT                   SATAALKGQRNLRGEVLRGPQLKFYYPVRPSPQLERALADLYEFRPKRREELLVAPGAG
FT                   PKVMRALALISHLIYGAAPSFEDPVTVPLDPFLYSYAVGGKDGVPYPYDVKTADEVIKI
FT                   LEEVVARAKVGEKERLRALRRLSEMVENLHARGA"
FT   gene            complement(99205..99963)
FT                   /locus_tag="Igni_0106"
FT   CDS_pept        complement(99205..99963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0106"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81290"
FT                   /db_xref="GOA:A8A8N8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N8"
FT                   /protein_id="ABU81290.1"
FT                   /translation="MSSETMVKIENLSVTINGKTVLRNINLEVPKNTIFAIMGPSGSGK
FT                   STLLRAINKLWDLYPQVKVTGKIYVNGTDVNKMPPHELRKIVGMVFQRPNPFPHMSIFD
FT                   NVAIGLRLHKLVKSKEELRERVEWALKKAYLWDEVKDDLKKKAHALSGGQQQRLCIARA
FT                   IALKPKVLLMDEPTSALDVVSTKKIEENIVELKKDFTIIIVTHNPQQAARISDYVAFIY
FT                   NGELVEVGPTSEIFTRPKNPLTEKYVLGKV"
FT   gene            complement(99953..100792)
FT                   /locus_tag="Igni_0107"
FT   CDS_pept        complement(99953..100792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0107"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81291"
FT                   /db_xref="GOA:A8A8N9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8N9"
FT                   /protein_id="ABU81291.1"
FT                   /translation="MRRGAIWIALIYVISLSALGVLIWILGSIAVNGAAVIAKYGTDIF
FT                   LKDIPPPIFLFEEVEVGIAPAIIGTLMIVGMALLISFPLGFLAGIVISEFGNTRLGRLV
FT                   ENLASTLVEVPTITAGVAIYWTLVVPTGSFSAIAGALALSLIMIPYIALYTAESYRKVP
FT                   RLIKEGGLALGLKYTTVLFKVIRGLVLPGVVSGVLMALAKGAGEAAPLLFTAGWNDKVT
FT                   LDPFEPVSTLSVLIYKFGFSSQDLWLEMSWAASFVLVFLIVLPLIILSKLVVKRHEF"
FT   sig_peptide     complement(100691..100792)
FT                   /locus_tag="Igni_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.469 at
FT                   residue 34"
FT   gene            complement(100785..101708)
FT                   /locus_tag="Igni_0108"
FT   CDS_pept        complement(100785..101708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0108"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81292"
FT                   /db_xref="GOA:A8A8P0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P0"
FT                   /protein_id="ABU81292.1"
FT                   /translation="MIKERTLKVVAALGLFGVLVPLLLLVVPLLSNSYDFILEHGLEII
FT                   TSMNWSPYDGEFGSLQFILGTLWVTFWSTALATPLAVALAVFVTELVPPKAKTFFGTLI
FT                   DLIAAIPSVIYGYWGLIIFGPLLANTAYPVLAGLSWVPALGALFSTSAISPQCFMTAIL
FT                   VLSLMITPYASAIIRNSYEMIPRELVEAVYALGGTKWDVIRINLGYIKSSILAGVVIAA
FT                   GRSMGETMAVTMLIGNSIEPFKPCLLCRGATITSLVANEFEEAMMNPAHVKALTALVLI
FT                   LIFLGSIILALGRKLGRALTEAEIVA"
FT   sig_peptide     complement(101607..101708)
FT                   /locus_tag="Igni_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.665 at
FT                   residue 34"
FT   gene            complement(101770..102357)
FT                   /locus_tag="Igni_0109"
FT   CDS_pept        complement(101770..102357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0109"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81293"
FT                   /db_xref="GOA:A8A8P1"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P1"
FT                   /protein_id="ABU81293.1"
FT                   /translation="MYVWFPSNPKYIKFMYGAPALLISWAVLTIAFGIRYLLFGFWQLL
FT                   AWVALAVATGFIFHELAHRETAKRMGCRAEYVLWPTGLAIALFLALISKGSFVFAAPGA
FT                   VTFACAYRNKRAEGLIAAAGPLANIAVALVSQALFYLTGAWGLLIVSNVNWFLALFNLL
FT                   PLDPLDGAKVMRYNLALWLALFSVSVVFTFVL"
FT   gene            complement(102360..102695)
FT                   /locus_tag="Igni_0110"
FT   CDS_pept        complement(102360..102695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0110"
FT                   /product="t-RNA-binding domain protein"
FT                   /note="PFAM: t-RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81294"
FT                   /db_xref="GOA:A8A8P2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P2"
FT                   /protein_id="ABU81294.1"
FT                   /translation="METVDFNTFSKVDLRVGKVIEAEDVPESRKLIKLIVDLGPLGKKQ
FT                   ILSGIKKWYRPEELVGRYVVVVANLEPKKMAGLVSEGMVLMAQEDEGSKPVFVVPQEPV
FT                   RPGTKVF"
FT   gene            complement(102732..103712)
FT                   /locus_tag="Igni_0111"
FT   CDS_pept        complement(102732..103712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0111"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81295"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P3"
FT                   /protein_id="ABU81295.1"
FT                   /translation="MKVVWSESFTKHFFAPPSIVREWTARMKKFKEVVSGKVELVPPEE
FT                   ASLELFELVHCRSLIERIMELDSIGGVIDYGDTYIYPGSASTLVDVLGGVLRAAELAEE
FT                   QGFGYTPYGGLHHAGKCRAAGFCPANDVAVLAEALARKGYRVAYLDFDVHHGDGTQEIF
FT                   YERSDVLTVSVHMYYPGFYPGTGWYAELGAGEGKGYSLNVPLPPRSGDEAYAMVIDLIV
FT                   KRAIENFEPDFVVAQMGVDGYWKDPLGGALNLTANTYYKIGEFLRSIEVPVAGAGGGGY
FT                   GEGAVVPMLSELGFRIEEEPTPSPPEALERVEEVLRYFEENVSWF"
FT   gene            complement(103723..104604)
FT                   /locus_tag="Igni_0112"
FT   CDS_pept        complement(103723..104604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81296"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P4"
FT                   /protein_id="ABU81296.1"
FT                   /translation="MALFDWGTYNGLTKLESASLTGMRLTEIPPAEFSRRYYTEEHFIK
FT                   YRELSSKYFHLVTAHAPYYSLVNHDKYTHEKVKRAMVQAAKKASVAGAKIFNMHLGPKV
FT                   RGVPYDYEPVVDVVKAILNEVPSIYVSLETTYTERFLGSLDEIREIIEMIGDERVIPSA
FT                   QLENDFMRETRAYAHGDLTLADKQATVDFWLSIFNKLKRMTNKYFSLRFSQIISFRFRT
FT                   FIMKKRVPLGKGYPSLEPLAEALALFLTRDLYYAGSGLEAHLIYTGPWQLKYRDTVKLY
FT                   CEVMGRATSYIK"
FT   gene            complement(104637..104930)
FT                   /locus_tag="Igni_0113"
FT   CDS_pept        complement(104637..104930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81297"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P5"
FT                   /protein_id="ABU81297.1"
FT                   /translation="MREANALRSKGLEVKCEDLGDCVACYYKKGEELYTIVIKEGLKGY
FT                   FAKVVPFHKLPPAFTCSSAFLVPYGLYAFAEDLDELADKVKEKLELVRTSSD"
FT   gene            complement(104917..105717)
FT                   /locus_tag="Igni_0114"
FT   CDS_pept        complement(104917..105717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81298"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P6"
FT                   /protein_id="ABU81298.1"
FT                   /translation="MIELLLLWSFEGGWLVSSLAPGPLLGVATFAHCFYLLNWTDGAVA
FT                   LKGCPGGQILRASYAFGKYAFLGSDGVYLVEGKDVRKLDCNCTYVLPLKNGVAACTRDG
FT                   KLVTPRWTLPISCNWLGTNGTVLFASSDNSTYIIDLNDGGVLAELRAGGAAGSACGSLL
FT                   ALTNASSVTVFNGTESLWTAPANWAGEPDFSDDCKYLAYPEVYEGRLNVVEAATGKVVL
FT                   RKTFYFSEECQLTLFSVAWKGHIIALGRGDGWVEAYTVRGLEGG"
FT   gene            complement(105714..106226)
FT                   /locus_tag="Igni_0115"
FT   CDS_pept        complement(105714..106226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0115"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81299"
FT                   /db_xref="GOA:A8A8P7"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P7"
FT                   /protein_id="ABU81299.1"
FT                   /translation="MAKGGWKEFVLVDPDVIEEKNLYTQAYFPEDVGKRKVFALKKKLE
FT                   ALGARAEAVPSAVEDVIDDLPEAPLALALTDNIPSRIRVEEKYKTLHAMVRPGLGILLM
FT                   TNDNLKLRDIMREGKHVGPQEVTMVTLVASVAAREALEYLSRGSSVLEGKMLLITPYKF
FT                   EFWWKKS"
FT   gene            complement(106219..106578)
FT                   /locus_tag="Igni_0116"
FT   CDS_pept        complement(106219..106578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81300"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P8"
FT                   /protein_id="ABU81300.1"
FT                   /translation="MKCYFCDSSAVARCEVCGRPVCERHSPVCPACLRGRCEVCGKRLS
FT                   VSRCYVCGRLVCRECSEEVQPGMRVCKYCLPNWREKLDEVTKKSLKKYVRWYLEEARRY
FT                   SRLWRAGKLDLDNDG"
FT   gene            complement(106478..107263)
FT                   /locus_tag="Igni_0117"
FT   CDS_pept        complement(106478..107263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81301"
FT                   /db_xref="GOA:A8A8P9"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8P9"
FT                   /protein_id="ABU81301.1"
FT                   /translation="MDVSFILLNSVLFATTSYVGKYLKYLKASFLVPASSDFALAATIL
FT                   SLYFLGRADATFLIFATIPVAAALWKSRGRQILYLKAIAYTVTTLMIPYLSYEVYEYAQ
FT                   SLLTGFLFVDPNMLYLSVITVTLTSVLVAFRKNVIYSIFDPEFAALKNMRPALWIGLLV
FT                   VTSIIDGFSLTLSLGFLLAHVVALSAVGVRETPKAAVIFFVTSLALSSVVAAPLACAAS
FT                   AVAVRAGEVLLLRLLSGREVRGLRATGLRKALPRLSRVP"
FT   gene            complement(107253..107996)
FT                   /locus_tag="Igni_0118"
FT   CDS_pept        complement(107253..107996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0118"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81302"
FT                   /db_xref="GOA:A8A8Q0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q0"
FT                   /protein_id="ABU81302.1"
FT                   /translation="MKYGDTYALEGVTLDVPKGDFLAIMGPNGAGKSTLLKTILGLAPL
FT                   VRGSVRVFGKDPYKQRSEIAKKIGYVPQRENVNDEVPLRAIDVVMMGLIEGMRPQREEA
FT                   LMDKALKALEEVGLVDVAYKTYRELSGGQKQRVLIARAIVSKPELLLLDEPFSALDAQS
FT                   SRTVARLLKKYNDEGTTIILVTHDITPIANDVKRVALLNKKLIAVGEPLKIFTKENLLK
FT                   TYGVEVPVLVQGRLCIPLIGDQHGR"
FT   gene            complement(108022..108447)
FT                   /locus_tag="Igni_0119"
FT   CDS_pept        complement(108022..108447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81303"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q1"
FT                   /protein_id="ABU81303.1"
FT                   /translation="MVLAVGTLDERLRARWVLKLRDGVRRGGKGRRDLKPKPLGDKCNP
FT                   ACPFFRCSQNALMFTKKYQRGKVITVVTCRLVGDKCIGYRCQYAYCEKKYLLPDGRCAW
FT                   ALRKEEEKEDAFLKEVEEEERAFGKLKNKLRGYDDLL"
FT   gene            complement(108432..108974)
FT                   /locus_tag="Igni_0120"
FT   CDS_pept        complement(108432..108974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0120"
FT                   /product="tRNA intron endonuclease"
FT                   /note="TIGRFAM: tRNA intron endonuclease; PFAM: tRNA intron
FT                   endonuclease, catalytic-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81304"
FT                   /db_xref="GOA:A8A8Q2"
FT                   /db_xref="InterPro:IPR006676"
FT                   /db_xref="InterPro:IPR006677"
FT                   /db_xref="InterPro:IPR006678"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR016442"
FT                   /db_xref="InterPro:IPR036167"
FT                   /db_xref="InterPro:IPR036740"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q2"
FT                   /protein_id="ABU81304.1"
FT                   /translation="MYTAYLVGDRVVVLDDAAAKDIYSKGFFGHPLGTEKPKGPEDVKA
FT                   PLALSPLEALYLLETGVIEIRDITTDKSYSPEELKEIWKFMEGLEEKYLVYKELRNKGF
FT                   VVRSGLKYGSDFVVYEFGPGIDHAPYVVDVLEKGTSLDPSEIVKGGRVAHGVRKRYIMA
FT                   IVENGSINYVMLKWYLP"
FT   gene            complement(108978..109670)
FT                   /locus_tag="Igni_0121"
FT   CDS_pept        complement(108978..109670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81305"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q3"
FT                   /protein_id="ABU81305.1"
FT                   /translation="MEEEREVDYLEPETQAKVYSSIAEINLIETLNNLMSSLTEEIRAA
FT                   LSMVEKAKGGTAAEVDASLQSVRELKENIENYKDKAMEYLVRLPAGLIMKDTFMPIVLG
FT                   ISNAAQYVDGSCYRLGVLAKRGKAHEELVLETQELLNLLLEQAERLAKAARVVTEPKMA
FT                   MKYVNESIGLEDEIDRAYRSKLMDVLEGSKDCASAVLSWEILGNLEDASDILKDVAENL
FT                   KYFLMHKV"
FT   gene            109953..110501
FT                   /locus_tag="Igni_0122"
FT   CDS_pept        109953..110501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0122"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family;
FT                   regulatory protein, DeoR; Helix-turn-helix, type 11 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81306"
FT                   /db_xref="GOA:A8A8Q4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q4"
FT                   /protein_id="ABU81306.1"
FT                   /translation="MAARRVRNLGEPSIIDFVRSERINDRDKLILKTLLKNSKTTTTDI
FT                   AEKLNISDVATRRRIKKLEEEGVIRFYTAILNPKKLGFNVVALLLIETEPSSVDEVAKT
FT                   LAEIPHVVELGTLLGDASVYAVVWAEDLESLENIVKEKIGKVKQIKKIHTYLMAKHYKV
FT                   NGLPLRESELVPDDGGHEA"
FT   gene            110482..111099
FT                   /locus_tag="Igni_0123"
FT   CDS_pept        110482..111099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0123"
FT                   /product="glutamine amidotransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81307"
FT                   /db_xref="GOA:A8A8Q5"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q5"
FT                   /protein_id="ABU81307.1"
FT                   /translation="MAGTRPRFITNFVKVARKDGKGLPNGDGWGFAAYLADGTILIKKK
FT                   LEPIWESLEPLPRAPFLLHARRAEKLPKSLEHVHPHVCNGVILAHNGNVEVPRPSGLKL
FT                   YRRTSSEALACYFGALLASGRELEEALETVSKTVKPKPSANFVAIVTSASKLVIFNYHT
FT                   GDRYYVMWKKEGVYASEPLGEGWQPLSEDGAPVWEVVDLKPS"
FT   gene            complement(111086..111316)
FT                   /locus_tag="Igni_0124"
FT   CDS_pept        complement(111086..111316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81308"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q6"
FT                   /protein_id="ABU81308.1"
FT                   /translation="MKEIDLTAQDVVCGDMISNIAMAVQQLGSGEEAKIILPIEYKESI
FT                   EVYKEALKMIGADVLEVKEENNKLILRVKKA"
FT   gene            complement(111346..112122)
FT                   /locus_tag="Igni_0125"
FT   CDS_pept        complement(111346..112122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0125"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81309"
FT                   /db_xref="GOA:A8A8Q7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q7"
FT                   /protein_id="ABU81309.1"
FT                   /translation="MSSLSLRNADQSMIPLYDINAVRGKSIINTAIITINVLVFVVLEL
FT                   PLLLQGNVLSFNELVKNYGMVPYFVVNGMREYTLLTHMWLHGSLEHIAGNMLFLYIFGD
FT                   NVEAVLGRRGYLALYLLSGLGAVVFHLLSVMLTPSIILNPYLRQNPWLTPAIGASGAIS
FT                   GVLAAYMLFFPHAQVMTLVFAPYPLLIPIRASVFIGLWFLYQLIMGTWSLSGMPTGVAW
FT                   WAHIGGFLTGAALAYLLADRNRIIELRLRGRYVVYI"
FT   gene            112189..113982
FT                   /locus_tag="Igni_0126"
FT   CDS_pept        112189..113982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81310"
FT                   /db_xref="InterPro:IPR007548"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q8"
FT                   /protein_id="ABU81310.1"
FT                   /translation="MLLKREYMQVLEKFKGKDEVDVAEVATGEYEEAENVLFILLALEV
FT                   QGLIEPVSKERPRSFRLTEAGKKVLEAWEEAGRPEAERWFDSSIHAAVWSLWRTSAKAP
FT                   KDWFTPLRERGLVDEEGFLTDAAKKLVEQFEPKVRPVKVRVTRDLGWTLARVPPGPAAV
FT                   APLSKFPEEHIDLLEAMGVIVFTSPDRKYYALTRFGRFLREAIRELRPVAMEYVLVNMK
FT                   IAEMVKKLVEGGELTEEEKYWLMNLGYYRDGKPTRAAKWLYLALKELERGEWWDTFPIG
FT                   LTRVDEWVLKTIDHLWKKAENNPELKPTKKLIQYWIEKHRDELGMDEETYKELEFSDYT
FT                   IGLALYRLEAVRLVDSYEEKGKLVYELTEYGKRLLEVLGQITEVPAHAVKTLVYADKGI
FT                   PPFRLWIEEAIRWGLMGPQGAGTKARVLMWISRRVKRLPLITKLEHLVLQKTLPSRRAE
FT                   PLEELVKRVSALGYDEEEVRAAIYWLEMWGALEVYGNGYVELTEIGDMIKHALVATPPG
FT                   VATPVHPHFIRVLQAVKELGSYEDLAEIVNRTRLTLGIVKDALVVAREAKLLGAKDLTG
FT                   EGELLLEAVKRIQAHVEEVVQ"
FT   gene            114019..114705
FT                   /locus_tag="Igni_0127"
FT   CDS_pept        114019..114705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0127"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81311"
FT                   /db_xref="GOA:A8A8Q9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Q9"
FT                   /protein_id="ABU81311.1"
FT                   /translation="MKVRLVLVEPEGKINFGFILRLCKNFEVDEIVAVRPKFDVRDEEV
FT                   LTFAANGRDYVDKVKVVDDYKEALEGLVVCTSAKVSSADPLRDFVLPWELKEKFGEPER
FT                   LTLVFGRESVGLTREELKECDALLHVPASPQYPVMNLSHAVAVVLWEVWKQYRIEKGAQ
FT                   PERPDERDLRLALGVAERLARALIKDEAKRERVTVAIKRLLAKATRQELRNLLYLLSKC
FT                   ANRLGE"
FT   gene            complement(114686..115276)
FT                   /locus_tag="Igni_0128"
FT   CDS_pept        complement(114686..115276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0128"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81312"
FT                   /db_xref="GOA:A8A8R0"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R0"
FT                   /protein_id="ABU81312.1"
FT                   /translation="MDLNAVINAFISMLIIIDPFTNAPIFYQLTSSFEPKRRKRIIVRS
FT                   ATVSTIILLVFALFGDLIVRPFGMTLEDIKVATGLILLIYAIQALLGKSEAEMIDPESV
FT                   AIVPMAIPMLAGPGAISLVLYYRSVLEPYELALVVVGVMLVSLPILLLGGYLDKLLGKN
FT                   GTLALNRILAILMAGLGIAMVREGLLTFIRPVG"
FT   gene            complement(115291..117726)
FT                   /locus_tag="Igni_0129"
FT   CDS_pept        complement(115291..117726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0129"
FT                   /product="protein of unknown function DUF699, ATPase
FT                   putative"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; protein of
FT                   unknown function DUF699, ATPase putative; domain of unknown
FT                   function DUF1726"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81313"
FT                   /db_xref="GOA:A8A8R1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R1"
FT                   /protein_id="ABU81313.1"
FT                   /translation="MLKQFLRELEDDLDNAVEGKHRRLVVISGDDPSKVGEAVKEVLLL
FT                   YDRIRYRRDMEKGTVLYMFHDEFEDAKKIKDIVKAGVKENRKNIELSINVYEASKKLLG
FT                   STYQGLVLDLTHDLRPNDVGRLVEVVEGGAPVILIVPKWEEWDTRITLFKKLLTVPQYP
FT                   EPRHVFITWFKRKLLAHPSHIYHADKEEIIKQEKFESPKWVPKRPEIPEKTRFPKKLYE
FT                   LALTQDQVNVIQGIEWLLGRKKSHRVLTVTADRGRGKSGAVGIGLIGFVETFKKSKGGF
FT                   AKVIVTSADPIGVQTLFSLAMKAANVLGIKAKRVEKKGYVYELHGEGWSIEYWPPADAA
FT                   VKSADLVVVDEAAGIPVPLLHKIWKNHKRSLFATTIHGYEGAGRGFNVRFLPALKNDKK
FT                   TELKMIHMTEPIRYAPGDPVERWLYDSLLLDAEPAKLDSEDLKAIKEKRLKYLKLDPEW
FT                   LFSEEGEGVLRQLFGIYVLAHYRNEPDDLAMIADAPHHTPRAVVTDTGKVVGAIHLAEE
FT                   GPIPEDMIDELLAGGKIAGNIIPDRFLKHLRVRDFAYTKGWRVVRIATHPDVQGKGIGT
FT                   FGLERVSEEASERGYDWVASGFGVTAQLLRFWLRSGFIPVHMSPDRNPSSGEFTILLAK
FT                   PLNEKLRSLIMEANRLFRRRLVMALHLNYRDLEWDVAKLILETDPLPVQPDLKVPRFHP
FT                   VDLDRLWIYAYGPMTFEAASDLLYRLSLAYWSQPKAWRPEVDEEMKIVLITKVLQSKKW
FT                   EEVEEETGIPFKKQTAILKSFARKALKHYWGIEDGGKGVSKTALDAFLAFRGRKLLDF"
FT   gene            117775..118473
FT                   /locus_tag="Igni_0130"
FT   CDS_pept        117775..118473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0130"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81314"
FT                   /db_xref="GOA:A8A8R2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R2"
FT                   /protein_id="ABU81314.1"
FT                   /translation="MDAHVHLYEDPTMADEETILVAVSDDLESSLKTLSLKGENVVPCV
FT                   GVHPWSSPEVGEEELKEFEKLVERALCLGEIGLDKRYVPDFEKQRRVFEHFLTLSKEYS
FT                   LPVNLHALDAWEEVFNMLLRYDVDRAYFHWFNGPLHLLDEIVSQGYYVGINAAAKIQKK
FT                   HLRVIERAPLTSIMTESDGPYVYRGVKLTPKAVPELIGIIAKVKKVSEEAVAEAVLRNF
FT                   KRWSGALAQG"
FT   gene            complement(118545..119135)
FT                   /locus_tag="Igni_0131"
FT   CDS_pept        complement(118545..119135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0131"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81315"
FT                   /db_xref="GOA:A8A8R3"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R3"
FT                   /protein_id="ABU81315.1"
FT                   /translation="MKLKDVLEAAASLVRTGWMQRGVPPQLGETVALHSFYAALIALEL
FT                   GLRLKNVGVEVNPERAASIAIAHDLPEVLVGDLPKWTTDKIGDIKESLELKAIGEMDSL
FT                   EVVEYSKAYIDERGRERALAKVSETLATLWQAEKYLNMGFSRVKEIRDTMVEHLSGIIK
FT                   KVLEEDEEFGKALVKVLGELDEGLQALRAQVQR"
FT   gene            complement(119157..120401)
FT                   /locus_tag="Igni_0132"
FT   CDS_pept        complement(119157..120401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0132"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81316"
FT                   /db_xref="GOA:A8A8R4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R4"
FT                   /protein_id="ABU81316.1"
FT                   /translation="MYNPFGDYVWEFRSPRSKFGPGALNELKVDLERLRVEKPFLITTK
FT                   GWVKRGIVDRLREILGKDVPYWDGVEPEPSAESVEEAAKALAESGADSVIAIGGGSALD
FT                   TAKIANLLATYGGRVRDYVAPPYGEGKPVPGPVKPMVAVPTTAGTGSEVTSVAVVTLKD
FT                   VGVKVGISSDFLRPSLALLDPELTMTVPPKVTADTGMDALTHAVESYIAKPYWARERPE
FT                   DPAKRPVYVGSFTVTDALAERAIELIGKYLRRAVYQGRTDLEARSGMLIASYLAGLAFG
FT                   NAGVGLAHAASYPLGGRYKVTHGEAVGILLPAVLEFNAPANYEKAKRVGELLTGEKCPE
FT                   RDPAKCAEWAANAIRELQRDIKFTPGLEAVGVKEEDLMEMAKETLNQKRLLATNPRPVT
FT                   EEDVYWVYKRSMRNY"
FT   gene            120480..121745
FT                   /locus_tag="Igni_0133"
FT   CDS_pept        120480..121745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0133"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81317"
FT                   /db_xref="GOA:A8A8R5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R5"
FT                   /protein_id="ABU81317.1"
FT                   /translation="MMRIVVRSKKDADAVRAMLSQALPSWNAEVVTLKGARKEKILDVI
FT                   NDVVDPDAFNIVLLGREDSEVIRELTETTPPNVIVHLVPRARVRNARLSHLRWELERAK
FT                   AQPRGWVRWSGEVPYLEKKFPARVEPGEEPFLAWGLWWKTLGLGEPSEKSFLVFKRQKG
FT                   FHEVYSEGRTVAMFEMNDFAYPKVTKLGEVKGFDIMKSVEMSEGVLEVWEKVSSKVLEG
FT                   CERAVVPWSGGKDSTAALLIAKRACDEVTAVYVDTGVDMYLNRKYVELWSQKLNVDLII
FT                   KEVPVKSQIFQRGLPTKEDRWCTALKLKGLEEAIREVKPDYIVVGDRDAESQARSARWE
FT                   ERAWEGVGTVKAPLKLWSAMMVQLYLFKNKVFPNPLYASGFYRLGCYVCPFFRAYEREL
FT                   VRRVPPAKLGTDEELLKKFLEG"
FT   gene            121776..122573
FT                   /locus_tag="Igni_0134"
FT   CDS_pept        121776..122573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81318"
FT                   /db_xref="GOA:A8A8R6"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R6"
FT                   /protein_id="ABU81318.1"
FT                   /translation="MMCRSKENFFLEFERLMVESAKDEVTADSTVVMGILAEASRNLLA
FT                   TPCTPRTSGFWSKLTEFVKKARETNDYYLKKVYAEKIRDGVLALVSSEKEWNAKGNAVL
FT                   LLSAVISVLAKPLTPISYVPWASLLVYQLSPVAALLLLASSGLAALALKPTLGLLFLIS
FT                   AVGGYLERKVELDLSVPKVARRVSREEVERLFVQYYGERLGRELFRFELYQLILSGRTV
FT                   EEALSELWERLTNTQISSRGYGRLGGERVSAGRREDQGAENNN"
FT   gene            122524..122970
FT                   /locus_tag="Igni_0135"
FT   CDS_pept        122524..122970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81319"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R7"
FT                   /protein_id="ABU81319.1"
FT                   /translation="MSAPGGGKTKELKIITRQVLTVDDVKKNKNMKIILHIVKHLGEVS
FT                   EKGLTRLLYEMKEKGLDLGYQFVKIGKVIGSKDLHQDIMDLLYVGLLERNPAKNKLRLT
FT                   RDGEEFLEKNGLPEEEIKPILSLVDQLKPVIEPIEAEVEMRRRP"
FT   gene            122973..123701
FT                   /locus_tag="Igni_0136"
FT   CDS_pept        122973..123701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81320"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R8"
FT                   /protein_id="ABU81320.1"
FT                   /translation="MSAQPGEIHITILMKPELSEYHVTANYGDTPDEVRNKLAEKLGIS
FT                   PSRIRLFIKRPDGAEYEITHSSESVGQIVSVHGNVWYASIEEPYGSLIDAIEAFREHYL
FT                   SSGELQKKYSPLANDPGLGIWTEKSCKRKEYCSPSRPYRVFVFPSVGYPVTQPLIFVSP
FT                   KVLHKCCFYNLKSQFFDIKAKELPELAPAFEEASKLVNVNMCVMHIESWDYLRKVERNP
FT                   LEVLDRALCTDVGLCDGTGA"
FT   gene            123694..124473
FT                   /locus_tag="Igni_0137"
FT   CDS_pept        123694..124473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81321"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8R9"
FT                   /protein_id="ABU81321.1"
FT                   /translation="MHNAVIDPAVFVPLAEVGIKNKCYELTVDASEDVVSFSGSLDDTT
FT                   ITINSVRYMKAVEKGPTHVRTYDFLPDDVVVAHYHCGIPPEPSAIDVETMKLALRAQLM
FT                   ATLPGRPRVFGIISPTVAGSSFCLSLSLYEPVPKATIAFKTERLRLGDLDFLEGIRKGF
FT                   VRLEEGDSEYYLTDLCEGLERGCYPFRYGSVPEIVLEDFIFILSYSINTKKKKFPYAKV
FT                   SPSKAVVYEVEVANFDAKDAVIRGLVWRLRGASTRGR"
FT   gene            124437..125228
FT                   /locus_tag="Igni_0138"
FT   CDS_pept        124437..125228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0138"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81322"
FT                   /db_xref="GOA:A8A8S0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S0"
FT                   /protein_id="ABU81322.1"
FT                   /translation="MAAPRGFYERTLRYLREVADPEALKDKVVLVGGVGTIGSRLVRNL
FT                   ARFNFKKIIIIDIDYVGPENVGYQCYHTEEIGAPKVEALSKRFRRYHPWTEVQGVYLEV
FT                   FTPSGLSSLSELKKFAELVRESDVVVTAFDTLPPRATALLLAVKYGKKYVDVGLGSTRG
FT                   YVKFLKDGYCPICSKVWEEKVTYYTNPNLAEVVAALGAQAALRAALGMDWPSEVHVNLE
FT                   EPLKAYMASDVKNDGCPLCSEEVRALAIEEVPNYLIKNVYQ"
FT   gene            complement(125234..126523)
FT                   /locus_tag="Igni_0139"
FT   CDS_pept        complement(125234..126523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0139"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81323"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S1"
FT                   /protein_id="ABU81323.1"
FT                   /translation="MKKFLPLLLLAVMTSAVLAVAPQEAYGGPKCDYLKIAVERAGGLE
FT                   KVKEGLGGTTIKIGALIPMSGALASFADERYAVELAARDLNYCFKELGLPFKVTWVVED
FT                   TQTNPQVALEKVRKLVNVDGVRLVVGPATSAAVGTLQDVINGELKVILMSHSSTSPLVR
FT                   FNNRDYIAKLGYSYVFFSVSSDLFQAKALAKVVKSFGYNKVVFFYRNDDYGKGFAMAFK
FT                   QAFEAEGGKAYLIPYDPNARSYLAELRTINNYKPQAIVWLAFDEIKVILRQALQLGLQR
FT                   YPWFFTEAVKGPALIEDPVVARVLAAKHVLGTAPYTSGNFIKYYESVYGKAPVVFSDTL
FT                   YDAVWLVTLGALRAASYNPNLVEHGIIEMSYIYKGFSGDKSMNAIYQEPLSTSYSIWTV
FT                   KMVDGKPVFEDVGFWSPAEGLKLYTNLTPR"
FT   sig_peptide     complement(126464..126523)
FT                   /locus_tag="Igni_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 20"
FT   gene            complement(126575..127870)
FT                   /locus_tag="Igni_0140"
FT   CDS_pept        complement(126575..127870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0140"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81324"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S2"
FT                   /protein_id="ABU81324.1"
FT                   /translation="MRTGLLLTLLMTAFVIAASTEEMDLLTKPYQLGPNCESIKKVIEW
FT                   AGGVDNIRLPKEIPIGAPAPLSGALGSFAVSNYNAIKMASDDINGCMEKLGLPWRFKFI
FT                   MEDTRTDPQVAVEVVRKLALQGVQIIAGRITSRPMGSLMYPVNSELHVVVMSATSTAPN
FT                   LRIANYKEYISKTGKSYIFWAITNDYFQGKALAELATKLGYKKVTIVFRQDDYGVGLAN
FT                   AFKYYFSQNGGECVLVPYDPNARTFDAELRVVANSNPDAILFISFDELKVILRQAMQLG
FT                   LQRYPWLFSETCRGVLLNDPYLAKVVALKNGMGTGPGGSDVFAKLYEKRFGIPPMLYAD
FT                   YIYDTLWLSALSVLKAKKYDADAIREALIEVGAYFKGYTGPKTFNPLTQEVMRSSYHYW
FT                   TIKIENGKPTVVKVGFWDPEKGIELFTPIRPK"
FT   sig_peptide     complement(127817..127870)
FT                   /locus_tag="Igni_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.478 at
FT                   residue 18"
FT   gene            127999..128748
FT                   /locus_tag="Igni_0141"
FT   CDS_pept        127999..128748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81325"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S3"
FT                   /protein_id="ABU81325.1"
FT                   /translation="MAGRSAAGLYMASGVVLLHTGCLKVAVASLPGSAQTSSTVRFAPA
FT                   PPKKSVLIMGTFEPKYKLINSLYVALTKLEELDMVSSAGMIDNNVFSVPGDEAPYAKIM
FT                   FTIGKKTKEYWLVGVPSEISTKILSNLKDSIRAFRGSLPKETIYEIVDDPEGLAKIMGG
FT                   VKRIVYVFDPETQAYASIELANMLAAFEGRKAEKVAVVNVGKGMPAFVPSTLQALERLG
FT                   FVKDSLVLETPTLNSFEMLKLAKFVFL"
FT   gene            128799..129314
FT                   /locus_tag="Igni_0142"
FT   CDS_pept        128799..129314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81326"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S4"
FT                   /protein_id="ABU81326.1"
FT                   /translation="MVAKGEAKVYLDGNVLLAASTLEDKLHDETVEFLDLVKKADWELV
FT                   IGTPILLELEQLLYLGDMGWFRLRHALSALPKYEIKIIEDDHKKVLELANEYLNERVLS
FT                   EKYFTNLLVIASATLGDVDYLVSWDSRRMANKSVVTAVNRVNLNKKLREIEIVTPKRLS
FT                   QIIKEEVL"
FT   gene            129316..129516
FT                   /locus_tag="Igni_0143"
FT   CDS_pept        129316..129516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81327"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S5"
FT                   /protein_id="ABU81327.1"
FT                   /translation="MAKAREEESLSFLLDEKLKEFVTKNVLKAKIEEYEEAVAIAKEVV
FT                   LPLAKAVERSKKVVRMLLLGG"
FT   gene            129521..129964
FT                   /locus_tag="Igni_0144"
FT   CDS_pept        129521..129964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0144"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81328"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S6"
FT                   /protein_id="ABU81328.1"
FT                   /translation="MFKKILMAHDSSLCGWKAFEVALDLAKKYGAKLYVVHAVDTTAIP
FT                   DIPHKDVLVKPLLERAEKLKGEVEEKLKEAGVEGEFIVVHDNPVNAIVKKAEDLDVDLV
FT                   VMGARGAGPVGGYLLGSVSTRVLLTCNRSVLVVKGKAPAASKL"
FT   gene            complement(129973..131652)
FT                   /locus_tag="Igni_0145"
FT   CDS_pept        complement(129973..131652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0145"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81329"
FT                   /db_xref="GOA:A8A8S7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S7"
FT                   /protein_id="ABU81329.1"
FT                   /translation="MKLRSYQLRALDIALRMKRCVIVMPTGSGKTVVAGAWLKELFERG
FT                   EIRKALVLEPTRILVEQNSLLLRNAFSLNAMPLHGKKTKAQKLEAVKAEVVVATPEEAE
FT                   LWLAELSNSDALVVDECHHTSGKDPYVKVVKSVKAEWRLGLSAFIPPKRRSIIEKYIGP
FT                   IIEIPWSDEEVRKYVPPYIGEVYEAPLPESCMKLYEALKSRWPSSDKKTRLLISLALRF
FT                   LARDGPMALRESSKGEGALARLLKEYSQQIEKCYEEAPLHKLPALTRVLDDHVYEKALV
FT                   FVDRVSIALAVAKELGALPLTSKSKGRLEDLKSAKVIVATSAGEEGLDLPEIDLLVIWS
FT                   NTSSALRLIQRIGRLLRPKGDKKVKFLTFIVTPDTIDVDLLIEGLEVAKKVGVDPNVDP
FT                   EVLRKLLKVSSVGGVLEVLRGRALPEDLIAELSSLPLSRVKRLLRKMGEEGIAAYVYSP
FT                   YGKLWFLQEEAEAVGEELKELLEPLEGATLAIEELGLRGKLEQVIERLKGLLPAGPLTV
FT                   KVRARTGSMEIFDVRKYNFVVSNEKVAEIVLRNATSKRLLLG"
FT   gene            131734..132693
FT                   /locus_tag="Igni_0146"
FT   CDS_pept        131734..132693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0146"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81330"
FT                   /db_xref="GOA:A8A8S8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S8"
FT                   /protein_id="ABU81330.1"
FT                   /translation="MSYAIEARDLRKRYGEFEAVRGVSFTVRWGEVFGFLGPNGAGKTT
FT                   TIMMLTTLVEPTSGEAYVAGYHVVKEKNEVRKNIGIVFQDPTLDSYLTVYENMYVHGKL
FT                   YGIKGNVLKERIKEALTFFDLWEHRNKVARYLSGGMRRRLELARAMLHEPKVLFLDEPT
FT                   VGLDPQSRNKVWEYIKTLNKKLGVTVFMTTHYMDEADEMCDRIAIIDHGKIIAEGSPEE
FT                   LKSSVGGALVIVKTKKEAPCPQGFECEKKGDKLIISLKNLGKELIDVIDSLRSYEITEL
FT                   DVRKPTLNEVFLKLTGRELRDEDSNDYLKHIITKRMWG"
FT   gene            132698..133465
FT                   /locus_tag="Igni_0147"
FT   CDS_pept        132698..133465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0147"
FT                   /product="daunorubicin resistance ABC transporter, inner
FT                   membrane subunit B"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter,
FT                   inner membrane subunit B; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81331"
FT                   /db_xref="GOA:A8A8S9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR005942"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8S9"
FT                   /protein_id="ABU81331.1"
FT                   /translation="MDVLLAMAYRQLKKFLRARARVLSMLTMPLFWVLFFGVGWASSMN
FT                   FPGIELILGTDYLSFMLPGVIAMTVFTSGLMSGASVIWDRQLGFLKEVLVAPTSKLEAV
FT                   LGRILGDSLVASLQGSVMLLIGYLIATNMYLSGALPAIIIMFMTAMGFSALGVTMASLR
FT                   HVKSVEGFFAMVNLLMMPAIFASGAFFPLNNLPDWFWIISYTDPLTYSVDLMRYFLVGV
FT                   NKFEPLKDLCALLVFDASALLLATKLFERSDVE"
FT   sig_peptide     132698..132823
FT                   /locus_tag="Igni_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.597 at
FT                   residue 42"
FT   gene            133508..133795
FT                   /locus_tag="Igni_0148"
FT   CDS_pept        133508..133795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81332"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T0"
FT                   /protein_id="ABU81332.1"
FT                   /translation="MAEDEGIVLVVRIGEGENAKEIELTEEVLRKVRVYLRTEYSLEKL
FT                   AEELGLDGWEEAYEFVKKMPAWLVWIPPTLLRYKMKMIEEKLKNNELQLK"
FT   gene            complement(134008..134847)
FT                   /locus_tag="Igni_0149"
FT   CDS_pept        complement(134008..134847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81333"
FT                   /db_xref="GOA:A8A8T1"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T1"
FT                   /protein_id="ABU81333.1"
FT                   /translation="MLPSVKVTNDLPRAPKKAPLPRGPGQRPLFPRREALLLPYFERER
FT                   SPAQHRIERQLEKINLEEATLALIEVAEREIYVASEKFPHKVLRALKRKSESGVSVKII
FT                   TADESCEVLKFWGLRTSKCITKGLMKGTVIRLPLLAASLFLPSHLNAALTPYSLLGVII
FT                   GSSLPASYALLLAELYWWREYFAYTFIPWVLKASCATSFIELLIKTFMPKNKNAGNVEV
FT                   RTVDALPSTLVVVDGKRGFSSECRLSSSRCLANVYREGAHELLREFSLLWEASRPAK"
FT   gene            135275..138343
FT                   /locus_tag="Igni_0150"
FT   CDS_pept        135275..138343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0150"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81334"
FT                   /db_xref="GOA:A8A8T2"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR020791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8T2"
FT                   /protein_id="ABU81334.1"
FT                   /translation="MGDFVEDFVRYLKEIAAKWREEWERARLHEADVDPNRPKFYVTAA
FT                   FPYPNSPMHLGHSRTYSVTDAYARFKRMRGFNVLFPMGFHYTGTPIIAMSEKVKQGLQA
FT                   LRSLGEVKTILEEIWKIKVERNLSIGEAIKEYLRGAGREDLMDKTDSIEYLVLFYKVFE
FT                   IPVEDLEKLTEPLSMANYFASITEEGMKELGYMIDWRRKFTTVDPDFQKFITWQFLKLY
FT                   DLGYVEKGTHPVAWDPVYDTPVSQHDTKGDVEPEIEEYDVILFKLKDEDLYLPAATLRA
FT                   ETVFGVTNVWLNPEAEYEVVEVDGKRWVLSKKAAYKIKFQKDEVKSLGPIDPKKLLKKM
FT                   VINPATEEEVPVLPARFVDPNVATGVVMSVPAHAPFDYVALKELEGDPEYSDIVKSIEL
FT                   VQVIRVPEEGLLVPQLVEKLGIRDTSDKKKLEEATREVYSKEYRKGRMLESVLERVKGD
FT                   ERLRAALKAFLGNDPVPDAREKTAKWLKLFGAGDVFYEIKNAPVYSRFGNEVVVKVLKD
FT                   QWFLNYGDPQWKELARKALARMRIIPENFLKEFEDTIDWLQKRACARTRGLGTPLPWDK
FT                   RWIIESLSDSTIYMAFYTVVNILRGASVEPEKLQPEVWDYIMLGKGNPKELEEKYGISA
FT                   AVLEEARRSFDYWYPVDSRHSGKDLIRNHLTFFIFNHAAIFPEDKWPRQIVVNGFVNLE
FT                   GKKMSKSLGNIIPITVAIRSFAPDIIRLVLLHSAELGSDADFRTEMVSRAISNLREIKS
FT                   IVEKVKDYNGPRPANLTMLDAWYLSSFVKDVENVTNMMEDLKIREVTNVLYFILLNRTK
FT                   EYLNALEAMGRGLDEVAKWVLRYTVERWVKMMTPFTPFFAEEMWHELGFNTFVVTEPWP
FT                   VKDEELVNPLAEAAKEYVEKVIEDIKEIIKVAKIEKPKKVRIEVASPEQVKMLKMAVEF
FT                   VNSGKSLREFMAEATKVFGKKEAKSLRQAFERATSLSESMRSVIARGEFDEKAVLEEFK
FT                   RLIEEEVGSEVEIRRYEGGKKRPEPLRPAIYVE"
FT   gene            138383..138676
FT                   /locus_tag="Igni_0151"
FT   CDS_pept        138383..138676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0151"
FT                   /product="DNA-directed RNA polymerase, subunit K"
FT                   /note="PFAM: RNA polymerase Rpb6"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81335"
FT                   /db_xref="GOA:A8A8T3"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T3"
FT                   /protein_id="ABU81335.1"
FT                   /translation="MSEECKIELGPPHLTKFERAVIVGVRALQLSIGAPPLIDISKLPK
FT                   RDALIIAREELRRGLLPITVKRRTQSGKEVLVPLDCLLKKEKEVFGEVPKLM"
FT   gene            138681..139523
FT                   /locus_tag="Igni_0152"
FT   CDS_pept        138681..139523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81336"
FT                   /db_xref="GOA:A8A8T4"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T4"
FT                   /protein_id="ABU81336.1"
FT                   /translation="MASDGYLLVTRRDACGCEGYGESAGPFVVMKRLETKNSAHVTLIS
FT                   IAFLAALAVAYSKALSSISTITFETAFLGYLGTLLLLAGFQSTLSSLIARLMGASLNVT
FT                   WVVVPSPLPSLLPLFTAERAFCRRGDFQLAVALPLLASMLLAAILSHTLAFHAYPKGKP
FT                   QVLESVPLALADAPSGPVQLAALAYALSALFQLTGYPYSPSWPLLGRSNALFPLSVGVA
FT                   LSVDRPVLGELLGGYVLMATLFSAFVRERAQWKDPFSRTSVVALASTLITLFLVVPVG"
FT   gene            139529..140017
FT                   /locus_tag="Igni_0153"
FT   CDS_pept        139529..140017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0153"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="TIGRFAM: peptidase S26B, signal peptidase; PFAM:
FT                   peptidase S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81337"
FT                   /db_xref="GOA:A8A8T5"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T5"
FT                   /protein_id="ABU81337.1"
FT                   /translation="MNKAKKEAIEWIKAIIEAIIILTVLKFLLKTNVPLAAVASGSMLP
FT                   TLERGDLVIVRGVAPDDVSVGDIIVYKSCQGPLIIHRVIKVVKVGSQYYYVTKGDNNPD
FT                   SDYFLGQFVDCRTGRPLPGVPYERVEGEVLETFGYTIKVPYLGYVALFAFPFLWWVSR"
FT   gene            complement(139969..140610)
FT                   /locus_tag="Igni_0154"
FT   CDS_pept        complement(139969..140610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81338"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T6"
FT                   /protein_id="ABU81338.1"
FT                   /translation="MRCCYLRPREPRPYKVSLEHPHVGPVPRLPTPLIEMHSEIEEARN
FT                   LIPEDELSGLVVNLNKVIMYSDILKTFTNYMRFMESGIDMCEDVKKAQWKLEALNEVLM
FT                   NVVLVMKKLNESVKYIERWIDKNLDKLKDTCESCETYRKVLRASKLWNKWKSEELCKQI
FT                   VEPERETVTKLAEKMLKCQEDSKDASLIGRIMALFQRDTHQRNGNANSAT"
FT   gene            complement(140582..141184)
FT                   /locus_tag="Igni_0155"
FT   CDS_pept        complement(140582..141184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0155"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81339"
FT                   /db_xref="GOA:A8A8T7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8T7"
FT                   /protein_id="ABU81339.1"
FT                   /translation="MSELKVGVLALQGGVVEHIYMIREAAKRLGKEVEVVEVRKPEHLN
FT                   SLRAIVLPGGESTAMYKLGKRTGLDKRLKEALLEGLPALGTCAGAALLAREIEDKQSGK
FT                   RYEPLLGVADFKVVRNFFGRQRESFEANLNIKGIGTFRGVFIRAPVMVPLSPAVEVLGE
FT                   FKGNAVMVKQGNIIATSFHPELTSDTRIHEMLLSEAS"
FT   gene            complement(141177..142205)
FT                   /locus_tag="Igni_0156"
FT   CDS_pept        complement(141177..142205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0156"
FT                   /product="Vitamin B6 biosynthesis protein"
FT                   /note="PFAM: Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81340"
FT                   /db_xref="GOA:A8A8T8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T8"
FT                   /protein_id="ABU81340.1"
FT                   /translation="MRHRDGLVEVGFDAIANFFYKLAETADKLKEEGLWTYLPDPREVE
FT                   REVAKGTVRAKLGFPVYQKGGVIMDVTNIEQAEIAEDAGAVAVMVLDKLPYDIRKSGGV
FT                   ARMADVNVIREVMDSISLPVMAKVRIGHFMEAKVLEALGVDMIDESEVLTPADEKHHIN
FT                   KWLFKVPFVNGARNLGEALRRISEGASMIRTKGEAGTGNVVEAVKHMKTVMGEIREIVS
FT                   MSEEDRVLKAREMGVSYELVELVARLRRLPVVNFAAGGIATPADAALMMWLGADGVFVG
FT                   SGIFKSEDPRQRAEAIVLATSLWMDPEAVLEAQSMISERKSMMGIDVKQLKPEELLQVR
FT                   GE"
FT   gene            142310..142585
FT                   /locus_tag="Igni_0157"
FT   CDS_pept        142310..142585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0157"
FT                   /product="Like-Sm ribonucleoprotein, core"
FT                   /note="PFAM: Like-Sm ribonucleoprotein, core; SMART:
FT                   Like-Sm ribonucleoprotein, eukaryotic and archaea-type,
FT                   core"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81341"
FT                   /db_xref="GOA:A8A8T9"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8T9"
FT                   /protein_id="ABU81341.1"
FT                   /translation="MARGQEKGKLNLENPLKYLRAAVDNVVLVRLKDGNEYVGKLVFTD
FT                   NTMNLILDDCTELSPETGEPVAKYGRIMIRGSYVLFISLDYHKVMK"
FT   gene            142596..143801
FT                   /locus_tag="Igni_0158"
FT   CDS_pept        142596..143801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0158"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase (MAT)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81342"
FT                   /db_xref="GOA:A8A8U0"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U0"
FT                   /protein_id="ABU81342.1"
FT                   /translation="MKNVTVTKLPLPPQDELDVEIVERKGTGHPDYIADAVSEEASRQL
FT                   SLYYLKEFGHVFHHNLDKTLLVGGQASPRFGGGDVLQPIYIIISGRAVTEVRTDDGVVD
FT                   VPLGTVLLKAAKDWLKKNLPHLDVEHHVVVDYKVGKGSADLVGVFELGKTVPLANDTSV
FT                   GVGFAPFSTLEKLVYTVERKLNSAETKAKIKALGEDIKVMGLRMKNKIKLTVAAAIVSE
FT                   YVRDAGEYAAVKEEVKEIVEAVAHEVAPNHEVEVFINTADNPEKGIFYLTVTGTSAEHG
FT                   DDGATGRGNRVNGLITPMRPMSLEAAAGKNPVNHVGKLYNVLANIAAQKVVEEVPETKE
FT                   VYLEILSQIGRPITDPLIAAVRVKGELTPTIEKRVKEIIEAELDRLPMITKEILEGKIS
FT                   VF"
FT   gene            complement(143798..144076)
FT                   /locus_tag="Igni_0159"
FT   CDS_pept        complement(143798..144076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81343"
FT                   /db_xref="GOA:A8A8U1"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U1"
FT                   /protein_id="ABU81343.1"
FT                   /translation="MEEALNPSALGFGLIILGVFLIFIGLLMMIVLRGGEVEWGGGAII
FT                   FIGPFPIAIGGGKLGWFALLIAALLALAMIILLFTTTYWGKPAGKGG"
FT   gene            144100..144684
FT                   /locus_tag="Igni_0160"
FT   CDS_pept        144100..144684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0160"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81344"
FT                   /db_xref="GOA:A8A8U2"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U2"
FT                   /protein_id="ABU81344.1"
FT                   /translation="MKHYFKGGAGGRPEVVGAWIRGAPLKFIVPRGLFSSSKVDLGTAL
FT                   LAEFMEIPKEGKVLDVGCGYGVLGILMAKLNPNLEVYMVDVNPVAVDAAKRNAELNGVR
FT                   VTVLQGNLYEPTDLLGIKDFSTIVSNPPLAAGKEVVKEIIEGAPARLKSGGSLQLVMAQ
FT                   GGDWAKGVMEEYFKEVEVKRKKGYALLRGYV"
FT   gene            144893..145549
FT                   /locus_tag="Igni_0161"
FT   CDS_pept        144893..145549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0161"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81345"
FT                   /db_xref="GOA:A8A8U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U3"
FT                   /protein_id="ABU81345.1"
FT                   /translation="MITLIFTLYRPGKQLLETLVFKGVWKVYSNKVVLKDFNLIVFEGE
FT                   VVRLEGPNGSGKTTVLKLASGIERPTRGEVYVAGSRPWSPSGKRAFGVVMHGNMTYPEL
FT                   TVRENIEFFVKLYKADKDYAFELANKIGLDDKLDQRASELSFGWRKRLEMVRALLHKPK
FT                   LLLLDEPFVGLDKRGLEDIMTILKSVNEEGVSIVYTAPTGVPYSVRPDERVVSLA"
FT   gene            145622..147376
FT                   /locus_tag="Igni_0162"
FT   CDS_pept        145622..147376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0162"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81346"
FT                   /db_xref="GOA:A8A8U4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U4"
FT                   /protein_id="ABU81346.1"
FT                   /translation="MKKERKVFKELLPPDEAMRRLEERVPPTPPEAEEVPIEEALGFYL
FT                   AEDVKSPINLPPYPRSAADGYAVRARSTWGASEDEPVELRVVGEVRVGEAPGFELKEGE
FT                   AAEVDTGSALPPGADAVVMIEYVKEVGDKILVYKSVVPGENVLWPATDVYSGQPLWKRG
FT                   TRVDSRVIASLASVGIRKVRVWRPKVYLISTGSELVEPGKPLETGKIYDVNTYSLQARL
FT                   REEGFVPIVHGVVPDDKEEIKKAILEGVEKADVVVTTGSTSAGPADFVYRAVGEVGEVL
FT                   VHGLAFKPGKPVMLGVVKGKPVFGLAGHPDSAYFNLERLVIPYLRKMVKADERSQSSTK
FT                   AVAATSFVGAKGRRTHVPVSLLTDGSRWFAFPASHSDHAMVSYSKADGYIVIPETRRAP
FT                   VEPGEEVEVWLFKDPSYKGAIVGDTDVAVDAVVERLDYPPKMLPLGSYSGAYASKMSLR
FT                   SVWISPEAVGKEVEVEVVAVGRGERVGVPHKSSFLYPFFSKFLEVEGISREELQKRFVR
FT                   VTMPTPQALASAVASGEVDAAITTRNAAEALGLDWRPLSKAKLYIGWTEDHAELGREVL
FT                   NEFLRRGG"
FT   gene            147351..148076
FT                   /locus_tag="Igni_0163"
FT   CDS_pept        147351..148076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0163"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81347"
FT                   /db_xref="GOA:A8A8U5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U5"
FT                   /protein_id="ABU81347.1"
FT                   /translation="MSSYAAEVRDVWKVYAAGGSSYPALRGVTLKIPKGSFVVVLGPSG
FT                   SGKSTLLHLLGALDTPTKGEVIIAGKNVKELDEEGRARLRREYVGFVFQKFYLINRLSA
FT                   VENVELPMLAKGLPKAERRRRALALLKKVGLGEKAFRRPTELSGGEQQRVAIARALAND
FT                   PDIILADEPTGNLDTANATRIMKLLEALNVEMGKTVVVVTHNPEHTRYANYVVRIRDGK
FT                   VESVEEGGRPAGDPSLLLA"
FT   gene            complement(148062..148604)
FT                   /locus_tag="Igni_0164"
FT   CDS_pept        complement(148062..148604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81348"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U6"
FT                   /protein_id="ABU81348.1"
FT                   /translation="MLVPANVKEKTRIRFENNQCIVDGRSFSTEHVVLVSPSNAKLVLN
FT                   EDGIKLEASYDQHPKFSTYGNYIVIGVSSDRYIPTWDTLEGKVVKVDEHGGSAEGELGI
FT                   RASLSRGYVVVELIGSDKKPTKFYVKEVNLEAEKPDFVNVLGSRFHTFYVKTRKDSKVD
FT                   IKKEDDKLFISISSSEE"
FT   gene            148667..150052
FT                   /locus_tag="Igni_0165"
FT   CDS_pept        148667..150052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0165"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81349"
FT                   /db_xref="GOA:A8A8U7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U7"
FT                   /protein_id="ABU81349.1"
FT                   /translation="MAGERVLLVGGGGREHAIGERLVSHGAVLGVAASNLNPGLLSLTK
FT                   DSGGEFFKANPTSPQEVLEVAKKFKAELVVIGPEEPQFRGVTDALRAAGFTVFGASSKA
FT                   SEIEKSKVFARSIMKKYNIPGNLDFWFFESWEEAIEFLERAGNVAIKPARQAGGKGVKV
FT                   ISDVQAYLSEEKKKVKEEHAKRILTEVMAKYTDIKEKLLIEEKVDGVEYTVQAFTDGER
FT                   VVPLPAVQDNPHLFVYDVGPETGGMGSVQGPGKLLPFITEEEYKVAVEILERVVEAIAK
FT                   ETGEKYVGAISAQMMLTTKGPVLIEFYSRLGDPEAVNVMNVVEGNVLEAMFEAAQGNLK
FT                   TELGVREAASAVKCIAPMGYPERRDLTKGREVLVPECEGAKVYYASVDVKDGKLVSGGS
FT                   RAVEVYAEGKSISEAAEKANACASKVKFVNWKSVWRPDIGGEWYIRRRSEVAELMRSVW
FT                   GLR"
FT   gene            150109..150804
FT                   /locus_tag="Igni_0166"
FT   CDS_pept        150109..150804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81350"
FT                   /db_xref="GOA:A8A8U8"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U8"
FT                   /protein_id="ABU81350.1"
FT                   /translation="MVETSVELSKVAFYVITLLLALAFIQYSLINYNTGELWYPFVAGP
FT                   LMGISFLLLVAITAFGGDYQLAALLNILFIVLTLTAYAVTFETSSIIDYEYVAFMLSLN
FT                   LLLVVYMDRKEGSVDLAPMFLRLSLLVTYVPFLLFVLLAFKYGYYYSYLAMIMALILSL
FT                   SNFLLLIPTFTQSLLQTLVLESFVMFVFLIYVLASSPIGPDVCEWIIRATLLSSYLTLL
FT                   WTAFRSRWE"
FT   gene            150801..151592
FT                   /locus_tag="Igni_0167"
FT   CDS_pept        150801..151592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0167"
FT                   /product="Ras superfamily GTP-binding protein YlqF"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81351"
FT                   /db_xref="GOA:A8A8U9"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8U9"
FT                   /protein_id="ABU81351.1"
FT                   /translation="MITLSWGSLAALIRRADVVVETVDARVPLNTRSRRLERLVETMGK
FT                   PVIIALNKADLVPREVAEEWTRIFRGEGYEAVYLAAREHKGTRVLRKKINRATDVRPVV
FT                   VAVVGYPKTGKSTVINALRGRAGASTSPVPGSPGFTKRPGLYRGPGQIYFLDTPGVIPP
FT                   DGNPLEKTLRGAPPEKLKDPVGVAAELYKFIKKYNPEAFEEAYGFDTGEPYSFLEELAR
FT                   RRGWFYKSDHEPLVEEAAKALLYDYHKGKIPFYVPPGEYWR"
FT   gene            151589..152470
FT                   /locus_tag="Igni_0168"
FT   CDS_pept        151589..152470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0168"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81352"
FT                   /db_xref="GOA:A8A8V0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V0"
FT                   /protein_id="ABU81352.1"
FT                   /translation="MRRAGIGERGDERGCQGRVPRLLVLYPQRKMPRSVLILGAYLTKL
FT                   GAITSLKSYEELSCRDLERFDLVVARGLPYYYDSVRMLSLIECLRTARKVINDPQATLV
FT                   ARNKYVSMKVLESNGVPVPKTFLVRTRFELLEKVKELGEVVVKPLSNSLGLGVNRVDER
FT                   SIHYLIPLLPYTFDLVIQEYVEKVRDVRSFVIGNRAVASMYRISPFKFATNYAQGSDVD
FT                   PAPLEEYSEISVKAVRALGLSYGGVDLVESPEGPKVIEVNPSPLWFGVSRACNVDVGFE
FT                   LAKFLFEEACED"
FT   gene            152550..152637
FT                   /locus_tag="Igni_R0007"
FT                   /note="tRNA-Ser1"
FT   tRNA            152550..152637
FT                   /locus_tag="Igni_R0007"
FT                   /product="tRNA-Ser"
FT   gene            complement(152731..153078)
FT                   /locus_tag="Igni_0169"
FT   CDS_pept        complement(152731..153078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81353"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V1"
FT                   /protein_id="ABU81353.1"
FT                   /translation="MVCVVIPTDDKKTVKLGHFGDAKYYLHYVKGEDGWTLVSEVVNPY
FT                   KEDEEHEHEHNTLEKRQKILELNKDCDIFVYTVFGPGGEDFMKKHGKVVVRVKPRTTIE
FT                   EALRAVEESLH"
FT   gene            complement(153125..153502)
FT                   /locus_tag="Igni_0170"
FT   CDS_pept        complement(153125..153502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81354"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V2"
FT                   /protein_id="ABU81354.1"
FT                   /translation="MVELPWRPFASSGKIVRNYEPLKHYLELVKGTEWYDKAFLSEDDF
FT                   NYLRKVAKDKMRLIDLLKELEEHFLNKINAEMALEAFRNADYPIEDEEEAKREMAKILA
FT                   GWLVEAAEEWDILRLRGPGFD"
FT   gene            complement(153564..153641)
FT                   /locus_tag="Igni_R0008"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(153564..153641)
FT                   /locus_tag="Igni_R0008"
FT                   /product="tRNA-Asp"
FT   gene            153739..155517
FT                   /locus_tag="Igni_0171"
FT   CDS_pept        153739..155517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0171"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81355"
FT                   /db_xref="GOA:A8A8V3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V3"
FT                   /protein_id="ABU81355.1"
FT                   /translation="MCGIAGIAAREEYYDDVLKELIRLLESLEYRGYDSAGIAVYDVDS
FT                   KKIRVWKKKGKVADLVKLLRSQLGDFKLKASVGIAHTRWATHGEPKDENAHPHIDCEGK
FT                   VAVVHNGIISNYKELKRELEARGHSFRSETDTEVFAHLFEEELKRKEPFEAFKAAVARL
FT                   EGYYAIVAITSLEPHKVFFARKESPLVVGRGPKGNYVSSDVVSLVGNCWEVSPLYDDDV
FT                   GWMNDKEIYVERGGVRRRLSFIKPTWSPVQAQKGSYEYFMLKEIHEQPQVVKETLISIA
FT                   SEWDKVEEVVNLLEGWAVVVAAGTSYHAGLIFSYNVMKETGRYIPVIDASEAPHFSKLL
FT                   KGTVVAISQSGETYDTLKAVRIAKENGAKVVGVVNVVGSTLDREADVSLYTRAGPEIGV
FT                   AATKTFLTQLSVLNALVARMVGEGANRVREMANELSKITKESIEVSAGYAKGLADQLYT
FT                   KRDMYVLGTGISYPVAMEGALKIKEISYVHAEAYPAGEAKHGPIALAEPGFPVLLVWTP
FT                   EDVEKLEVAEKEFESRGSEVYWVAPRGDVPIPEVDWKYVPFALTPPLQLLSYYMAVKKG
FT                   LDPDKPRNLAKSVTVH"
FT   gene            155574..156308
FT                   /locus_tag="Igni_0172"
FT   CDS_pept        155574..156308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0172"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81356"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V4"
FT                   /protein_id="ABU81356.1"
FT                   /translation="MLETAVLTSSSGGCGKTLLGAELARRGYVVLTASPITNYLNSYRV
FT                   MERYEIYDALKAYVDEGACDRCGECLEACTKGAITEDFKVIEGLCEGCPACAYACPRGA
FT                   IKFKQTKGAEYEIIKVEEGFVIEVRVEPGLNELSYLLGLMGVARRLAEDNGIGTVLVET
FT                   RARLPAQKGLFFVRKHPGAEDQVKEFELRSTGYERDAAVVVNVGLGDFDVNTSLKKFYM
FT                   PHKEDPSFSTFVEEVVEWLESR"
FT   gene            156290..156925
FT                   /locus_tag="Igni_0173"
FT   CDS_pept        156290..156925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0173"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81357"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V5"
FT                   /protein_id="ABU81357.1"
FT                   /translation="MVRVAVVGLGGEGKTLLSLKLAELLGAVPVEAKEVCELHYFIRAP
FT                   RVLIKTVESFYPAVVKDKCLRCNLCAAACPDKAMLRDEEGYPSSVPDLCSSCTSCFWAC
FT                   PHGALERRSKVVAKIYKVGKALQLEGKFLKGLLKDLDSLAGSSWVLDAERPEYALFADA
FT                   ALVVSRDPKRRARALQLANFLEKNGTRAVVVNPEEQGAEEVLDFLNHL"
FT   gene            156959..157252
FT                   /locus_tag="Igni_0174"
FT   CDS_pept        156959..157252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0174"
FT                   /product="nucleoid protein Alba"
FT                   /note="TIGRFAM: DNA-binding protein Alba; PFAM: Alba,
FT                   DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81358"
FT                   /db_xref="GOA:A8A8V6"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8V6"
FT                   /protein_id="ABU81358.1"
FT                   /translation="MAAQIPQSNEVRVGKKPVMNYVLATLTLLNQGVDRIEIKARGRAI
FT                   SKAVDTVEIVRNRFLPGQVRVAEIRIGSQTVTSADGRQSRISTIDIVLERVK"
FT   gene            157311..157631
FT                   /locus_tag="Igni_0175"
FT   CDS_pept        157311..157631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81359"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V7"
FT                   /protein_id="ABU81359.1"
FT                   /translation="MEETKKVTVFEGEARIGLMKVPTLTITLEPEDFESPLSFQMALSK
FT                   LMDELTKAFENPPESKYFAEVKFRDHLNRPVFVAVDLGKSIPPFSKNKVKARIVVEIYE
FT                   EE"
FT   gene            complement(157616..157888)
FT                   /locus_tag="Igni_0176"
FT   CDS_pept        complement(157616..157888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81360"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V8"
FT                   /protein_id="ABU81360.1"
FT                   /translation="MGFWPNKREMSVYYLLKKRFGDRFNLGEGLEVLSPYFSRKVALNI
FT                   IKRLTKLGLLEKRGNFEYAIVDLEEWLGKRTEEYLEARKGRHSSS"
FT   gene            complement(157892..158599)
FT                   /locus_tag="Igni_0177"
FT   CDS_pept        complement(157892..158599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0177"
FT                   /product="1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)
FT                   imidazole-4-carboxamide isomerase"
FT                   /note="PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81361"
FT                   /db_xref="GOA:A8A8V9"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8V9"
FT                   /protein_id="ABU81361.1"
FT                   /translation="MRVFPSIDVSEGRAVKRVRGVKGTGLDLGDPVKWAEFWALEGAKG
FT                   LHVVDLDGAEAGKPINVEVINKVIEKAKEYGLWVQVAGGLREVEHLERYPKADAFVIGS
FT                   RAHKDPEFLEVASEAVGADKVIVAIDLKGGKVSVEGWKEEIPVGLKEALEKFKGRSFRG
FT                   FLYTYVDTEGTMEGPDVSGVKYIRREYPDKLLEYAGGVGSPEHVKLLESAGADVVVLGM
FT                   ALYSGKLRLKDLV"
FT   gene            158651..159265
FT                   /locus_tag="Igni_0178"
FT   CDS_pept        158651..159265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0178"
FT                   /product="Mn2+-dependent serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81362"
FT                   /db_xref="GOA:A8A8W0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W0"
FT                   /protein_id="ABU81362.1"
FT                   /translation="MNLLAKGAEAEVYLAKYWGCKAVYKVRKPKAYRHPKLDLRLRYER
FT                   TRNEFNNMLRAYKEGMNVPTPYDVDYNEYSIVMEYIEGTPLSEKVEAWAIEEAGRQLAI
FT                   LHSADIAHWDYTTANLIIKGRKLFIIDFGLSRKTKSDIEKAIDAHLMIRSFLSAHPGRE
FT                   DLVDRFWKGYSEFGEAEKMRELTKQIELLGRYVKERRKTVW"
FT   gene            159259..159825
FT                   /locus_tag="Igni_0179"
FT   CDS_pept        159259..159825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0179"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81363"
FT                   /db_xref="GOA:A8A8W1"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8W1"
FT                   /protein_id="ABU81363.1"
FT                   /translation="MVSKKVYFLTSNPHKAKEVSDVLSQFSIEVVPLKGEKLEIQADSV
FT                   EEVARFAAEEAKKRFKERPLLLEDSGLFVDALKGFPGPYSNYVYRTLGLEGLLKLMEGV
FT                   EDRRARFVCAAALVKEDDKIVIEVGEVEGEIAYEPRGDKGFGFDPIFVPLGYEKTFAEL
FT                   GEEVKKRISHRARAFMKIAKHLSGE"
FT   gene            160032..160490
FT                   /locus_tag="Igni_0180"
FT   CDS_pept        160032..160490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0180"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81364"
FT                   /db_xref="GOA:A8A8W2"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W2"
FT                   /protein_id="ABU81364.1"
FT                   /translation="MARLVEEFKYIVRIGDTDIDGSLPAVYGLAKIKGIGYTTALAILR
FT                   KLGIDPHMRLGYLSETRIRELDEKVRDITQLGFPSWLYNRRKDYTTGKDLHLIGADLVF
FT                   YARQDIEREKRIKSWRGLRHSLGLKVRGQRTATTGRLGMTVGVSKKSR"
FT   gene            160502..161002
FT                   /locus_tag="Igni_0181"
FT   CDS_pept        160502..161002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0181"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81365"
FT                   /db_xref="GOA:A8A8W3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8W3"
FT                   /protein_id="ABU81365.1"
FT                   /translation="MGDPRKPRKKWSPPGHPWVKERLIEEMKLMGEYGLRNKREIWIAA
FT                   AMLRRYRHRARELLALPAEVREKEEKALLKRLYDLGLVDENATLDDVLSLTVRDLLERR
FT                   LQTVVYKKGLAKSIYHARQLVTHGHIAINGRRVTSPGYIVRRDEEELIGYAPTSPYFKK
FT                   AQQ"
FT   gene            161022..161414
FT                   /locus_tag="Igni_0182"
FT   CDS_pept        161022..161414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0182"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81366"
FT                   /db_xref="GOA:A8A8W4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8W4"
FT                   /protein_id="ABU81366.1"
FT                   /translation="MPKEIRWGVAHIFSSPNNTFVHITDITGSETASRVTGGMVVKADH
FT                   EKPSPYAAMIAAARAAQQAMERGITAIHIKVRAPGGYGPKTPGPGAQAAIRALARSGFI
FT                   IGRIEDVTPLPHDTIRRPGGRRGRRV"
FT   gene            161418..162269
FT                   /locus_tag="Igni_0183"
FT   CDS_pept        161418..162269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0183"
FT                   /product="DNA-directed RNA polymerase, subunit D"
FT                   /note="PFAM: RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81367"
FT                   /db_xref="GOA:A8A8W5"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W5"
FT                   /protein_id="ABU81367.1"
FT                   /translation="MPIEVLEETPTSIRLLAKGYPLAVLNAIRRAALELAPKMAVDFIA
FT                   VDRNDSTLFNEVLAHRLAMIPLRSEEALERYAPPEACMECTPEEAEADKCVVDGKPCYV
FT                   RLYLDASAEGKQIIVYSKDLKSEDEDVRPVYENIPVVPLIGDQKVKVIAYARLGRGREH
FT                   AKWMPATVSIVKPLLKGISVKEGLCDAECQKECAEKCKEAFVMKDGKLTLKEGTTLSMV
FT                   MYCIEYVCEGKGIRPVFEEDTYLFELESDGSLSARRTLVEAAKAVVEKLSELKNRLQSR
FT                   EG"
FT   gene            162277..162633
FT                   /locus_tag="Igni_0184"
FT   CDS_pept        162277..162633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0184"
FT                   /product="LSU ribosomal protein L18AE"
FT                   /note="PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81368"
FT                   /db_xref="GOA:A8A8W6"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W6"
FT                   /protein_id="ABU81368.1"
FT                   /translation="MPARRRKITNVLLRKTLDELWKTKSPAWRRVYELLNRPARQRIVV
FT                   NVSKINRYANDGDVVVVPGKVLGSGELEKKVTVAAFSFSYTALEKIETAGGKALHILEL
FT                   VKENPKGSGIKIIT"
FT   gene            162644..163090
FT                   /locus_tag="Igni_0185"
FT   CDS_pept        162644..163090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0185"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="TIGRFAM: ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81369"
FT                   /db_xref="GOA:A8A8W7"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W7"
FT                   /protein_id="ABU81369.1"
FT                   /translation="MKRVVVIDATNQIVGRMASHIAKMLLEGWEVNVINAEKAVLSGEP
FT                   TRVVKGYQILLNVKTHTNPYRNKIKRPRTPIAIIKDAVKGMLPKHNTRGREALKRLKVY
FT                   IGEPEYVPKENLMRFPDADALRLSGKYITVGEVARRMGWKGGEA"
FT   gene            163090..163536
FT                   /locus_tag="Igni_0186"
FT   CDS_pept        163090..163536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0186"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81370"
FT                   /db_xref="GOA:A8A8W8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W8"
FT                   /protein_id="ABU81370.1"
FT                   /translation="MVDVKWAKEQQGKGGVRIVLATGKRKRAIARAIIYPGKGRVWING
FT                   VPVEIVKPEIKRWRILEPLLLAGEKVMKNIDIKVFVKGGGFMAQAEAARMAIARGLVKY
FT                   TGSEELKALYEEHDRHMLSGDPRRTEPEKWMRYSARRRKQKSYR"
FT   gene            163547..163753
FT                   /locus_tag="Igni_0187"
FT   CDS_pept        163547..163753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0187"
FT                   /product="DNA-directed RNA polymerase, subunit N"
FT                   /note="PFAM: RNA polymerases, N/8 Kd subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81371"
FT                   /db_xref="GOA:A8A8W9"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8W9"
FT                   /protein_id="ABU81371.1"
FT                   /translation="MLPIRCYTCGRPLWPEYEEFLRRVEAGEEPGKVLDDLGIKRYCCR
FT                   RTMLSAVDISKEIIKFSTRVHRW"
FT   gene            163756..164394
FT                   /locus_tag="Igni_0188"
FT   CDS_pept        163756..164394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0188"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="PFAM: ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81372"
FT                   /db_xref="GOA:A8A8X0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023454"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8X0"
FT                   /protein_id="ABU81372.1"
FT                   /translation="MSAETGEKVVELLIPLEMYLQHGVHIGTKMVTNYMKRFVYKRRNI
FT                   DGLAILDVRKIDQRIRVAAKFLSRFEPEKIMVVSVRQYGHKPVTMFAQFTGAKPVIGRF
FT                   VPGTLTNPALEVYYEPDVILVTDTRMDQQAIVEAAEIGIPVVAICDTDNKTENVDLIIP
FT                   GNNKGRKSLALLYWLLTRQVLVERGQLSPDAPEDQPAPVSEFETKVKMV"
FT   gene            164523..164762
FT                   /locus_tag="Igni_0189"
FT   CDS_pept        164523..164762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0189"
FT                   /product="Ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81373"
FT                   /db_xref="GOA:A8A8X1"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X1"
FT                   /protein_id="ABU81373.1"
FT                   /translation="MAKYKVWIENEKCISDAVCAHLCPDVFEMNEEYKAVIVPQYRTGD
FT                   NPAEGVIPEELKDCAEQAAAACPVQIIHVEPLQE"
FT   gene            complement(164769..164996)
FT                   /locus_tag="Igni_0190"
FT   CDS_pept        complement(164769..164996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81374"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X2"
FT                   /protein_id="ABU81374.1"
FT                   /translation="MRCMYCGRTFFKGQGVVINIGGETFYFHSKKCALEFFKRLMERIP
FT                   LEVSLPAAKSLARELEEAIRKKEELSKKKF"
FT   gene            165104..167935
FT                   /locus_tag="Igni_0191"
FT   CDS_pept        165104..167935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0191"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81375"
FT                   /db_xref="GOA:A8A8X3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X3"
FT                   /protein_id="ABU81375.1"
FT                   /translation="MGVSAVEADLLPPRLVELIKERGWKDLTEVQKKAFKPITEGKNVL
FT                   IVAPTGYGKTEAAMLPIFAKMIEERPEPLSVLYITPLKSLINDLKNRIEWWAERLGFVV
FT                   ARKHGDVGASERSLRLKRTPHILLTTPEGFKIDLDWASQFRKYYKNVRWVVVDEAHELV
FT                   GSKRGVQLSLLLERLKAYSGRDYQRIALSATVGDPEATAKLLFGSSSREKEIVKVNVKR
FT                   KIELVVDSIGEAREEDSFWKASAKKILEHVEPPTLVFVNTRYAAERLHEELSKIEGLKV
FT                   EVHHSSISKEIRQEIEKNLKDGKLDVVIATKTLELGIDISDLNKVILFKPPGSVASLLQ
FT                   RVGRAGHKLGGVSRGVIITTDEIEALDGYTEAVLAVKGIVEPPKVPDAPLDVLAREIIG
FT                   MTLQEKRLDPSWAYEVVKGAYPYRNLTKETFDELINVLVKNKILAWDGDKLKVSYMFYK
FT                   LWSFDGGEKKRWSRSFGEFFSVISERDVFVVKWGNKVVGDLDAFYVYKYLRPESKIRLG
FT                   GKTWKVIGIDDEGMKVYVEPATDQMGEIPLWKGEEFHRSSLIPEYAKRVLEEEKPKEVK
FT                   LLPDAEKKVRKVFESYKRKNIDLPGGDVYYLEKVPGGYVLTGFMDQRLAEALAHLIMYK
FT                   VSSEYTTAVSVRSSFTGIAVTVDGGEAPNPIKLLKEIDDVEDAIRKAMERSPYLVQTAK
FT                   EIQLSFGKLGKVTPDDGLVFEEAVKQAIEKYIDVEKAKKFIEMLKEKKIKVKLIKAKSL
FT                   TPLAAHVMSLPAFRPWLKIIEARIVSLLKGEAFTAEELATMLDLSPTTVENKLKEMRKP
FT                   TSKARVVHFIDVEFGETRWCLLEDLDEIMKKDEYATSFKPLDPYENFTMFYRTSPKDEY
FT                   NMKYFKPLDIINNAEEFLRSINADEFYEVKVMFQGDPLFKNLVPRYFYVPKKALPAVLL
FT                   NAVAYIQRVRRSA"
FT   gene            167967..169355
FT                   /locus_tag="Igni_0192"
FT   CDS_pept        167967..169355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0192"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81376"
FT                   /db_xref="GOA:A8A8X4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X4"
FT                   /protein_id="ABU81376.1"
FT                   /translation="MSLVVSSLAFFLASLTSLTYPYFDDYVALSFVIAAAYAYAASRLV
FT                   KYAIAVTNPAIMIKALVLFWFLTPFLVALPFSYITGLGLIDSYFEMVSGFTGTGLTVLN
FT                   PSAETPFVNALRASSQWAGEVGALFLTLILAIVFHVSPTGIVSALGKGERVRPSMYNTL
FT                   IDLILIYLVLTIIPIVYMKLVGMSLYDAIVYTFAALATGGFAPTAGGTADLPFVQQLAV
FT                   ILTCVLGAVNFSVYLNLRYNKVRNALKHPELRLLIASILFYALLLLFVWKRFDAEHLWS
FT                   ALFHSASAVTTSGFQIQDVSKFGESSKYIITVAMIVGASAFSTGGGVKLYRAYVLGKSI
FT                   MKQIKSLGTPRGYVSTVTVMGKEITSEELTTMLTVVATYLFTMFALALVLTEQLSAHKV
FT                   KVPSIDVIFEVASAMSGTGLSSGLTAIAPPDVKITLSIAMILGKLEVLPFLFFLYDSLR
FT                   SLKK"
FT   sig_peptide     167967..168026
FT                   /locus_tag="Igni_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.897 at
FT                   residue 20"
FT   gene            169800..170174
FT                   /locus_tag="Igni_0193"
FT   CDS_pept        169800..170174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0193"
FT                   /product="SSU ribosomal protein S25E"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81377"
FT                   /db_xref="GOA:A8A8X5"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X5"
FT                   /protein_id="ABU81377.1"
FT                   /translation="MGRVNKPLSAIEKRQMKQLLRELRQKMIEERKEKRGVTLRVVAEA
FT                   NVVDQAQKAIRGMKYVTPTILAEKMGISVGLAKRVLRDLETRGVLKLYAKNRRVQVYVP
FT                   SDKFEQLVKPGAYSYTVKEM"
FT   gene            170186..170986
FT                   /locus_tag="Igni_0194"
FT   CDS_pept        170186..170986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0194"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81378"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X6"
FT                   /protein_id="ABU81378.1"
FT                   /translation="MRSLDPPDFYDEDYASRGVTNMMVPVDFWETSRPKPGFKTVVGFV
FT                   DVGLVGLIATKHMIEELGLEPIGGIDAPSELPLTPIRDGVVQYPIGLYYKHPWLVISPE
FT                   VPLPATLIYPIASAILDYVERRGTSEIISLTGLASLQRIKKEPSTFWIVNDPDLFEEET
FT                   MRKIARVGEPLKDGVLYGPTAVLLKLARGRGIPGVTVLAEAFPDFPDPGAAAKVLDALS
FT                   KIYDVEINTQKLIEDSERIKARLQEMANRAKEVIQERPRSMMYA"
FT   gene            170998..171306
FT                   /locus_tag="Igni_0195"
FT   CDS_pept        170998..171306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81379"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X7"
FT                   /protein_id="ABU81379.1"
FT                   /translation="MVRVSPNGKAEPLHTVFDLPDRVEILIDLPLADEKSLTVSLYQKT
FT                   LKVRAKLREKILIGGYEVEEYVKIMKIPEDVDEEYELEIVNREGPIVVIVFPKAARP"
FT   gene            171346..174051
FT                   /locus_tag="Igni_0196"
FT   CDS_pept        171346..174051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0196"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: alanyl-tRNA
FT                   synthetase, class IIc; Threonyl/alanyl tRNA synthetase,
FT                   SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81380"
FT                   /db_xref="GOA:A8A8X8"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8X8"
FT                   /protein_id="ABU81380.1"
FT                   /translation="MENEYRLRFFEEEGLKRKRCKVCGSYFWTKGEHEVCGDSPCQEYE
FT                   FFDVPTKVKLSLRDAKREFIKFFEEKGHVPVEPRPVVARWRDDLFLTIASIVVFQPHVT
FT                   KGLVPPPANPLVIVQPCIRLEDIDNVGLTLGRHMTGFHMGGHHAFNYPDNWVYWKEETV
FT                   KLAYEFFTERIGIPEELLNFKESWWEGGGNAGPSFEVTVAGLELATLVFMQYDVVEENG
FT                   QKKYVPMKLKVVDTGYGIERIAWFTQKTPTAFHAVYGELLHEFHKRLGVEEPPDELLYE
FT                   LVRSAGLMDPERPETLERVYKRASEKLGMRVDEIREIHSRASLVYQVLDHTRTLMWMLA
FT                   DGIVPSNVGEGYLARLVIRRTLRALKKLKADVPLSELLELQINYWKDDYPRAWKNKDYI
FT                   LDVVEFEQKKFEETLKKGRNIVIRLIKKKKQITLDDLVELYDSHGIPPDIVSEIAKEMG
FT                   VRVEVPHNFYSIVASRHQKTVHKVKGAEEKGKLPPEIIEWAKGFPPTRRLFHEDPYMKE
FT                   FDAQVIGSNRNYVILDKTAFYPEGGGQAADTGVIASGDESYRVVDVQKVGDVIVHVLDR
FT                   DYSGGKVVVGRIDWERRYRLMRHHTGTHLLLGALRKVLGDHVWQAGAEKTPEKARFDFT
FT                   HHKPLTREEVRKIEEVANKVIDERRKIRAFTLPRNEAEARYWFSIYQGGVPMSKDIRLV
FT                   EIEGWDVEACFGTHLSNTGEVGSLKIISTRKIQDGVVRVEFVAGTRVAEEAAKMEDLIR
FT                   EASEKLSTNPEMLVKRIDALQKELENVKKTVAEYRKRLVSEYLKAAKALDGIKYVKLDL
FT                   RDPELVQEVLRALSSDSPAAVIVDGRVELAAPKGVDVGKAVREVVREVGCKGGGKGNRA
FT                   TVVCESEEKVVELLSKLAAKLTSQPSGRRG"
FT   gene            complement(174078..174330)
FT                   /gene="ffs"
FT                   /locus_tag="Igni_R0009"
FT   misc_RNA        complement(174078..174330)
FT                   /gene="ffs"
FT                   /locus_tag="Igni_R0009"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            complement(174422..175888)
FT                   /locus_tag="Igni_0197"
FT   CDS_pept        complement(174422..175888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81381"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8X9"
FT                   /protein_id="ABU81381.1"
FT                   /translation="MRVAFVALLLSALLVAQNPIVESVKERSTQALLTRLAQAYCKSKI
FT                   ALEALSYSVSNIGSAITNISPDFEELVALLKPGGRLYEEIVSWSDNYVTNYSAFRNYVT
FT                   NLLIQARGLSSALRAAGALVEATYPGSARAKLLNAYSQQINNLVTEAGLHLQKYEALET
FT                   MQLLSELASILHPKGVDVYLEVGTSRNLLGFVRNNVNVTAIEPPPERAWLSLTACATDF
FT                   PNNTFILCAVVGNPQNYTVARKYYLSFNDPFYTNVYSFGLGAPCPINSIQIHGLMLNSW
FT                   NGYVNVYNYYINNVWRYEALLINSKNVLISILNTLGEDLLAPLLGAFAGRVPSTLQACL
FT                   QLASPGGQAQNLNNYDLRDPVQLRSFLSNVVNAFYNVLDGTTKAINCMKYYLPLIEKSQ
FT                   KAYLKALASKFRQISGQDVEAWAAANGIACSYVPPVSLVEALRITINTYKSLLDPQSPT
FT                   SFANTISTQEPPGVLKPSEVPQLPLGSPCS"
FT   sig_peptide     complement(175838..175888)
FT                   /locus_tag="Igni_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.843 at
FT                   residue 17"
FT   gene            175934..176950
FT                   /locus_tag="Igni_0198"
FT   CDS_pept        175934..176950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0198"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81382"
FT                   /db_xref="GOA:A8A8Y0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y0"
FT                   /protein_id="ABU81382.1"
FT                   /translation="MRFVERVLTEVREPIPLVGSIAFGIIDRGTNVLQVRITTVCSMCC
FT                   KFCSVDAGPCSKSRWADFVVTDLEWLRAWVNDVVKFKGVPVEVLLDGVGDPLEHPNVVG
FT                   VVRTLKSIEGVASVALETHGLKLNEDLAFSLAEAGLDRINLSIETLDEAKAKELAGRPD
FT                   YDVRRVKEVIEKVFRETQVDIHVTPVLLPGINDEDIKEIIKWVKEVGFGKRWPPITIQK
FT                   YVRHKRGRKMKGIKEMTWEEFWNYVSKLEKETGARLRWTMEEWGMMRARKLPELYKRGE
FT                   VVKVEIVSRGLFRDEWLGVPVGRRDVVMTVVNADVDVGRRIKVKVRQNKDNIYLASP"
FT   gene            complement(176932..178317)
FT                   /locus_tag="Igni_0199"
FT   CDS_pept        complement(176932..178317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0199"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81383"
FT                   /db_xref="GOA:A8A8Y1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y1"
FT                   /protein_id="ABU81383.1"
FT                   /translation="MKLVAKFGGSVLRDAEGYSASAKVVKECVGEGYKVVVVVSAMKGV
FT                   TDSLLKVSGSLPKDWKKYVEALKRRHERVLQQLGSSERWFKELEKNVEELKNVLWALYI
FT                   LREHTPRTRDFVLSFGERLSTILMSAALEREGLNPIPLTPEKAGIFTDENYNEAVPLYD
FT                   VIEREVPKRLEPFLEEDKVPVVTGFLGSTLEGSITTLGRGGSDLTATILGSSLKADEVR
FT                   LYTDIDGIKTGNPKEFPDAVTIRELSVEEAIELAHLGAKRLHPRTFEPVLRRHVDVRVL
FT                   SLYDPKGNNTLISHGRRGPMLKAVALLNGLAIITVKGVGMVGTKGVAATVMESVTKVGA
FT                   NIYAISQPVSEISISIAVKSSKADLVSNAIRNALEGKGISVETKIKDNVTAVSVVGRGL
FT                   EELDFVGNVLSLFDNKPVLMVSKGPLDQSLTVLTTNKASREIGRKIHEKIVEEMMQYYG
FT                   EAK"
FT   gene            complement(178366..178527)
FT                   /locus_tag="Igni_0200"
FT   CDS_pept        complement(178366..178527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81384"
FT                   /db_xref="GOA:A8A8Y2"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y2"
FT                   /protein_id="ABU81384.1"
FT                   /translation="MRRSAALKGLTLFEISIILLSLIATLAWVYMVYKITTLIDTLQTN
FT                   LNAMFGGA"
FT   gene            178708..180036
FT                   /locus_tag="Igni_0201"
FT   CDS_pept        178708..180036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0201"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /note="TIGRFAM: L-asparaginase, type I; glutamyl-tRNA(Gln)
FT                   amidotransferase, subunit D; PFAM:
FT                   Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81385"
FT                   /db_xref="GOA:A8A8Y3"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y3"
FT                   /protein_id="ABU81385.1"
FT                   /translation="MSYPSDLAASLLQKGIEVGDVIKVVRDDGLVVEGILMPRPKGGRY
FT                   IVVKLKNGYNVGIDVRRIKELELVAKRKPQRREKGEKPPRRPGYPLVKVLGTGGTIASR
FT                   IDYETGAVKPAMSTEELVEEVPELLDYADVEAEQIMDVLSENMTPEMWSRVAEAVHAEL
FT                   LREEVAGVVVAHGTDTMVYTASAVAFAIREINKPVVFVGAQRSSDRPSSDATLNLIGAT
FT                   IAAARSDIAESIIAMHGESSDTFVVLHRATRTKKFHSTRRDAFQSICAQPLAYVWPWTG
FT                   DVEPKSRPLRTRGDWTPKLMNSFEPRVLQLRAYPGMPPDLLYLAKDKGFKGVIIEGTGM
FT                   GHVPEYLVDAIKELTESGIFVGVTTQCVHGTTNLNVYATGRKMLEAGATPLGDMLTEVA
FT                   TVKLMWALANYPPEEVPKVMVTPLEGELRERRLLRDYRLSYRR"
FT   gene            complement(180005..180832)
FT                   /locus_tag="Igni_0202"
FT   CDS_pept        complement(180005..180832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81386"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y4"
FT                   /protein_id="ABU81386.1"
FT                   /translation="MQEAYMVPRGGRTRREGELERRDIRPLEGCQEVMLLTYTGPASGL
FT                   ARLYSNALMELKGTFAPVLRPEEVSQRYLPFSEGGGRATVFGLGDPSSTLRVLEALKVA
FT                   GYEVELFRPPLKGLPYELEGKLSAYPAREVPPDLLQALVEVGSTVLREALEGSDNPRAA
FT                   RIKEDLEDLEIPLTLNLDIDMIIYTNSMEMAAQALSYVTKAPALYYQEALGAELRNKKI
FT                   VILTTSSEEHWVRGMAVRMRAGLVSLPYDPLVAPLSFVASLRKVIAYTRADNL"
FT   gene            181026..181334
FT                   /locus_tag="Igni_0203"
FT   CDS_pept        181026..181334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0203"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase, DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81387"
FT                   /db_xref="GOA:A8A8Y5"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y5"
FT                   /protein_id="ABU81387.1"
FT                   /translation="MLRRLELLKELLLLIPLGKVTTYSSLASLLGTHPRAVGAMLARNE
FT                   DLVVYPCHRVVMSDGRLGGYALGKEFKRRLLELEGVKFCGPERVCKESVVDLKELLS"
FT   gene            complement(181315..181683)
FT                   /locus_tag="Igni_0204"
FT   CDS_pept        complement(181315..181683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81388"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y6"
FT                   /protein_id="ABU81388.1"
FT                   /translation="MVGRGEVFTLLLFYLVLSKTREAIVTNATTSAQDFLKVCNDTVTV
FT                   YLNGFPEYVVIGEGCLTVPLLANNFTLLDNKVFFWNSTPITLMKEDNEGTRGLSVPPWV
FT                   APTALLLIRGLLSKRAAL"
FT   gene            181849..182793
FT                   /locus_tag="Igni_0205"
FT   CDS_pept        181849..182793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0205"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81389"
FT                   /db_xref="GOA:A8A8Y7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y7"
FT                   /protein_id="ABU81389.1"
FT                   /translation="MEPKELYEKILNNVTQHLAGVERPVEVLTISLLSRGHALLEGVVG
FT                   VAKTTLAKLFAQSLGLSFRRVQMTPDLLPADLLGGKIFDPKTGEFRTVKGPIFTNVLLV
FT                   DEINRASPRTQSALLEAMQEGQVTIEGETFELPKPFFVIATMNPVEMVGTYQLPEAAKD
FT                   RFLASIDMRFPPREVEVMAVLLDSERRAREPSASPVAGPEDVIDAIERAQAVKLSRKVA
FT                   EYVVDVVRATRRAPGVLLGATTRAAIHLARAAKAKAAIEGRDVALTDDVKYVAPYVLAH
FT                   RIVVEVPTTRLFASRDAALKVVSEVLEEVEPPA"
FT   gene            182790..184076
FT                   /locus_tag="Igni_0206"
FT   CDS_pept        182790..184076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0206"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81390"
FT                   /db_xref="GOA:A8A8Y8"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y8"
FT                   /protein_id="ABU81390.1"
FT                   /translation="MRFIVALVTLAIAYFMLNSLEPLNAGALVAGGRVEVPYSWDVSGP
FT                   RVVLASVSPPDAKWLRVASFSVYTGDAWVKGDEELSGKLGGAEYKISVTPYAIMLYPAM
FT                   PVPQPAPGYTPQGQGLTKIKDEFRSDSFVIKVRVEYGAPFPYGEYPELGYRVSSLLGEP
FT                   KGWSTPRVQALAAQLLERFRDKTLRELLGYLTSWLRDNYRYALRYSGTPAGDAADWFLF
FT                   VSKTGMCVHFATAAAVLLNDMGIRARVVYGFANSYVNDGLRVFTTPTHLWVEVWTPSGW
FT                   VPWDPSPPLTLASASGTPLQRSAPQAQTIQELGGGRGASARTAPPALRTNPLELLVMIS
FT                   ALLLVSIYAAPLKGWLVAWPLAFRRCVERVYGAKGLTLREVAEITGIKELEHAQREYLL
FT                   EGKWPRRGVLKALRWCLARWARRTRYRRR"
FT   sig_peptide     182790..182849
FT                   /locus_tag="Igni_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.808) with cleavage site probability 0.424 at
FT                   residue 20"
FT   gene            complement(184359..185135)
FT                   /locus_tag="Igni_0207"
FT   CDS_pept        complement(184359..185135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81391"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Y9"
FT                   /protein_id="ABU81391.1"
FT                   /translation="MNVLSNALLATLKSVLSQYSSSRVEDYCLCRKLSYALVDGRMGFA
FT                   FLPECEGLTEVVEPKAYVRKVFSLAWKGEAETSLALATMSALTHKWIDEGGEVDFDSTS
FT                   LIDVVDIKKGDKVIMIGYMRRVLDEIVERGARVILYEDNYRLRCEAKQLGVEAYPGSYV
FT                   LLEDSAEVVIATGASLLDPRGPYVLDKVSAKEKVLLGPTATVHPYFAKLLGATRVGGSY
FT                   VPKESQEKVLSAIKAGYGYHKLVKLGLIKRWFAKAS"
FT   gene            complement(185180..185482)
FT                   /locus_tag="Igni_0208"
FT   CDS_pept        complement(185180..185482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81392"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z0"
FT                   /protein_id="ABU81392.1"
FT                   /translation="MQCVEEVSKRLGKRSGCVPLKELIAVLDSLEANEEVKESCIELFK
FT                   QFPCVSGNEIRNDLVDLRRVRRVVELVDLLTILYQIETKNAQILEVKLREDLSPN"
FT   gene            complement(185567..186397)
FT                   /locus_tag="Igni_0209"
FT   CDS_pept        complement(185567..186397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0209"
FT                   /product="ribosomal RNA-processing protein RRP42"
FT                   /note="PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81393"
FT                   /db_xref="GOA:A8A8Z1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020869"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z1"
FT                   /protein_id="ABU81393.1"
FT                   /translation="MSITPFNVPIVPKLKRDTILSLAKRGTRIDKRRLDQYRPIKITLG
FT                   VGGKAHGSALVEIGNTKVLAGVKVEVGKPFKDVPDAGVLNVNAELLPLASSEFEPGPPD
FT                   ENAIELARVIDRALREPGVIDLKELVLIPGEKVLVVWLDVYVLDHDGNLFDASMLASMA
FT                   ALLDTRYPEYVVREDGSVEVDEANKRPLPIANKVVSVTLNVLENLFMVDPTLEEEVVAD
FT                   GKIVFAFDERGRLVGLQKSGPAWLDLDKSTTAFNLAYSKYKELLEVLEKSLAER"
FT   gene            complement(186398..187123)
FT                   /locus_tag="Igni_0210"
FT   CDS_pept        complement(186398..187123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0210"
FT                   /product="ribosomal RNA-processing protein RRP41/SKI6"
FT                   /note="TIGRFAM: exosome complex exonuclease 1; PFAM: 3'
FT                   exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81394"
FT                   /db_xref="GOA:A8A8Z2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR011807"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z2"
FT                   /protein_id="ABU81394.1"
FT                   /translation="MMKEPPVPLIVDGKRHDGRGPADLRPLEMKVGVLYNADGSAWLRI
FT                   GGTEVVAAVYGPREPPMRGMVLPDRAVIRCRYHMAPFSTDERKNPAPSRREIELSKVIR
FT                   EALEATILTHLFPRTIIDVFIEVIRADGGTRTAALTAASLALADAGIPMKGLVAGVAVG
FT                   KVQGTLVLDIDELEDMYGEADMPVAAIPSLNKIVLLQLNGVLEPREFPQALKLAWEGIK
FT                   KIHAMQKKVLAEKYGGGEA"
FT   gene            complement(187120..187839)
FT                   /locus_tag="Igni_0211"
FT   CDS_pept        complement(187120..187839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0211"
FT                   /product="ribosomal RNA-processing protein RRP4"
FT                   /note="PFAM: KH, type 1, domain protein; SMART: RNA binding
FT                   S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81395"
FT                   /db_xref="GOA:A8A8Z3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023474"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z3"
FT                   /protein_id="ABU81395.1"
FT                   /translation="MNKQSNEVQRKIVMPGDLVVKGNYTINPKSIMYLYKVGDAVYAAV
FT                   AGMAEITNGTVSLIPFEGTYIPKPGDLVIGVVENFVVTHWQVDINSPYIGILHVSNLLG
FT                   RPYNPAKDNLKEYLDIGDYIIAKVESFDRTKDPILNVQGKGLGRVVEGKIVEIKPSRVP
FT                   RVIGKKKSMLNVIKGDTGCEIIVGANGRIWIKCPNKDLEDIVTLAIKLIEREAFATGLT
FT                   EKVRVLIATEKHERGLL"
FT   gene            187888..188598
FT                   /locus_tag="Igni_0212"
FT   CDS_pept        187888..188598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81396"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z4"
FT                   /protein_id="ABU81396.1"
FT                   /translation="MSLKVIAGQITYIERLYIYHYVPGAHALWISLDSWEPPESPLEFL
FT                   RGEGRQLSVEEIVKRALKYSTKTLVFDGPLPYEVAEELLRRGFRVAVRYDAPLELPKGA
FT                   SLLMQTSSPEDLRAQLKAYDDVHLEVYPTNLEALEEAPKDLPVHLFSWPDYLKVEKMGF
FT                   YYVYNHTQPYREDTKCPRCGTPNAVRENDTLLGWDGPRCRRCGFRLHYHAEETPEVPRV
FT                   IREWLSWRFSVPVL"
FT   gene            complement(188552..189037)
FT                   /locus_tag="Igni_0213"
FT   CDS_pept        complement(188552..189037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81397"
FT                   /db_xref="InterPro:IPR007309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z5"
FT                   /protein_id="ABU81397.1"
FT                   /translation="MSSEKLNLTELEKKALKLIIEAGKDGLLQQDLWKKLNIDSRDGSR
FT                   IALRLAKKKLIHRELVTVKGRKTYRLTALVDKVPEEEESEEKKEVKYEKRIPRSIKLDV
FT                   KVRMGLVAKIPCTSCPHANRCGPGNFFDPATCTKLGQWLEKAVKALERKSAKRATRV"
FT   gene            complement(189083..189391)
FT                   /locus_tag="Igni_0214"
FT   CDS_pept        complement(189083..189391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81398"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z6"
FT                   /protein_id="ABU81398.1"
FT                   /translation="MKRLRFRFTKAKWNINALKDVLGSIAESFPESEVLIFRSGRNMPI
FT                   LDINVYVDEEQVSDEKIKEAEKKIFSVLTDYNISHVVFRGIKIFEVSREGEEGGSEE"
FT   gene            complement(189454..190242)
FT                   /locus_tag="Igni_0215"
FT   CDS_pept        complement(189454..190242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0215"
FT                   /product="shikimate dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81399"
FT                   /db_xref="GOA:A8A8Z7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A8Z7"
FT                   /protein_id="ABU81399.1"
FT                   /translation="MLFAVIGHPIEHSLSPLLHKISFELMKVEAEYVKVDVPPHRLGDF
FT                   MSSVDMIFNGINVTIPHKVEVLKYVDVADDLVNEVGAANTLKIKDGKIYAFNTDVEGVR
FT                   GSIKDAVDPKGLKVAVLGAGGAARAAVVALRDEAQVTVFNRTLEKAKRLAEELGVDYAG
FT                   LNEVDKIKKHDIIINATPVGMDGVSMPIPPDVIESRHVLMDMVYRPLYTPFLKVGLAKG
FT                   AKTVNGLKMLVIQGMESEKVWLGASPYWRDVYERLLASLA"
FT   gene            190320..190559
FT                   /locus_tag="Igni_0216"
FT   CDS_pept        190320..190559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81400"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z8"
FT                   /protein_id="ABU81400.1"
FT                   /translation="MFGKGWGRGRGWGRRRFGKWGARWWWHYYAAPPVAQPPVQEARPP
FT                   QGAQEDEFPEPPVWGGPGWRWWYWWYYSQRRERK"
FT   gene            complement(190596..191744)
FT                   /locus_tag="Igni_0217"
FT   CDS_pept        complement(190596..191744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81401"
FT                   /db_xref="GOA:A8A8Z9"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:A8A8Z9"
FT                   /protein_id="ABU81401.1"
FT                   /translation="MAYAATPMSPVRIYGSYGFTFDGRGIMMIEGIKLYDNLFTKLYVK
FT                   TPLEVCEGAEACSLYYEGIMNFYPALGTLEKFMEIKFKVLTNVPPRYAALKDLLGETAE
FT                   KLFVMCTVIPRPEVASATVAGSVAKFLALNMRTFYFFALAPYNVELRKGDTVTMTYFIS
FT                   TSPSDVSLYGRRMIAKGNPCPLGSPYYAPVPDVYNFGGITNITMQWGWSVPNALKPVGY
FT                   WDFPRPAYYVFTVKGAVGYAAQGGYTSNRGPSGLITVQPMIVSVGLSAYPTAPFSINLP
FT                   PSYVGAVMQSFEVTFARKCPGDVDLDGKYTMKDFEVVACMTNLITNRKYCNVVINNLPP
FT                   QLKEIFSMTGDVDQNGVVNQNDALVLLSYVGTDCPAADYASR"
FT   gene            complement(191746..192036)
FT                   /locus_tag="Igni_0218"
FT   CDS_pept        complement(191746..192036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81402"
FT                   /db_xref="UniProtKB/TrEMBL:A8A900"
FT                   /protein_id="ABU81402.1"
FT                   /translation="MRLVAWSAGLNVERRRVHVALIVKCNGNCNSILSRAFEIFKPIED
FT                   KPIFTWSDYFEGFVLSTRFPKPLEEVKAFCESAAGGLIETCDLLVDDRDST"
FT   gene            192084..192932
FT                   /locus_tag="Igni_0219"
FT   CDS_pept        192084..192932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0219"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81403"
FT                   /db_xref="GOA:A8A901"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8A901"
FT                   /protein_id="ABU81403.1"
FT                   /translation="MKVEDELLAIVRRRLGAGLLGPGDDVDFIKVGDYRLVFNVDGFSA
FT                   KGVLLEFMDLRDVGWRGVTACVSDLVAKLVKPKYFLHSVYGSDVEEVREIVEGIVEAAE
FT                   EYGLAFLGADTNKGEAAVDVFCFGLSDLDPPRLGGARPGDKVVVPEGCWGCINRCLRGE
FT                   YWEHCKRPKVPLELLERLRGYEKYVHASTDSSDGLVISLYKLAWASGVTIALHEPPPGP
FT                   LGEEGLYGGEEYLPVFVVDPSASEAVEEAVKGRAIGEVLPGRPEVVYKGRTLDPRGWEW
FT                   F"
FT   gene            192965..195343
FT                   /locus_tag="Igni_0220"
FT   CDS_pept        192965..195343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0220"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81404"
FT                   /db_xref="GOA:A8A902"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:A8A902"
FT                   /protein_id="ABU81404.1"
FT                   /translation="MEFKPKLELKRWDFKIEDQVRSWWEKEDWWKFDPNSPKPKFVIDT
FT                   PPPYPAPLWHIGAAVSYAMHDMIARAMRMMGYEVLYPIGFDRNGLPIELYVEKYLGLTP
FT                   WKTDREKFLETCRQVLDSWVEKMKETLKRLLIAADIDNPYQTDSPDYRAFTQATFIEAW
FT                   KKGLVYEAERPNNWCPKCRTTIADAEVEYKEMKGIMAYIKFKVKDSDEELVIATTRPEL
FT                   LCACRAVVVHPDDERYKKYHGKKVIVPIYGHEIPVLPHKMADPNFGTGAMMVCSFGDWR
FT                   DVQIFRELGLTPVKAIDEEGKMTECAGPIAGLKVKEAKMKIVELLKEQGYLVKVEDIVH
FT                   KVPVHERCETPIEIIPMKEYYLKQLEFKDVLKKYAEEMKWQPERYKKNLLQWIDSVSTD
FT                   WPISRRRFYATEIPVWTCKRCGYKYVPPPGRYYRPWKEDPPIDKCPKCGAREWEGEKRV
FT                   FDTWMDSSVTVLYITKYMRDEEFWKKTFLEGVKLRPQGYDIIRTWLYYSLLRVHQLTGK
FT                   RAFDLVFINGMGLDPKGKKMSKRYGNVIMPEEILNKYGADATRFWIALEVKPGENYRVI
FT                   ENKIQGAQKFLTKFLNVARYVSSFPYPEGRVELREADKWILAELAELIEKVRKAYAEMD
FT                   FHTVAEEFYHFVWDKFSSHYIELSKKRARMMDERFDEEDAKAAWWTLHTVLKNLLLILA
FT                   PISPAISDYLWRRLYSSESVHAQRLPEAPEEWRDEATLEKGRAIMELNSKVWKAKKEVL
FT                   GKKLSDPVTVEELKSAGVELPELGGFEEDFMALHNVVRG"
FT   gene            195429..196637
FT                   /locus_tag="Igni_0221"
FT   CDS_pept        195429..196637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0221"
FT                   /product="ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81405"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A903"
FT                   /protein_id="ABU81405.1"
FT                   /translation="MICRRACFKVVDDLDLTPLISYLSQVAEKSGCDAKLTLNVSRKTL
FT                   VCEVCCLRSKKLIDVIKARFAAVKGLKASKCFGSKGLTAPSGWWPLSGSVCLGVEAFTG
FT                   SPFCLDERNLRRHAVIVGSTGSGKSTTAKKIFKELAHNKLVLDWHGEYRGVAKRIECIS
FT                   LNRLRSLGQLELMDALANSLKLTDAQYYLLMKVVQMLYAKGGEFGIRDIIFYLKSLEEL
FT                   SRWIRESKYSLLRKLEMLTVRGTCKFEITDLESLTEGGLVIDLSGYVTEYAKKFVSHAV
FT                   LAYLFAKARGGELKRTYVIVEEAHNVIPKSSELSVADKIFMEGRKYGLHVIAVTQSPRA
FT                   MSENVMKNSYVKIIHGIREVDDAKYVAESVGDPSLWKEIISLDVGEAIVAQRKLARVII
FT                   SNS"
FT   gene            complement(196621..197166)
FT                   /locus_tag="Igni_0222"
FT   CDS_pept        complement(196621..197166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0222"
FT                   /product="nucleotide kinase-like protein"
FT                   /note="related to CMP and AMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81406"
FT                   /db_xref="GOA:A8A904"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A904"
FT                   /protein_id="ABU81406.1"
FT                   /translation="MFILIAGVPGSGKTTVAKELSKMIGCKSLSVTDVVVKNKLYVDVE
FT                   KDECGKPLYVVDMDKLEELIKGLEGCYIIEGVVVDFVPPEATKKVLYLQARPKTLIARM
FT                   EQKGYCKEKICSNLEAELVGSYLQMLRGLYGDKVVCVQSDGPLDRTLEEALKAVKCERL
FT                   PCARWSQEDFEEFSSYCL"
FT   gene            197200..198057
FT                   /locus_tag="Igni_0223"
FT   CDS_pept        197200..198057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0223"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81407"
FT                   /db_xref="GOA:A8A905"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8A905"
FT                   /protein_id="ABU81407.1"
FT                   /translation="MTRKYGWAAWKGQLDKLEELLKEAREAGFDYVEFSLDYPLPYKAD
FT                   LVAEIVKKIKDFGLAVSFHAPWRGLDVATLWPEVRKASIDIIKKSIRMASELGAEYVVY
FT                   HVTTPEKLFKDTVDEVYEAGKEAVAELTDFAREMSVEAAVENVGNLGTPEFFGILKDET
FT                   RAKFCFDVAHAVTTFMQRHKLKLNDVDVDEVIELWKNAIGGRTLCAHVHGVEAPRREHR
FT                   PLGYPLTKRAAAKAYVSLGADYVTYEIYYVRKGEEATPKVVGKEMKDVRSWELVYEKRQ
FT                   ALVA"
FT   gene            complement(198065..198607)
FT                   /locus_tag="Igni_0224"
FT   CDS_pept        complement(198065..198607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0224"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81408"
FT                   /db_xref="GOA:A8A906"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A906"
FT                   /protein_id="ABU81408.1"
FT                   /translation="MILSDGGIKSYLRRGLMKIEPFDENQVRENGVDLTIGHQYARFKN
FT                   TEDVLDVTKEEDLSKYYELGFMDDEGIVIKPYEHVLLHTREYIEMPADLVGLVNLKSSF
FT                   ARLGLYIPPTVVDAGFKGEIVIEIIGSSFPVRVRPGVPFIHLVFLRTDSPVLRDYSVRG
FT                   HYQGQRGIRLPKLPIKL"
FT   gene            198709..199065
FT                   /locus_tag="Igni_0225"
FT   CDS_pept        198709..199065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81409"
FT                   /db_xref="UniProtKB/TrEMBL:A8A907"
FT                   /protein_id="ABU81409.1"
FT                   /translation="MVEHEEPFAFVIESISEGRIRERLMSCLERKDEAKGFLESIMLSK
FT                   REESPVICVTGKHLTPRGVYDKFVLVLPHEAKFIDDEDYDEEEVMFFEHRGKVYLVRVF
FT                   LDRDGMEKLTIERL"
FT   gene            complement(199062..199295)
FT                   /locus_tag="Igni_0226"
FT   CDS_pept        complement(199062..199295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0226"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81410"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A8A908"
FT                   /protein_id="ABU81410.1"
FT                   /translation="MARVYLLIKTESGMEEKVYQALKGLDYVSRVDIVTGPYDVIAIFE
FT                   ADSLSKIEDYILNKVRKSEGIRETTTLIALTA"
FT   gene            complement(199341..200249)
FT                   /locus_tag="Igni_0227"
FT   CDS_pept        complement(199341..200249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0227"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81411"
FT                   /db_xref="GOA:A8A909"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:A8A909"
FT                   /protein_id="ABU81411.1"
FT                   /translation="MLDLSADVGGLKLRLPLMPASGILGGSPDALEAVAKKAKVGALVT
FT                   KTLTLEPRKGNDPPIVVSTPCGLVNAVGLANPGVKVAKELVEVGRKYNLPVVVSIAGKD
FT                   EREFAEAAWASVDAGASALELNLSCPHAKGLGLELGMDINAVRKVVEAVATTVNVPVFA
FT                   KLGLVDKLVDTASAALDAGASGLVLINTIRAMVIDIDVMEPVLTNKVGGLSGRAIHPIA
FT                   VRAVYEVYKELKAPIVGVGGVYEWRDAVELVLAGASAVQIGSAVADKGLGVFSEVLAGL
FT                   AWWLHSKGFRSLREAVGAAVR"
FT   gene            200321..201187
FT                   /locus_tag="Igni_0228"
FT   CDS_pept        200321..201187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81412"
FT                   /db_xref="GOA:A8A910"
FT                   /db_xref="UniProtKB/TrEMBL:A8A910"
FT                   /protein_id="ABU81412.1"
FT                   /translation="MRKGVINVVEVLVLIVIFLAAAAFLASFYMTSVTQQSEKIKEESQ
FT                   KNVFLINPPAKVIGTVVVENYTNSESEANGQKDAVPFACLEEVGSGKSWWLSSVYLIKG
FT                   YGGNVFKSVSLYDVVKTVSEVSNLGDGSKQNFTEVAFGNLNKLVALCYLNDTLNAVYKF
FT                   DVSCDEEVLKKTVNDAVGWCKSKANAQTTWMVKFLNPFQYLPSGGVGVAVGPIIPGEVV
FT                   QQGGTFSFKVKLAESYDPNPLLPYSLKQEGSLTFDDIVSWIQKGNGAVSAVGVIEAVCE
FT                   SCTFSVG"
FT   sig_peptide     200321..200428
FT                   /locus_tag="Igni_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.263 at
FT                   residue 36"
FT   gene            complement(201184..201840)
FT                   /locus_tag="Igni_0229"
FT   CDS_pept        complement(201184..201840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0229"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81413"
FT                   /db_xref="GOA:A8A911"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A8A911"
FT                   /protein_id="ABU81413.1"
FT                   /translation="MSEFEVIEEFLSIQGEGSLVGTPAYFVRLARCNLRCPWCDTKYSW
FT                   SPGLKVPVSEVAERALESGVGLIVLTGGEPLLWQLEIRSFLKELEEKGFKGLVQIETNG
FT                   TIYPSALEGHEIWITVSPKVTCDYYINFPSTVRRILENFSGELKLVVRRTDLTCVKKFL
FT                   EELGDVPRPVVLQPLDEGEGYASAARELVLEVLKDDYLKRRVRVVPQVHKLLQMP"
FT   gene            complement(201840..202226)
FT                   /locus_tag="Igni_0230"
FT   CDS_pept        complement(201840..202226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0230"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81414"
FT                   /db_xref="GOA:A8A912"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A912"
FT                   /protein_id="ABU81414.1"
FT                   /translation="MSKPFYVRFEVPPELAEKAYEALRKARESGGKIKKGTNETTKAVD
FT                   KGLAKLVLIAEDVDPPEIVAHLPLLCEEKKIPYVYVPSKKKLGEAAGIEVQAAAAAIID
FT                   PGAAKDLVEEIIKEVEQIKAKAGL"
FT   gene            complement(202406..203692)
FT                   /locus_tag="Igni_0231"
FT   CDS_pept        complement(202406..203692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0231"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81415"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:A8A913"
FT                   /protein_id="ABU81415.1"
FT                   /translation="MLHYLNLDVRAVTLSLDVTGKEKEEIVETVESKGSELVRAVREVS
FT                   EEHGIPIVTVRMALTPLAEVVNKEEELVELAKELDRAAVKTGVDALGGFGAFAEVGLNA
FT                   RAKTLIKVLPEVLSKTERLFGFLNVGDTWSGLNVEAVYEVSEALIDLAIRTKGTGNAKF
FT                   LVSANLPGDVPFMPGAHHGKGRPEAEVNVAISGPGVMEAVVRRSKVNSFRELYEVLKKA
FT                   AFKIARLGEFAGRKVAEKMGVEMGSVDLSLAPTPKMGDSVAKVVEAMGVPSFGAPGTLA
FT                   ALALLVEALKKGGAMAVSRFGGFSGLFVPLSEDSGMVEAAQRGTLDLYKLIAYTSVCSA
FT                   GLDMVPIPLVTPETLASITLDQLMIGVINSKPLGVRLLPVPDAKPGDVIELGGLLGRGV
FT                   VLPVEDLRPNNFIRLKGHVPPPTLRLHRG"
FT   gene            complement(203703..204038)
FT                   /locus_tag="Igni_0232"
FT   CDS_pept        complement(203703..204038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81416"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:A8A914"
FT                   /protein_id="ABU81416.1"
FT                   /translation="MRLRAAAALAYDDFVKGCTISSYFPVEVLLYYFGTKQISRALELS
FT                   AKELEGVEVAYFADVELPPRPLWVTELEGCPFELVPREWMVKAMEIRSEKRRKRCRKVE
FT                   VQARGDS"
FT   gene            complement(204061..204654)
FT                   /locus_tag="Igni_0233"
FT   CDS_pept        complement(204061..204654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0233"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81417"
FT                   /db_xref="GOA:A8A915"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8A915"
FT                   /protein_id="ABU81417.1"
FT                   /translation="MTRRVRGRAQTLPLLTLEGPRMYEVVSWEEVHKMSLELAKAIGDS
FT                   VDAVVGLLRGGYVPAHLIADALGLELYVMRIKSYRGIGKKGKPVVTLPLIGNVTDLRIL
FT                   LVDDVCDSGETLSVAKKFLEAYSPKSITTAVLFKKPQCSEEVDLWVKESGNWIVFPWDA
FT                   SETLREDPSVKGALEEALGVELDILGEGGGSGEA"
FT   gene            complement(204733..205083)
FT                   /locus_tag="Igni_0234"
FT   CDS_pept        complement(204733..205083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81418"
FT                   /db_xref="UniProtKB/TrEMBL:A8A916"
FT                   /protein_id="ABU81418.1"
FT                   /translation="MEEVSLRARSKLSSELSRVLKAALGPLEASVEGNKAVIRNASDKP
FT                   VFIERLSVLYYYTVNAPDGKVIRRRGEETVLERKELKPNEILNVKFDVDIAGLKAVLVV
FT                   SDEVKSYEALLK"
FT   gene            complement(205149..205901)
FT                   /locus_tag="Igni_0235"
FT   CDS_pept        complement(205149..205901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81419"
FT                   /db_xref="GOA:A8A917"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A8A917"
FT                   /protein_id="ABU81419.1"
FT                   /translation="MELWLYVTVPYSILLVLAYLFLRIKIIKDMVKRRIMTPTSAKDVT
FT                   HILDYIFMIMLIVGDFVGYLSPQVLAFLLSALLITTPFLLWDVVRSIVHYYIITSTKIV
FT                   NVGNFVILTRGVRGWIKRITPFFVELRGEYEETIRVPNSLVAMELVRIPSRSLPFTLTV
FT                   RFYGVNDFNAIEEALKDAVVYTKKFSVAEPKIKVRGVGNDWIEYELTYGLRNYEVTNDI
FT                   MKLLANKLGKLVEGVKFEIRREHSLMVK"
FT   gene            complement(205907..206569)
FT                   /locus_tag="Igni_0236"
FT   CDS_pept        complement(205907..206569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0236"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81420"
FT                   /db_xref="GOA:A8A918"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8A918"
FT                   /protein_id="ABU81420.1"
FT                   /translation="MKILVVGIGELGRRVATDLSLKGYDVVAVDVNSEKCQALAREADV
FT                   MVINRDATDPSLYEELELGSFDVVIASTDRDEVNLFVAAVAKEYGVGNIVVVTRTAKAS
FT                   ELIEMLGLADVTFPSPIVSAKLVLSYIEGKYGIVELTKVLSGKYGIYSIEITSGDSSVG
FT                   MKISEIKEILPKDVMILAVFNGEQFVEPEEELTLEPGYILILLAPVGREEEIESALR"
FT   gene            complement(206576..206938)
FT                   /locus_tag="Igni_0237"
FT   CDS_pept        complement(206576..206938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81421"
FT                   /db_xref="GOA:A8A919"
FT                   /db_xref="UniProtKB/TrEMBL:A8A919"
FT                   /protein_id="ABU81421.1"
FT                   /translation="MCSGSSFSSTRGPRRARVLADWGELLLLNYAFLYSLSTVFWRTLR
FT                   DKVKKERPFALAYATGAHLIFLTSLLRLNLIDWIPLVITSYLIMSIISITRPDKAMLPY
FT                   VYTAWATLLALEVAMG"
FT   gene            complement(206916..207602)
FT                   /locus_tag="Igni_0238"
FT   CDS_pept        complement(206916..207602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81422"
FT                   /db_xref="GOA:A8A920"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8A920"
FT                   /protein_id="ABU81422.1"
FT                   /translation="MLALAFSDVHSPKYLHLLKADGRYRLTLMAGDLVERSRVENLRPV
FT                   VEFAKSRSDFIISVFGNEEYREKEEEFREAYPEVRWLDDEYAVMDLGGPCVSVVGSRGS
FT                   LLRPTSWQRKHLPNIEEEYSKKPEVIRKLIREAKKECPTVIYLSHYAPTWKTLVGEKRS
FT                   IWPYLGDPRIERVLLEEGVRLAVHGHAHYGRVAYVNLGRLTIYNVALPARGKPTKIAIG
FT                   VQRKLI"
FT   gene            207603..208457
FT                   /locus_tag="Igni_0239"
FT   CDS_pept        207603..208457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81423"
FT                   /db_xref="UniProtKB/TrEMBL:A8A921"
FT                   /protein_id="ABU81423.1"
FT                   /translation="MVPGRCLSKKGLRCDPPTFEHPSRRSERWSKLSSKGRRKKSSKVK
FT                   RRQWDPAKFAEDAAPLVASALGLDSLGLSEDEYVELLRDIIVGLVGDRVTKPKPENIIK
FT                   NIRRNESRIMSIIAFKLLEVVPEGKLTPEQYEFVAANIGPLVIPVAQRLYKEAKRLGLD
FT                   VTPLQGAWEEGWRLRGDPGPVGYCPNCGFRAVAPDGSCMVCGKVLDDKELKEAVEFDAK
FT                   FEEFLETASCNELKEAFKRGTLYVSHASTSLEPQTKWDVEVFLSKKEREALRSAISRRC
FT                   QPS"
FT   gene            complement(208429..208863)
FT                   /locus_tag="Igni_0240"
FT   CDS_pept        complement(208429..208863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0240"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81424"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:A8A922"
FT                   /protein_id="ABU81424.1"
FT                   /translation="MIERVEVTVIIHATEDPEKVMESVFNLLGLNKEDVDEVETLRSRG
FT                   HHGNPITYVKMVIKGKKAQKALRNIISRMDELEYQILKREMDLRTEGSKLYLRFDKQRA
FT                   YLNEVSLSTGSDVVRVVAVFKGRVDEGALEKFRRADSAGR"
FT   gene            complement(208860..209297)
FT                   /locus_tag="Igni_0241"
FT   CDS_pept        complement(208860..209297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0241"
FT                   /product="RecB-family nuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81425"
FT                   /db_xref="InterPro:IPR018665"
FT                   /db_xref="UniProtKB/TrEMBL:A8A923"
FT                   /protein_id="ABU81425.1"
FT                   /translation="MKKVFVVAHAPTSVQRLEDLAKLAFGFGEPVSGLVVTKPSGAAAQ
FT                   IGVPEVSKLAYKLDKAFFVFPDIDDALELLKPQRVYTVSREYGEEVERVEAEGVTLVVV
FT                   GASEPGLSKLEASKGKAIYPKGLEGEIGPIGAAALILAGLK"
FT   gene            complement(209327..209953)
FT                   /locus_tag="Igni_0242"
FT   CDS_pept        complement(209327..209953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0242"
FT                   /product="HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like)"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81426"
FT                   /db_xref="GOA:A8A924"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8A924"
FT                   /protein_id="ABU81426.1"
FT                   /translation="MKKLALLDLEGTLIDFEFWEEMADVKGDQSLKLLLEKGLRGPGWY
FT                   ESFLDRVRLILGTPKEVVESVAKRAIGKIRPEAVTLISELKKRQYVTMIVSGGFEEFVA
FT                   PVAHALGVDDYVSQKLIYHNGVIVGVLPVFKEKGEVVDKLRPWFDFVLAVGDGYNDIKM
FT                   LERADEAVVVGKRAKEISKKINAKTYNNLGEFVEDLIKGGDAIKI"
FT   gene            210087..212756
FT                   /locus_tag="Igni_0243"
FT   CDS_pept        210087..212756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0243"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase subunit A';
FT                   PFAM: RNA polymerase, alpha subunit; RNA polymerase Rpb1,
FT                   domain 3; RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 4; SMART: RNA polymerase I subunit A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81427"
FT                   /db_xref="GOA:A8A925"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/TrEMBL:A8A925"
FT                   /protein_id="ABU81427.1"
FT                   /translation="MPQRFRLAPRADKIIKEIKFGILSPDEIRKMAVVAVVTDQAYDEA
FT                   GMPVEGGIMDPRMGVTSPGQRCPTCGNTLHDCPGHFGYIELVKPVIHYEFVPHIYDALR
FT                   ATCRVCGRVKLSDEEIDKFLRLYEKLEKKWPLLARRVTAFVRKKAAKVMECPHCGAKQY
FT                   KIKLEKPYNFIEERMPRLHYLNPEEVRSRLENIPDKDAKVLGFDPKEARPEWAVLTVLP
FT                   VPPVTVRPSIILETGMRSEDDLTHKLADIVRTNNKLRENIESGASEAMIENLWGLLQYH
FT                   VATFFDNEIPGIPPARHRSGKPLRTLAQRLKGKEGRFRSNLSGKRVDFSARTVISPDPN
FT                   ISINEVGVPIEVAKTLTVPVKVTPWNIEEMRKLVINGPDKWPGANYVIMKDGRRIDLRY
FT                   AKDRKIIAESLQPGWTVERHLQDGDVVLFNRQPSLHRMSIMAHLVRVLPGKTFRLCPLV
FT                   CPPYNADFDGDEMNLHVPQSEEARAEALELMLVEKHILSPRYGGPIIGGLQDYISGAYL
FT                   LTTVATLLDRSDVQELLGVTGYEGELPEPAILSPKTVWTGKQLFSVFLPKDFNYSGKAN
FT                   ISTGELKCDDEYCFYDSFVVVRDGELVEGVLDKKSIGHEQPKSLMHWIVYEYGPEKGRE
FT                   IYDRAFKMFLRFIEKRGFTTRYDDVRLPPEAKKEIEEVLKEAYEEVEKLIEDFKNGLLE
FT                   PLPGRTLEETLELMIMDVLAKARDKAGEIAAKYLSPLNNAVIMAKAGARGNILNLTQMA
FT                   ALLGQQSVRGERIKRGYRKRTLPHFEWGDISPDARGFVKHSFYEGLTPTEVFFHAAGGR
FT                   EGLVDTAVRTSQSGYMQRRLINALQDLKVDYDGTVKDAWGALYQSVYGDDGVDPMKSAH
FT                   GESVDVKHVIEKVTKVRL"
FT   gene            212753..214021
FT                   /locus_tag="Igni_0244"
FT   CDS_pept        212753..214021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0244"
FT                   /product="DNA-directed RNA polymerase, subunit A"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, subunit A'';
FT                   PFAM: RNA polymerase Rpb1, domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81428"
FT                   /db_xref="GOA:A8A926"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:A8A926"
FT                   /protein_id="ABU81428.1"
FT                   /translation="MSGAAEKLEYAFKLIDEWERKLYEEYNIRSKPKFIEELRRNIEKL
FT                   IDVKPEVSEEELKKVVDLTFRYFLRAQVEPGEAVGTVAAQSIGEPSTQMTLRTFHYAGV
FT                   KELNVTLGLPRLIEIVDARRTPSTPTMTVYLDEEHRHDKEKALEVARKIEMTKVENVAS
FT                   SVEIDWFETTIIVRLDPEMMEDKGITRDDVIKAINRLRIKGRAEPDPDDEYAVLVRLDP
FT                   EAYTSIGELQKVRDKVLSAKIKGIKGINRVIVQQREDEYVLVTDGSNLAQVLEVEGVDP
FT                   TRTVSDSIKEIEEVLGIEAARQAIINEILDVLENQGLDVDRRHIMLLADAMTWSGEVRQ
FT                   VGRHGIAGTKPSVLARAAFEVTVKQLVDAAVEGEVDELKGVTENIIIGQPIPLGTGMVL
FT                   LAMNPQEFVRRVKKSSEERQGGE"
FT   gene            214018..214341
FT                   /locus_tag="Igni_0245"
FT   CDS_pept        214018..214341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0245"
FT                   /product="LSU ribosomal protein L30E"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81429"
FT                   /db_xref="GOA:A8A927"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:A8A927"
FT                   /protein_id="ABU81429.1"
FT                   /translation="MTVTAIEAELKTALRTGKVVLGAKQTIKLLKTGKAKAAIVSAGAP
FT                   PIVRRDVLYYAKLSNIPVYVYPGTSKELGTLCAKPFVVSALAVVDEGDSKIVDAIKAES
FT                   RVE"
FT   gene            214343..214774
FT                   /locus_tag="Igni_0246"
FT   CDS_pept        214343..214774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0246"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH,
FT                   type 2 domain protein; KH, type 1, domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81430"
FT                   /db_xref="GOA:A8A928"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A8A928"
FT                   /protein_id="ABU81430.1"
FT                   /translation="MPDIVLTPEEFRYMQTFATLTGVTPVDCIVDPTFDRIIFLVKPED
FT                   VGRAIGKRGFMVRKLKEILKKQIEIVPYSDNIEEMVKNALAPARVIGVRVSKTPKGKVV
FT                   YARVNPKDKGVAIGKEGRNVAKARLILKRHFDVDSLVVV"
FT   gene            214789..215232
FT                   /locus_tag="Igni_0247"
FT   CDS_pept        214789..215232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0247"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81431"
FT                   /db_xref="GOA:A8A929"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A929"
FT                   /protein_id="ABU81431.1"
FT                   /translation="MPGKKAPNGLFAARKLERKRLKFRWSQREFKRRMLKLKEKYDPLE
FT                   GAPMARGIVLEKVGVEARKPNSAVRKCVRVQLVKNGKVVTAFVPGDGGLNVISEHDEVV
FT                   IVGIGGPRGRSMGDIPGVRYKVVLVNGVSLDAILKGKKQKPVR"
FT   gene            complement(215236..215619)
FT                   /locus_tag="Igni_0248"
FT   CDS_pept        complement(215236..215619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81432"
FT                   /db_xref="GOA:A8A930"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:A8A930"
FT                   /protein_id="ABU81432.1"
FT                   /translation="MICKLEDSRTFRLYYIPIEIVYAIKNLKEGFGEVPRNARNSLFDI
FT                   LPYFESVIENFKSVIEKVVIDELDEDSGLYTAKLFLNLGSVKLSIPMIPSHAIYLALIT
FT                   DKPIYVDEKLLEREYGEVGDYED"
FT   gene            215791..216378
FT                   /locus_tag="Igni_0249"
FT   CDS_pept        215791..216378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0249"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81433"
FT                   /db_xref="GOA:A8A931"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A8A931"
FT                   /protein_id="ABU81433.1"
FT                   /translation="MERETISPLEPKLFGKWDYDGVEIRDPSLKKYICLKPVWTPYTAG
FT                   RHEKRRFGKAEVPIVERLINKLMRPGRNMGKKAKLYSVVERAFDLIYLMTGQNPLQVLV
FT                   RAIENSAPREETTRIMYGGIVYHVAVDVSPQRRVDLALRFLTEGARMKAFKSQKPLEET
FT                   LAEEIVAAANDDPKSYAIQKKEEIERIALSSR"
FT   gene            216447..217658
FT                   /locus_tag="Igni_0250"
FT   CDS_pept        216447..217658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0250"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="TIGRFAM: Cell division control protein 6 related,
FT                   archaea; PFAM: AAA ATPase, central domain protein; CDC6, C
FT                   terminal; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81434"
FT                   /db_xref="GOA:A8A932"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8A932"
FT                   /protein_id="ABU81434.1"
FT                   /translation="MLTADLDDILDDVFERVTSSRIFKNRDVLLPDYLPNKLPHREEQI
FT                   RKVASVLAQALKGYKPNNLFIYGLTGTGKTAVVKLVVKKLSEKAVEKGVKLKITFINTK
FT                   RDDTPYRVLARMLEDIGIRVPPTGVATAELYSRFKKFLDKKGTLMILVLDEIDYHVKKY
FT                   GDDLLYKLTRINEELQRSKVSLVGITNDVNFTSWLDPRVKSSLGEEELVFPPYTAEQLR
FT                   DILKDRAEMAFVEGVLGEGVIELCAALAARENGDARKALDLLRISGEIAERSGSSKVTV
FT                   EHVRRAWEQMEKDRVVEIVKSLPLHSKLILYSILLLTKGGKTTYTGEVYRKYKELTAEL
FT                   GIETLTLRRVGDLISELDMLGLISTEVVSRGRRGLTRVISLESDPEAIRKGLLVDPTVA
FT                   EVAG"
FT   gene            217726..218178
FT                   /locus_tag="Igni_0251"
FT   CDS_pept        217726..218178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81435"
FT                   /db_xref="UniProtKB/TrEMBL:A8A933"
FT                   /protein_id="ABU81435.1"
FT                   /translation="MVVRLQAHAFKKDPGDVTGAFLPLAEGDVVIIDSITICGLGYVDP
FT                   SKFERAVVVSKFVPRVTKAVPVARRLYGDDRFREVAEEYLRRVKCFKRGPHKLCVAPYG
FT                   MDYQEALKIIEERSVRRGLPEEVILAHELASAAGLWLTRAPSPLGS"
FT   gene            complement(218147..219043)
FT                   /locus_tag="Igni_0252"
FT   CDS_pept        complement(218147..219043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0252"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81436"
FT                   /db_xref="GOA:A8A934"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:A8A934"
FT                   /protein_id="ABU81436.1"
FT                   /translation="MGKVLCLTPPKGLCDGLVASLNAEAHFIERKKFPDGESYVRIPIP
FT                   VSGEDVLVVHTGFPDQNDRVIEVLLTIDTLKDLGAESVTLLMPYMPYARQDRRFREGEP
FT                   VSIKTLLKTLSNLDLDYLVVVDIHKEYSLSEFGGGAFNVSVLPYLAEKIKDEVEDPLVL
FT                   APDRGATARAKSVASVLKAPWDYLEKRRDRVTGEVTIRPKEISAEGKTVIIVDDMVSTG
FT                   STLALAAKQLKAAGAKRVLALVAHALMVGDAENKLREAGVERVITANTLARDYPTITKV
FT                   IDVSEYLSNFLVEKGLA"
FT   gene            complement(219077..220117)
FT                   /locus_tag="Igni_0253"
FT   CDS_pept        complement(219077..220117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0253"
FT                   /product="putative translation factor pelota"
FT                   /note="TIGRFAM: putative translation factor pelota; PFAM:
FT                   eRF1 domain 1; eRF1 domain 2 protein; eRF1 domain 3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81437"
FT                   /db_xref="GOA:A8A935"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A935"
FT                   /protein_id="ABU81437.1"
FT                   /translation="MRVLEVNESKGEVKVRVEDEEDVWILHSALRPGDLVRARTARSVA
FT                   GSSGKEKIPMTLTIKVTGSEFQAFSNVLRVKGVVVEGPDKFGLIGSHHAIKVYPGKEIT
FT                   IIRERGLAQLLERLKKGEERKPQVPVLAVDYDEYSLAVVRGQGIEWVFEGSLRLPGKGD
FT                   EGREAATERKINELAKRVSEELKLRNLDHVVVVGPGFLKDKVAQRLSEEGFKVKVDSAS
FT                   SGGRAGVLEAIRKGSLRGVAKELESIKALEALEEFVKHVARGDGYALYGVDDCMTAAQA
FT                   NAVKTLIISDDLLHSPDLGERAVELVELAEKKGAEVIIVPKGTEAWERLRPFGDVVCLL
FT                   RFPISL"
FT   gene            complement(220200..220298)
FT                   /locus_tag="Igni_R0010"
FT                   /note="tRNA-His1"
FT   tRNA            complement(220200..220298)
FT                   /locus_tag="Igni_R0010"
FT                   /product="tRNA-His"
FT   gene            complement(220405..220641)
FT                   /locus_tag="Igni_0254"
FT   CDS_pept        complement(220405..220641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81438"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A8A936"
FT                   /protein_id="ABU81438.1"
FT                   /translation="MVELRLWDGRRAELEAKNLKELLLCARKLFGLERYVDEDGEPKAI
FT                   LLVFVNGVERSALLDESLEDGDVVELYPVLHRG"
FT   gene            220718..221128
FT                   /locus_tag="Igni_0255"
FT   CDS_pept        220718..221128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0255"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81439"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8A937"
FT                   /protein_id="ABU81439.1"
FT                   /translation="MLAYDASPPSRKALHFAKELAKKTGSELLVLYVIDIKKLNEVLGN
FT                   LDVEKLKVLERRANSLVEDAVKYLNEEGVKARGLVKKGPPPEAIVETAAEEGCSMIIVG
FT                   SRGLKGLKRALLGSVSDKVLRISNVPVLIVKG"
FT   gene            221174..222412
FT                   /locus_tag="Igni_0256"
FT   CDS_pept        221174..222412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0256"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81440"
FT                   /db_xref="GOA:A8A938"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8A938"
FT                   /protein_id="ABU81440.1"
FT                   /translation="MTEEQKTVLPISKGVVPTGKLHEMRKRALEDPEGFWSEIASELYW
FT                   KKGWDKVVEGEAPYFKWFVGGKTNISYNALDRHVKTWRRNKAAIIWEGEPGETRVMTYY
FT                   QLWKEVNRFANVLKDLGVKKGDRVTIYMPMVPEAVVAMLATVRVGAIHSVVFSGFSAKG
FT                   LAERINDAQAKVVITADGMWRRGKKLILKEIVDKALEETPSVESVVVYKRLGEEVNMVE
FT                   GRDYWWDDLMEGAEDYAEPEWVESEHPSFILYTSGTTGKPKGIIHDTGGYMVGVYATMK
FT                   WVFDIRDDDLHWCTADIGWITGHSYVVYGPLLHGATTLMYEGAPDYPKPDRWWSIIEKY
FT                   GVTTFYTAPTAIRMFMRYGEKWVEKHDLSTLRILGSVGEPINPEAWWWYFKHVGKGKCP
FT                   IVDTWWQTETGHT"
FT   gene            222448..223149
FT                   /locus_tag="Igni_0257"
FT   CDS_pept        222448..223149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0257"
FT                   /product="Acyl-coenzyme A synthetase/AMP-(fatty) acid
FT                   ligase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81441"
FT                   /db_xref="GOA:A8A939"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8A939"
FT                   /protein_id="ABU81441.1"
FT                   /translation="MISPAPGIELVPLKPGSATFPLPGVDAEVVDDNGNPAPPGTKGYL
FT                   VIRKPWPGMLHGIWGDPERYVRTYWSKFPGWYFTGDYAMKDEDGYFWILGRADDVIKVA
FT                   GHRLGTLEIESAFVAHPAVAEAAVVGKPHPVKGEGIVAFVVLKEGYQPSDELRDELRKW
FT                   IRETIGPVATPDEIHFVTKLPKTRSGKIMRRVLRAVISGQPLGDLSTLEDEASVEEVKR
FT                   AVEELRRDLGM"
FT   gene            complement(223186..223602)
FT                   /locus_tag="Igni_0258"
FT   CDS_pept        complement(223186..223602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81442"
FT                   /db_xref="UniProtKB/TrEMBL:A8A940"
FT                   /protein_id="ABU81442.1"
FT                   /translation="MISARSAQKAALKGLENALGGFIGEPQVEVQEGEGSLSMKIVFEV
FT                   VKEGQISAGGETRKVKPGKYEMNVEVTFGKRGNMLEAHFSGKCGESALSDMYVVEENKL
FT                   DYVRNWLSDKVGALAVQCATEAEETADIGGVLGW"
FT   gene            complement(223694..224443)
FT                   /locus_tag="Igni_0259"
FT   CDS_pept        complement(223694..224443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0259"
FT                   /product="phosphoesterase, putative"
FT                   /note="TIGRFAM: phosphoesterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81443"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8A941"
FT                   /protein_id="ABU81443.1"
FT                   /translation="MEAVELERGLYATPQGALLYKGYAIIADLHLGFEEEMSRKGVFLP
FT                   PAQLRRALEVLESVSKAVKKVVVAGDLKHQFGRLGKMEKRDVEAFLSAAQKKGVELVLV
FT                   RGNHDNFVKKLVEDAGFEVVDELDLSEGVKVIHGHKAAELGEVTIMGHEHPSVALRDPV
FT                   GATAKFPCYLKVPSRRGVVVVLPAVGLYQSGTSVTPNREAYLSPILKELDLKKAVPYAA
FT                   DPELGVVELPALEDLAGLLVEEAPLGR"
FT   gene            complement(224474..225136)
FT                   /locus_tag="Igni_0260"
FT   CDS_pept        complement(224474..225136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0260"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein;
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81444"
FT                   /db_xref="GOA:A8A942"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A8A942"
FT                   /protein_id="ABU81444.1"
FT                   /translation="MKVKLKLYAMYKDALGEAAELELPEGSKVADLKRKVLELLPEGYP
FT                   EPVVLKDGRFAEDEEPLTEGEYELVPPAAGGGGRVVLTEEEDWSLDGLVEELGDPESGA
FT                   TVIFVGTVKSKGSKVLELIYEAHPSVKEFMEKIVEEELKKWGALDARVVQFLGPRKVGQ
FT                   KTLIIAVSGKDRESAFKAAREILERLKHEPPIWKREVRTDGEYWITGEGELRRSPKY"
FT   gene            225241..226707
FT                   /locus_tag="Igni_0261"
FT   CDS_pept        225241..226707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0261"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81445"
FT                   /db_xref="GOA:A8A943"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8A943"
FT                   /protein_id="ABU81445.1"
FT                   /translation="MYYRTREARSEFLRKVREEAIDFPDYEVIDSPSPELYKFIFPFKE
FT                   VPRVFFDGIILPTELPSEIWITDTTFRDGQQAREPYTVEQIVRLYKYLHELGGPLGKIK
FT                   TTEFFLYTEKDKEAVRRVKELGYKYPIPTGWIRAKKEELSLVKEAGLEETGILASISDY
FT                   HIYFKFKASRGKVVEKYLSVVEEALKMDIIPRVHLEDITRANIFEVVVPFVRKLMKLSE
FT                   RYGLPVKVRYPDTLGVGVPIVEAMLPRSIPKLTWVLRHVCGVPSEWLEFHGHNDFHLGV
FT                   ANAVSAWLYGAGLNNGTLLGIGERAGNVPIEALVFAYAQLKHGFDGMNTKVITEIAKYY
FT                   RDELGYEVPPYYPIVGRNFAVTRAGIHADGLLKNPETYLPFDTEGILGVKPGVAITPYA
FT                   GLAGIVYWINKTFDLKGEEQVSKKDPKVQAIYKDVMKQFEHGRLTALSDAEMLALVAKH
FT                   APELIKKYWDRLPEDLKAKAVALLDLAERR"
FT   gene            226742..226927
FT                   /locus_tag="Igni_0262"
FT   CDS_pept        226742..226927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81446"
FT                   /db_xref="GOA:A8A944"
FT                   /db_xref="UniProtKB/TrEMBL:A8A944"
FT                   /protein_id="ABU81446.1"
FT                   /translation="MSLLEKVELALSITFIILLIALAVVADSNGLGAEGTLALAAATAA
FT                   SGGAAILLHHVSADKP"
FT   sig_peptide     226742..226822
FT                   /locus_tag="Igni_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.956 at
FT                   residue 27"
FT   gene            complement(226924..227223)
FT                   /locus_tag="Igni_0263"
FT   CDS_pept        complement(226924..227223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81447"
FT                   /db_xref="UniProtKB/TrEMBL:A8A945"
FT                   /protein_id="ABU81447.1"
FT                   /translation="MQLDWVPEEALREVLEEIEKERRVRKVNKRRPTRKDLMKVIVEAL
FT                   SAGPSPQEFVDVVYEILEQKGFETKFTNVKRIWRTYEEMVKKGFIQDYLDVVKR"
FT   gene            227539..227922
FT                   /locus_tag="Igni_0264"
FT   CDS_pept        227539..227922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81448"
FT                   /db_xref="UniProtKB/TrEMBL:A8A946"
FT                   /protein_id="ABU81448.1"
FT                   /translation="MLTEVYQQCLERPSDATLEDLMKTHTKCISEVLKIRPVITMIEGE
FT                   EKAKTIMVDKDDVYLLECEDISDDLLEDAKLTNELLFAFDDVLIDELEDAVKVIMCTLK
FT                   KRKLKEEEKKEMSNFWSLKSNSF"
FT   gene            complement(227919..229367)
FT                   /locus_tag="Igni_0265"
FT   CDS_pept        complement(227919..229367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0265"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81449"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A8A947"
FT                   /protein_id="ABU81449.1"
FT                   /translation="MKPINEIVKKWFELNPHYASAMGLREYDFKVPSLSKRAVEELVDW
FT                   CLEGAAKLKEWTPDDEELEVDKGEVVRQLEVEVLLEGEWRPWKHYPVAPSLASELLLTV
FT                   LLSPASEDHKRAALASRLKALPKLFEESKELLERPKSLWVNLARAEIQGLKLLLLELGA
FT                   PEEVKRSVEEYDKWLDGLEADEGYQPMGESLFSTLLRVRGIKASAEELEALGRKKAKEI
FT                   VEELGEPPEGKEVSDLKGAYSEAVSKARAFVKERKLVPLAPDEDLEVIDTPAPLRPTIP
FT                   YAAYDPPQPFSPYNVGYLLVTPGSAKKDYFDVLNTAVHETYPGHHAQLSFHLPSKYRYL
FT                   ASATDYVEGWAHYAEELMFEQGFEAHPRYAWQVKKDELWRWVRVYVDVGLSTGKMSFEE
FT                   AVEELKNVAMLDESSAYSEALRYTLTPGYQLSYSYGKMRLKELRELYREYAGSSFSLYE
FT                   FHATVLGYGALPVDVLSELLLSKF"
FT   gene            complement(229405..230394)
FT                   /locus_tag="Igni_0266"
FT   CDS_pept        complement(229405..230394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0266"
FT                   /product="putative metalloendopeptidase, glycoprotease
FT                   family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81450"
FT                   /db_xref="GOA:A8A948"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A948"
FT                   /protein_id="ABU81450.1"
FT                   /translation="MYVLGIESTAHTIGVGIVNERAEVLANEMHTYVPKEGGIHPREAA
FT                   RHHAEWGPRLVKRALEVAGLRPEDLDAVAYSAGPGLGPCLRTGAVMARALAAFYEKPLV
FT                   PVNHSLAHIEIARAVTGFSKPVAIYVSGGSTIISAPAIKRYRVYGETLDIGLGNLLDTF
FT                   AREVGIGPPFVKGGVHVVELCSEGAEEPADLPYTVQGVDLSFSGLLTAALRAWKKEDKK
FT                   KVCYGLWETAYDMVVEVGERALAHSKLKEVVLVGGVAGSKRLQRKVALMSEERGVSFKP
FT                   IPYELARDNGAMIAWTGLLYYKHGFTVAPEEAFVRQRWRLDEVEVPWL"
FT   gene            complement(230408..230923)
FT                   /locus_tag="Igni_0267"
FT   CDS_pept        complement(230408..230923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81451"
FT                   /db_xref="UniProtKB/TrEMBL:A8A949"
FT                   /protein_id="ABU81451.1"
FT                   /translation="MRALVDDSLLSELKIEFLENVAFNLLYEEAKNLFGEVAARQLVYK
FT                   IMKEASKSMVERFRSQGLLNVNDVTTALSLPCKAFGVAASCEREGDKLLVRVRECPLLK
FT                   FDEDKSGRACITMMSLVAGMVESVTGKRVCIITPRVRFGTSSADLVIKMLKSKLLGDEE
FT                   CLFEVRAK"
FT   gene            complement(230961..232355)
FT                   /locus_tag="Igni_0268"
FT   CDS_pept        complement(230961..232355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81452"
FT                   /db_xref="UniProtKB/TrEMBL:A8A950"
FT                   /protein_id="ABU81452.1"
FT                   /translation="MFALGPKEAESYLSFSYFLKYAAGVEVPIPVLYGPPRIGKSEVVK
FT                   RSFVTFVRAVAKDIVEKDFLGLFEEGSKELKERHASLSNVIATGNKQLIAEALEEVDEE
FT                   TMFIATSFSLADKCDNDPSCSNLHRIISTINSKKVNEFYEKVVLTRAFVPTKDGLKAWE
FT                   EGVMYYKDQLNVDEYDNKFVYVELHASELSEEDLEGMNVIKENFFTKVPPKWASALSVS
FT                   LAGLLHIENATVLPWNALSKLLDVLITKRIGMCEFGKLSVLSGPDPSYAEVTLIPSYVS
FT                   SGNLEYVRVRAPTVREWKEQLDDEGEEWAEEVYYFLQVTSPNHGEGVKYEELRGVVEEV
FT                   SKRVKSYDTFLPPPEVVKEFENRFTPYPTPKAWKALAKALAVSKAEVAPLAFSYLGDES
FT                   VAELFVEFVGNYAEALSAPEKLKELASSKDLAARVALAALTFRALEGDEEVKKLLEEAG
FT                   IEVSSK"
FT   gene            232430..233077
FT                   /locus_tag="Igni_0269"
FT   CDS_pept        232430..233077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0269"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81453"
FT                   /db_xref="GOA:A8A951"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A8A951"
FT                   /protein_id="ABU81453.1"
FT                   /translation="MVWERRERPLLQVALDFTTIPSAISVAVKALKADILEVGTPLIKS
FT                   EGSKAVSAIAALGKPTLADTKTCDTGALEASIAFDAGADAMTVMAFSDDSVIKEAVEEA
FT                   ERRGKVVVADMMHLKDPVERAKRLKELGVRAVELHVGISQQRAYGVTAADLAALAERVR
FT                   SLGLVVAVAGGITPETARAFVGKADVVVVGGYITKSPNPEKAVEELLKALGR"
FT   gene            complement(233082..233258)
FT                   /locus_tag="Igni_0270"
FT   CDS_pept        complement(233082..233258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0270"
FT                   /product="SSU ribosomal protein S27AE"
FT                   /note="PFAM: Ribosomal protein S27a"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81454"
FT                   /db_xref="GOA:A8A952"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A952"
FT                   /protein_id="ABU81454.1"
FT                   /translation="MPKHAQVKPHLLYEWDYEKGIIKPKNKRCPRCGSFMAHHLKPVPR
FT                   WHCGKCGYTIFEK"
FT   gene            complement(233270..233587)
FT                   /locus_tag="Igni_0271"
FT   CDS_pept        complement(233270..233587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0271"
FT                   /product="SSU ribosomal protein S24E"
FT                   /note="PFAM: Ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81455"
FT                   /db_xref="GOA:A8A953"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A953"
FT                   /protein_id="ABU81455.1"
FT                   /translation="MSEFEVQVVNKRWNPLAEREELDLVLVHVAKPTPSRCEVEEKVAQ
FT                   MLGVDKKLVVVTKLLSEYGIGRTRARAHVYKNYERLQKLEPEKVKKLHEQCSQAQEAQA
FT                   Q"
FT   gene            complement(233601..233825)
FT                   /locus_tag="Igni_0272"
FT   CDS_pept        complement(233601..233825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0272"
FT                   /product="SSU ribosomal protein S17E"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81456"
FT                   /db_xref="GOA:A8A954"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A954"
FT                   /protein_id="ABU81456.1"
FT                   /translation="MGKVRINVVKRTARKLLQMYPDLFTRDFEHNKKVVSQLIEVNSKK
FT                   LRNQIAGYITHLKKVEERRQKVELREEYL"
FT   gene            complement(233827..234930)
FT                   /locus_tag="Igni_0273"
FT   CDS_pept        complement(233827..234930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0273"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81457"
FT                   /db_xref="GOA:A8A955"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8A955"
FT                   /protein_id="ABU81457.1"
FT                   /translation="MRLLAIRSKYALVGEELELVEEVELVWEGGRLVDWYPTTKKVSDL
FT                   LVMPALVNAHTHLADCYFPDAWLRESLSEIVDPSKGLKRKALEEADIKEAIKMGMEALR
FT                   STGSFAAADFREGGAKGLKEALEAREEGYLPFGRVEKEEDLEEVLRLAHGLGLPEPDFP
FT                   TPDLARRAAEAFKAAGKPVGLHLAEVRKEPVQKALDLGADFVVHGCFLEYEDLEELKRN
FT                   GVALVVCPRSNRWFGLKPKVKEAIEVGVKLLLGSDNCTFNKPDLWRDLEASAFELRSEG
FT                   AFDDEAARELLKAVTTNAEKPLGLPWKTALVEGSRWPALLMDSKLLALDRSKNKYATIV
FT                   KRGGPEALVGVVGKAKLNRPWSSAGWR"
FT   gene            complement(235012..236238)
FT                   /locus_tag="Igni_0274"
FT   CDS_pept        complement(235012..236238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0274"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81458"
FT                   /db_xref="GOA:A8A956"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A8A956"
FT                   /protein_id="ABU81458.1"
FT                   /translation="MKLEELPTLDDIDVSNKKVLLRVDFNSPVKDEELLDDSRIRAHVP
FT                   TIKELLEKGAAVVVISHQGRPGEDDFITLEPHAKKLSEVLGQTINFVDDVMGPEARRRI
FT                   KELKPGEVLLLDNVRFLAEENINAPPEVQAKTYLVRRLAKLFDVYVNDAFATAHRSQPS
FT                   VVGFPLVLPSAMGRVMEKEVKALSKVFNPQVSPKIFVLGGGKVPDTIVIIENLVKNKVA
FT                   DRILTTGLVAEVFLVAKGVDLGEKNMEVLEKKGLLGLIPKAKKLLLAGAPIETPLDFKT
FT                   VDEEGNVRVEPAFSVTGLIRDVGPATVKTYGELMKDARVIVMRGPAGVMEDPRFREGTR
FT                   ELVRLALESGAFTIFGGGHLTAVIKELGMEDKVGHISTGGGALLSFLAGKELPALKALE
FT                   MSKERFWSK"
FT   gene            236443..236685
FT                   /locus_tag="Igni_0275"
FT   CDS_pept        236443..236685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81459"
FT                   /db_xref="UniProtKB/TrEMBL:A8A957"
FT                   /protein_id="ABU81459.1"
FT                   /translation="MCAGTPLTPFSKGLPRSFELVCPYAIPARGGLVHCRAADMAVDPS
FT                   EYPCFGNYEECPIYRSEESGSCETCPLYGSCPKAQ"
FT   gene            236728..238413
FT                   /locus_tag="Igni_0276"
FT   CDS_pept        236728..238413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0276"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81460"
FT                   /db_xref="GOA:A8A958"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8A958"
FT                   /protein_id="ABU81460.1"
FT                   /translation="METLGPYDVVVVGGGLAGLRAAIEARRHGASALVVAKSHPVRSHS
FT                   SAAEGGVAAYIEGASDPRDSPLQHAFDTVKGSDWLADQDAVELMAFDAERAILELEKWG
FT                   CLFSRDPDGKIARRPFGGHTYPRTRFAADKTGMCMLHTVYERALAEGVDMLYEFYVTDV
FT                   VSDKRKVYGVIGFDVKSGDVYFIKSKAVILATGGGGLMYKFSTNSYLNSGDGYAIAARA
FT                   GAPLADMEFIQFHPTALYPSNILITEAARGEGGYLINKNGERFMKRYAPERMELAPRDV
FT                   VARAIMNEIKEGRGFEGGYVLLDLTHLGEEKINERLPLVREVSIKFAKVDPVKEPIPVR
FT                   PAAHYTMGGVKTNLDGATEVKGLFAAGEAACVSVHGANRLGSNSLLETLVFGRRAGMAA
FT                   AAYAKEVGYSEPPKEALSEAEARLWLPTTSESGLSFGQLRKEVGEIMWNYVGIERNEEG
FT                   LKTAVKKLKELMNMTKYVKGSGGPGAYELVAAHETINMVMNAYATATAALWRTESRGAH
FT                   YRSDYPKRDNENWLAHTIMRWKGTWEMEKLPVTITRWPPQERKY"
FT   gene            238454..239641
FT                   /locus_tag="Igni_0277"
FT   CDS_pept        238454..239641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81461"
FT                   /db_xref="UniProtKB/TrEMBL:A8A959"
FT                   /protein_id="ABU81461.1"
FT                   /translation="MSEVAMVYDFSRKKCGIKEYGDALVKWLKAIGVDVEVCDLKKESY
FT                   ADSVRAALCASRGELVHTQHEYGLFKGHFGWSQIFYYLTLKLLRKRDITTLHTVLTPKQ
FT                   AIENYVKFSLPYVKESLIETMRGFLISALVPYIPQAFSDLLVVHTLRGYELLPWLGKMK
FT                   AVLIPHFTPKPSWKIDEIIEKCRNMMSKKVERVEIVTPGFIRPTKRYDWAVHALVSLAL
FT                   EGLEVPLRYTVVGTTQDEAGERWYQYMKDFIDEISKYTEKLGLEIRIVKKMMTKEELIE
FT                   RACSAHVVLLPYSDPTQEASGIVHDSLTCGKHIVVPKIGDVRNYPEAFHPFDIDDPLPT
FT                   MKQALRRAIDEVLRGNLCNPGALAYARFTAVDRVARRHAELYATLRSRRSPRRPS"
FT   gene            complement(239556..240710)
FT                   /locus_tag="Igni_0278"
FT   CDS_pept        complement(239556..240710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0278"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81462"
FT                   /db_xref="GOA:A8A960"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A8A960"
FT                   /protein_id="ABU81462.1"
FT                   /translation="MLIVHAADVHLGKRQYGLKEREEDFYKAFEDLVEATIREKADALV
FT                   IAGDLFDTPVPDSTMKPFKVAVEGVRRLRENGIEVIMVAGDHDIPKVRGYPAIAYLSEL
FT                   TGAKLLRGELGAKGYELKGFTFYGDDAVTPSKRGPLERLRAVKPKKNSVLLLHVGLCRA
FT                   LPFSCVDEGLLPKGYKYYALGHVHKPTVLEVHGAPAAYPGSLEATTVDEVLWESSDNPL
FT                   LRRGPLLVDLGGDEAQIVGKLNVYNRKQIIKKYELPKDYKRALAEAESVPQGAVVHLYL
FT                   TGKVGKDAVRAISSKFQARALTVRVNFLAEEEEEVEETVTNFTGLEDLIIEFYGKELGR
FT                   LLYELVKAAQERRSDELKRVAEEIFESGAWRRAQRASSQRGRRR"
FT   gene            complement(240763..241122)
FT                   /locus_tag="Igni_0279"
FT   CDS_pept        complement(240763..241122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81463"
FT                   /db_xref="GOA:A8A961"
FT                   /db_xref="UniProtKB/TrEMBL:A8A961"
FT                   /protein_id="ABU81463.1"
FT                   /translation="MKGPSSAVLILLFLSFIGIDVAHVIGVIKTFPFFLFVENLVYAGI
FT                   SLALLWGLLKDKDVWCLTASFGSYLTGRVSRSVITPYGTLPKLALQHVPLLALSLALAL
FT                   LGLWGCYRRAVSGSR"
FT   sig_peptide     complement(241054..241122)
FT                   /locus_tag="Igni_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.772 at
FT                   residue 23"
FT   gene            complement(241125..241772)
FT                   /locus_tag="Igni_0280"
FT   CDS_pept        complement(241125..241772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0280"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81464"
FT                   /db_xref="GOA:A8A962"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A962"
FT                   /protein_id="ABU81464.1"
FT                   /translation="MYAVASIPFTDLGQVKKLIIKSAAAGADFVELRLDYWTRKETPPF
FT                   LEMIELARNYGLDVIVTVRDPEEGGVWSPPWRGEAYEMASEAGAVCDVEVKKFKELPCD
FT                   RAILSVHYFRKPPREGEVRKLSQRALEAGAWAFKVATVVTDFPSYFLLFSESVHPRTAF
FT                   MPMGEGTEALRLASALLGSFLNYGSVGEATAPGQVSVRQLTKALSALGGRGD"
FT   gene            241888..242259
FT                   /pseudo
FT                   /locus_tag="Igni_0281"
FT                   /product="Methylase involved in ubiquinone/menaquinone
FT                   biosynthesis-like"
FT   gene            complement(242242..242436)
FT                   /locus_tag="Igni_0282"
FT   CDS_pept        complement(242242..242436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81465"
FT                   /db_xref="UniProtKB/TrEMBL:A8A963"
FT                   /protein_id="ABU81465.1"
FT                   /translation="MLKKNLLLEALLSLDGKADVKSVYEYVKAREPNITQKEFEEMLKE
FT                   ALSSGDKIIRKGDELLIDD"
FT   gene            complement(242430..243548)
FT                   /locus_tag="Igni_0283"
FT   CDS_pept        complement(242430..243548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0283"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81466"
FT                   /db_xref="GOA:A8A964"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A8A964"
FT                   /protein_id="ABU81466.1"
FT                   /translation="MACKKRADFQEALALCETAGYEVVATVNFCKKPHPATYITPGKLE
FT                   ELKATIKEGGAEAVIVYGNPKPSQFYRLKKELGVEVVDRTSLILKIFELHAGSKEAKLQ
FT                   TELARLKYELTLAREYVRRVKMGEQVDFLGPGEYAAKYVIKAIKRRIKKIEEELEKIRT
FT                   MREQQKLRRVKRLRVPEVAVTGYTCAGKTALVNALGKLNLKEGPEMFTTLAPKHVRVSV
FT                   YENGLYEAIFIDTVGFIEGIPPQILEVFHATLAEITYSDAAVLVLDGSEELSRALDKLE
FT                   SSLATLAEIGFIGKPLVIAFNKIDLVDDYEEKVLEVDDWARSLYPWTWGTVPISAKKGT
FT                   NLRRLVIESVLAARGARNIKEPETNVCGKGAC"
FT   gene            243679..244146
FT                   /locus_tag="Igni_0284"
FT   CDS_pept        243679..244146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0284"
FT                   /product="SSU ribosomal protein S19E"
FT                   /note="PFAM: Ribosomal protein S19e"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81467"
FT                   /db_xref="GOA:A8A965"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:A8A965"
FT                   /protein_id="ABU81467.1"
FT                   /translation="MITPREVPPERFNQRLAMYLKERFPEIRPPEWAMYAKTGCFKDRP
FT                   PLDEDWWYYRAASILRKLYLAGRPLGIETFRTIYGGRQRRGVAPPHFRKAGGSHIRKIL
FT                   QQLEKAGLVKKVKGQGRVLTPAGRSVLDHVAYFTFQEIAEEMAELKKYAER"
FT   gene            244151..244501
FT                   /locus_tag="Igni_0285"
FT   CDS_pept        244151..244501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0285"
FT                   /product="DNA-binding TFAR19-related protein"
FT                   /note="PFAM: DNA-binding TFAR19-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81468"
FT                   /db_xref="GOA:A8A966"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:A8A966"
FT                   /protein_id="ABU81468.1"
FT                   /translation="MSFDDRELEEIRKKKLMELQKRMEEERKAEELRKKQQLVKETILK
FT                   SILTSEARARLANVKLVRPELAEQVENYLIALAQAGRIARPLTDAEVKEILARLAGETR
FT                   REGRINIKERGW"
FT   gene            244495..244662
FT                   /locus_tag="Igni_0286"
FT   CDS_pept        244495..244662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0286"
FT                   /product="LSU ribosomal protein L39E"
FT                   /note="PFAM: ribosomal protein L39e"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81469"
FT                   /db_xref="GOA:A8A967"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:A8A967"
FT                   /protein_id="ABU81469.1"
FT                   /translation="MVRVAHYKHVAKKIRLGKKTKQNRALPAWVILKTRRRVTRNPMRR
FT                   YWRRQKIKNV"
FT   gene            244673..244978
FT                   /locus_tag="Igni_0287"
FT   CDS_pept        244673..244978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0287"
FT                   /product="LSU ribosomal protein L31E"
FT                   /note="PFAM: Ribosomal protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81470"
FT                   /db_xref="GOA:A8A968"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A968"
FT                   /protein_id="ABU81470.1"
FT                   /translation="MPKEKDGVIYTINLRRLYWGRRSNRAKRAVRMVREFVARHFGVEP
FT                   EDVKIDNTVNNYLWSGSITKPPARVQVYVTVKTESGEEGERKVAYVTLANVKDVED"
FT   gene            244985..245656
FT                   /locus_tag="Igni_0288"
FT   CDS_pept        244985..245656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0288"
FT                   /product="translation initiation factor 6 (aeIF-6)"
FT                   /note="TIGRFAM: putative translation initiation factor
FT                   eIF-6; PFAM: translation initiation factor IF6"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81471"
FT                   /db_xref="GOA:A8A969"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:A8A969"
FT                   /protein_id="ABU81471.1"
FT                   /translation="MNFDVVPISIFGNPNIGVYMFANDDFALIPPGVKEDVVKKVESAL
FT                   KVTVVEAKVADSTLLGLFVNGNNHALVVPSIIKEYELENLKRELDLPIKVVYSKLTAMG
FT                   NVILCNDKFALFHPEMSNWVKDVTEVLGVPGETGTIAGVPTVGSVAVINDKGGLVHPDA
FT                   SDEELNELEKKFQVVLDIGTVNYGVPYVKTGLVANNKGAVVGDLTTGVEMARVARALSG
FT                   E"
FT   gene            245698..246765
FT                   /locus_tag="Igni_0289"
FT   CDS_pept        245698..246765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0289"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81472"
FT                   /db_xref="GOA:A8A970"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8A970"
FT                   /protein_id="ABU81472.1"
FT                   /translation="MEGIILAAGKGSRLRPLTLTVPKPLIPVAGKPLVQYGIEQLRGVG
FT                   VERAVVVVGWLGELFKEVLGDGSALGMRFEYVLQPKRLGVAHAIHTAIVNANVRSPFLV
FT                   YFGDNVFDDEWVKKFNSVDEEFDAFVVLAKVEDPRRFGVPVIESGRIVKFVEKPERPPS
FT                   NYALTGLYAFRDPEQYESCFSELKPSWRGEYEITDLLNCYIRRGYDVKYAVVEGWWKDT
FT                   GVPEDLIEAMKFILEKKLIHKVEGSVEGEVVGKVYVARGATVEGRLVGPAYVGPGAEVR
FT                   GSAGPFVDVEEGSVAEGSFVESLILKGSKVLMRGGATLKRSVVGDYSNIEVDAPVSLED
FT                   ALFASESALKVGRLD"
FT   gene            247120..247404
FT                   /locus_tag="Igni_0290"
FT   CDS_pept        247120..247404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0290"
FT                   /product="SSU ribosomal protein S26E"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81473"
FT                   /db_xref="GOA:A8A971"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:A8A971"
FT                   /protein_id="ABU81473.1"
FT                   /translation="MPKKRENRGRHKGDKGKTGTIQCDNCGRIVPADKAICVTRWHSPV
FT                   DPQLARELEKKGAIIPRYKITKCYCISCAVHLGIVKVRPEHERKRRGLY"
FT   gene            247407..247976
FT                   /locus_tag="Igni_0291"
FT   CDS_pept        247407..247976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0291"
FT                   /product="protein of unknown function DUF358"
FT                   /note="PFAM: protein of unknown function DUF358"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81474"
FT                   /db_xref="GOA:A8A972"
FT                   /db_xref="InterPro:IPR007158"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8A972"
FT                   /protein_id="ABU81474.1"
FT                   /translation="MRTFVTRSLTATTSPAFPKRGIASHTGRLDVIARMLRAALWTERG
FT                   VRKDSSFFVTLEGPPNPPLTLRFKGPELEADLSDERAAVEAIRKCMLGELKGCKRTKES
FT                   FEEVLKSLGMKVYVLSEDGEDVWSFEFPKSAAFLLGSQHDLELPPWLEAERVSLGPKSY
FT                   LASHCIYYLHYVLDLKLDPSPRRPGS"
FT   gene            complement(247939..249426)
FT                   /locus_tag="Igni_0292"
FT   CDS_pept        complement(247939..249426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0292"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81475"
FT                   /db_xref="GOA:A8A973"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A8A973"
FT                   /protein_id="ABU81475.1"
FT                   /translation="MKLRAGVVQRALSYIAEEMGSVLKRSSVSPNIRERLDMSCALLDE
FT                   DGRVLAQAEHIPVHLGSLSWAAPRLVERASELVEDEGDVMIVNDPYLTGTHLNDVTVMT
FT                   KYKNVWIVNKAHHVDVGGPVPGSLNPNAKTLFEEGIVIEPALVAKRWRVLKVAEDLAKG
FT                   VRGPKTFLADLKAQIAALRTGLQRLRELEDRYGDINEYKEDFLEASKRAYSERLAEVSG
FT                   EGEAEVPLELPEGLAKIRVRLKVGEVVEADFSGSSDQVPYNLNAVEGIAYAAVAFFVKA
FT                   MTVPEGPVDHGLYSLIKVKTREGSLLNPRFPAAVGAGNLETSQRALEAVVLAAQGFSHA
FT                   PSGGPGTMSNLILSWGNKVYYETNAGGGSATKDSDGQNAVQWGMTNTMNTPIEIIEREA
FT                   PVLFTRYSVRRGSGGAGTHKGGDGVVREFIALDDLKVTVIMSRYLTKSPGAKGGSDGEP
FT                   GAVLVDGEPVEGYFSGELKKGSRLTLMTPGAGGWGRA"
FT   gene            249501..250328
FT                   /locus_tag="Igni_0293"
FT   CDS_pept        249501..250328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0293"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81476"
FT                   /db_xref="GOA:A8A974"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A974"
FT                   /protein_id="ABU81476.1"
FT                   /translation="MIVKRVKTGIPGMDEILYGGIPERNVVLLSGGPGTGKTIFSQQFL
FT                   WYGLEHGEPGIYVALEEHPVQIRRNMLQFGWDVRKYEKKGTFAIIDAFTGGIGEAAKRE
FT                   KYVVRDPTDVHMLVDVLREAIRDLGAKRAAIDSVSTLYLTRPAVARSVVLQLKRVLSGL
FT                   GVTSILVSQVSATERGFGGPGVEHAADGIIRLDLDEYDGELYRSLIVWKMRGTKHSMRR
FT                   HPFEITDKGIVVFYDKVLRVRAGKAYVEPLNPEVVREMEEASKKTEDVYEGEV"
FT   gene            250654..251247
FT                   /locus_tag="Igni_0294"
FT   CDS_pept        250654..251247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0294"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81477"
FT                   /db_xref="GOA:A8A975"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8A975"
FT                   /protein_id="ABU81477.1"
FT                   /translation="MSSTRLTKKELEMELERVRWKKGKLGIKYEQYPTPASVAADVLWR
FT                   AFLAGDIEGKLVVDLGCGTGRLAYGASLLGARSICLELDLELLREAPLEERVLAEVPRV
FT                   PLRRADTVIMNPPFGTKVKRADRAFLLAAFDLAPTVYSIQPSGVWKVVKRLGEERGFRC
FT                   EALARYEMHLPQLYEFHVSRKRRTEVSLYCCRRW"
FT   gene            complement(251198..252118)
FT                   /locus_tag="Igni_0295"
FT   CDS_pept        complement(251198..252118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0295"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type II; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81478"
FT                   /db_xref="GOA:A8A976"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A976"
FT                   /protein_id="ABU81478.1"
FT                   /translation="MRSGEAVRRALERGRELIRPGASVLEICEEVEDLIRKLSDGPAFP
FT                   CNLSVGYEAAHYSPVPEDPKRLPEKGIVKLDLGAHVRGRIADSAISVLLKPVEKHEKLS
FT                   EAVKEALERALERARPGLSVSAIGTTISVTIRRKGFKPISNLGGHGLAPYLVHSGVSIP
FT                   NVPEPLPFKLEPGRAYAIEPFGTDGAGYVVEGKEVTIFSLRPRPPKGWEKRAGDLKDLV
FT                   EVINERFKTLPFSPRWLTDVMAYDKLMEALLRLSKIGVLTAYPILIEAKRGEVAQWEHT
FT                   IFVTEEGVVVTTAGSNRGSPRSSSS"
FT   gene            complement(252136..254094)
FT                   /locus_tag="Igni_0296"
FT   CDS_pept        complement(252136..254094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0296"
FT                   /product="glyceraldehyde-3-phosphate ferredoxin
FT                   oxidoreductase"
FT                   /note="SMART: Aldehyde ferredoxin oxidoreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81479"
FT                   /db_xref="GOA:A8A977"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A8A977"
FT                   /protein_id="ABU81479.1"
FT                   /translation="MNAPTLWFPFLELSRANGLREPLINPIEIDLEEENWRRININALG
FT                   PVEAGVKLHLKYQTQDWDPVEKNLVVMGTGPFARSPFFGSNRLIIVFKSPMTRGLHVTA
FT                   AGGAGFDFISSGTSLVVFKGRANSPKIVLLEGDEEGLKDVKFKNVTSDAFNYGGYFGTF
FT                   ALSKYVYDNYSPARAVAVGPFSLFSVSGSLVSIERLGNELSPFAVDFFGRGGPGSALAR
FT                   AHNVWAVGFGGRYEPPEVPGDLPERLSREAFGKSYVEAVLEATTKYRYDPKYKSGGTFG
FT                   VNYVYYRDLIPMFAFNSIYYSDETRTRLSKMIIKYFWTPFVEETIKRRVFGGCGDPCPA
FT                   ACKKVWRGVKLDYEPSNAMGPLIGVFKLDLTVKLIEVVDSYGMDAIEAGHVVSWLMDAL
FT                   YRNLLRPEELGVSEPPSFDPSHFEVEESEKNYEIAKKILEQYAKGVGVPGEAAKRGLRG
FT                   AAKYLDRELPSRTERVKFEDLAVYVAFGEKGYMTPNLYWAPGMVAPLYVLGRYWTNYRP
FT                   TFDEPEKFAESSFKRALKELIIDNAGICRFHRKWAERLVGEMYKEMVGAEVNDEYAKAV
FT                   YRSVAVYNVEAGAEPVPWESKKTYDVVRTMAKRVMPEKWGRLFDEGKGIEWWARFKARV
FT                   EELLEIRPPRREGGVKP"
FT   gene            254141..254524
FT                   /locus_tag="Igni_0297"
FT   CDS_pept        254141..254524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0297"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81480"
FT                   /db_xref="GOA:A8A978"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR039127"
FT                   /db_xref="UniProtKB/TrEMBL:A8A978"
FT                   /protein_id="ABU81480.1"
FT                   /translation="MYMTLDVLACPYCKDEGFPLKLYVIEKKKVKRKRPPKEKPYCELY
FT                   CGYLGKYLKDVRDPPCEQCLDEEVVTGVLVCPKCGRWFPIIDGIPHMLPDELRNKEEDL
FT                   KFLRKYKDLLPEEVLSGKPWGIK"
FT   gene            254521..255606
FT                   /locus_tag="Igni_0298"
FT   CDS_pept        254521..255606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81481"
FT                   /db_xref="GOA:A8A979"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8A979"
FT                   /protein_id="ABU81481.1"
FT                   /translation="MNPLLKSHLLAFFLFLSASSSDPYVLREAHVYGSLSVGLASGLAS
FT                   LVGLASKLTMFKRGLSPGMASSAPALMILAYPTALLGLPGFFAYLMLTNVAFAIILVLS
FT                   LTVVAEEAPPNKLGFHYALRGIALSAASFLGPLVGGLAYSALGLPGSLAVGAAASAVTF
FT                   AIQRTLMGYSFKGGGGWSFSPSWALAYATSFFLASTVLIISTYLPPYQASRGSGYLATT
FT                   YFFSGRALGSGSTRVLGGIIADAAPRLIAVPPLLALAASRLALNALEPSAAAVAGFFTG
FT                   GSWGLASPTLLSIAAREKEKGKSMSLFTTAWDLANVTSVPLAGAAGSFEASLSLSTATA
FT                   SMALVSAALLAASRKINPGRG"
FT   sig_peptide     254521..254583
FT                   /locus_tag="Igni_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.542 at
FT                   residue 21"
FT   gene            255626..255922
FT                   /locus_tag="Igni_0299"
FT   CDS_pept        255626..255922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81482"
FT                   /db_xref="UniProtKB/TrEMBL:A8A980"
FT                   /protein_id="ABU81482.1"
FT                   /translation="MSLGEAFSKLIERMVVEEFHPKSVKVIAEPSPFGGTYYIEMTLDE
FT                   LPEDVEFRITEIVNEVEFSFYMPTSFDVEKDGDSYKVRALFVSSGEEGAYAYL"
FT   gene            complement(255913..257043)
FT                   /locus_tag="Igni_0300"
FT   CDS_pept        complement(255913..257043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0300"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81483"
FT                   /db_xref="GOA:A8A981"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A8A981"
FT                   /protein_id="ABU81483.1"
FT                   /translation="MGRLTKAIEMKRKKLEELKEIVEDVRKAEEDWHARREPRDCGITV
FT                   HPGIGCDLGCVYCYIADMGFPTDKVEPYPLSGPELALALMLNPNVAPGPTGTYVAVGSV
FT                   TEPFHPLLLDKTFEYLKWLKYLGNYTQMSFKMVFPERRLNEFLESSERRLSVLVSVSSL
FT                   RRARELEPRLPPVEKRFELAKKIKDGGKGVAVFIRPIIPGITDKESKELLELASSYGLE
FT                   DVVLGGLRVTQRIMKNLRSLGVSLEGRLRRLPRGREQVYVYTRDLRDKIAREAESLGMR
FT                   VLYTACDANARHHGEVCWDSCIFERELCERLPPVDPRDLREGVEMLGGKLVSFELKEPV
FT                   LKVEAEGLKKNAGWIIQMAYRRQVILKVGGRTFYYK"
FT   gene            complement(257049..257624)
FT                   /locus_tag="Igni_0301"
FT   CDS_pept        complement(257049..257624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0301"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81484"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A8A982"
FT                   /protein_id="ABU81484.1"
FT                   /translation="MCLREVAEKVKGCCKCDLCKVRKNPVPGEGDEGAEVVFVGEAPGK
FT                   EEDEEGRPFVGRAGRLLRSTISQIGFKKYYITNVVKCRPPGNRTPTEEEVEACKPYLIE
FT                   ELNCIRPKLVVALGRTAAEALLGLKGPLKGVRGKVLVASAGGARVKVLVTYHPAAVLRN
FT                   PKLKEQFVSDLKKAFNEVYKQRSLFDSG"
FT   gene            257685..258764
FT                   /locus_tag="Igni_0302"
FT   CDS_pept        257685..258764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0302"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81485"
FT                   /db_xref="GOA:A8A983"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8A983"
FT                   /protein_id="ABU81485.1"
FT                   /translation="MKEFYALLLVAFLGNAASRTARMGSAFATLEEGWGFLAALAAAFS
FT                   LGRLASSFLGGELSKKYGSKVTSLGLASLGATGLGYALLPPSYYPLLRAFHGFSAGFTW
FT                   PSLQAITMSKVPREYRGRASSLYFVSGNLAWFFAFALGGLLAESALVPSALALFALSLA
FT                   VLAFKGKAVEERRKGKGKAFVPPLSALVMTSIALGIMTVLVNTEVAVAVFGREFGKAFG
FT                   GLLLAAAALVGSIISYFLNKKLIDISESHLSMLLPAVGASLSGFLISAPPPLSALGLFS
FT                   TKALTMWWRSSALGLARAGDVGRRVGAFNAAGDFGRLLGSLASSLGPWTVALLPALSLA
FT                   LGTLAWAHSRSTLSTSSAE"
FT   sig_peptide     257685..257771
FT                   /locus_tag="Igni_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.250 at
FT                   residue 29"
FT   gene            complement(258725..259000)
FT                   /locus_tag="Igni_0303"
FT   CDS_pept        complement(258725..259000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0303"
FT                   /product="ACT domain-containing protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81486"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:A8A984"
FT                   /protein_id="ABU81486.1"
FT                   /translation="MPQYAVITVVGKDRVGIVAGISSVLAEQGVNIVDISQTVLRGMFA
FT                   MIMVVDLAGAKVSVGELRELLKKKGKELGVDVALHSAELVESVERL"
FT   gene            complement(259042..259602)
FT                   /locus_tag="Igni_0304"
FT   CDS_pept        complement(259042..259602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0304"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81487"
FT                   /db_xref="GOA:A8A985"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:A8A985"
FT                   /protein_id="ABU81487.1"
FT                   /translation="MASQRLKSPPTQGREGSDMIKGRVVAKLGDNIDTDMIIPFRYKAK
FT                   TTDYYELAKHVFEDLDPELAKRIKPGDVVVAGKNFGMGSSREQAPIAIKYSGVSAVIAK
FT                   SFARIFFRNAINIGLPVIEAPEVVDETEEGDELEVDLEKGVIRNLTKGKEYSFKPYPPM
FT                   IMEVMKEGGIYEYFKKHGKFPWE"
FT   gene            complement(259584..260075)
FT                   /locus_tag="Igni_0305"
FT   CDS_pept        complement(259584..260075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81488"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:A8A986"
FT                   /protein_id="ABU81488.1"
FT                   /translation="MKVAVAACGCEGPGSLAESLASKAAELGAELMLGGCWGLMGKVVD
FT                   EAAKRGVKVYIFLPIGYQCPAEERENVVVIRTNMAENFRSALLVSAAEALLALGGGAGT
FT                   LMEVLMAYRERKRVALVKGHGMDTDKYFELMEGGVDSRELAEVKAFEDPGEALEWLVKG
FT                   "
FT   gene            261315..262178
FT                   /locus_tag="Igni_0306"
FT   CDS_pept        261315..262178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0306"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81489"
FT                   /db_xref="GOA:A8A987"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022443"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A987"
FT                   /protein_id="ABU81489.1"
FT                   /translation="MALIALNLKRGSSYVAEAVTKVRLRTGVEGFDDLIAGGIPKGFLV
FT                   AVVGEPGTGKTVFSIHFAWKGVLDGQKVIYVTTEESRESIISQAAQFGMNFNKAIEEKK
FT                   MVIIDALLRDKADQWNMVELTVEELLNKIIEAKKYLGYGDARVVIDSMSAFWLDKPAMA
FT                   RKYSYLVKRVLNKWNMTIVATSQYAITTSFGFGFGIEHVADGIIRFKKMIKGWELKRYV
FT                   IVEKMRQTPHSLRVHEIEIVDGKGMRVKGPVEYTRDEVTLPSKVVEGVKRGLARKALEE
FT                   RLMELD"
FT   gene            complement(262175..263110)
FT                   /locus_tag="Igni_0307"
FT   CDS_pept        complement(262175..263110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0307"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81490"
FT                   /db_xref="GOA:A8A988"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:A8A988"
FT                   /protein_id="ABU81490.1"
FT                   /translation="MDVVEELLKLAERAARERPTRLPSGTWPEELKPVIEWLRSLSPMK
FT                   VKVAYLGPPGSYTHEAASLVFPKEELVSKGSIPEVFESVEKGEADFGVVPIANRLEGPV
FT                   NETIDAFLQSHVKVYYDVEIPIRIMLASGTVKDVKEIKRVYGHPMIFKQATKLLKELGV
FT                   EQVPTSSTSEAARIAAQEPGAAALCSPKAVEMYKLKVLRANVEDKPHNATRFFVIHKRD
FT                   NPEGDKTALLASVPHRPGGLFEFLKPFAERGINLTMIYSRPLKDHPWRYVFYIETEGSR
FT                   EALKEVLEEASKISSFLKILGSYTKLDLTG"
FT   gene            263164..263424
FT                   /locus_tag="Igni_0308"
FT   CDS_pept        263164..263424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0308"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81491"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:A8A989"
FT                   /protein_id="ABU81491.1"
FT                   /translation="MWVARVALAIVLINTEIGGELDVFEKLKSIKAVREAYITYGTFDI
FT                   VAKIESPTLSEIQKVVNEIRNLKGVRSTLTLIAVEGKHFQR"
FT   gene            263421..264614
FT                   /locus_tag="Igni_0309"
FT   CDS_pept        263421..264614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0309"
FT                   /product="DNA-binding protein containing a Zn-ribbon
FT                   domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81492"
FT                   /db_xref="GOA:A8A990"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A990"
FT                   /protein_id="ABU81492.1"
FT                   /translation="MIVALDSFDEPRSGCTTLTASLLALHLASKGFRMLDYPRLVRLNP
FT                   AVPWKTRGNAAVALEFEGSAEELFEEAKAFLERAPGRGALAVGEEFPEVYPDAVEKVLD
FT                   PDEVAKKFEGLWWGRKEALVGALAAGAAEGLNNFELLAYRLPQNLGRPRRCSFHPAYEA
FT                   LLELAYPSIHESSPEVVCPKGPDPVLLGIRGSHPPLMWAALQLFDGEPFWLATMFRTNQ
FT                   HSYEPSRRAEEYPYEFVQKEFEGSYEVRGEDVLFGDYVLFNETGITKIFKEMIGYENKV
FT                   SVKLDVVVKPGSKGVAALRDLRALFWKRKAPKCPKCGGPMVSMGKKTLMRKCKKCGYKA
FT                   EVLPKLEIKVFEGTVFPVQGRKLHLEGDYRSPPWPPEGRICEKPGCAIWVAHGFDHH"
FT   gene            complement(264611..264973)
FT                   /locus_tag="Igni_0310"
FT   CDS_pept        complement(264611..264973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81493"
FT                   /db_xref="UniProtKB/TrEMBL:A8A991"
FT                   /protein_id="ABU81493.1"
FT                   /translation="MGVRVERIKLTVTLSSALPREAAAELMESLIAVGRYVRNALNVYI
FT                   DIDVREVAGCFPTPHTFHEFHGHLLDCETVKVEASVEGEESSDAVSEALYLIKKALVLP
FT                   EGLGVGMSWVGVADAA"
FT   gene            265071..266030
FT                   /locus_tag="Igni_0311"
FT   CDS_pept        265071..266030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0311"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81494"
FT                   /db_xref="GOA:A8A992"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8A992"
FT                   /protein_id="ABU81494.1"
FT                   /translation="MCRVGWTYSKAGVDVSAQKAMEEQFIKKSKKLANGIGGYASSFNV
FT                   CGEVTLHVDGVGTKTELLRKYSRNWVAGWDCLMVNANDVACEGFRVFAYVDYLAVERGD
FT                   PVLAREVAEGMSKAAEALGAVLAGGETAIMPDVVKGYDVSCTVLGVREARPQPPRPGDA
FT                   VIAVASNGPHANGYTLIRRLIQAGLLDPEPLLDFLLAPVANYHNPLLRAMKEGKAKWGA
FT                   HVTGGAFYKVHSRLPKGLGVRLEAWEVPEGFVKIVEAAGMSAEEAYKTFNMGVGMLVVG
FT                   SEEAVEAFEREGLKAWKAGEVVEGPTEIETPWGKVVIR"
FT   gene            complement(266020..266562)
FT                   /locus_tag="Igni_0312"
FT   CDS_pept        complement(266020..266562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81495"
FT                   /db_xref="GOA:A8A993"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A8A993"
FT                   /protein_id="ABU81495.1"
FT                   /translation="MSAEGISFKPTLRARAGELFFLALALALNVASPFVEDVYLWASLA
FT                   AIAVLSVLILKKKAVLVLVPLAFTAAAVYLTNPLLLVISSIISLIEVGFIIIYTNSVEY
FT                   YFNDDGLIIRVELPVYSKTRNVPKSTIAEVSVESSPVGKLLGYSNVTVKLRTGEVVNVV
FT                   GVPKGDAEKLVKKFVSG"
FT   gene            complement(266591..268249)
FT                   /locus_tag="Igni_0313"
FT   CDS_pept        complement(266591..268249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0313"
FT                   /product="Anticodon-binding domain protein"
FT                   /note="PFAM: Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81496"
FT                   /db_xref="GOA:A8A994"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A8A994"
FT                   /protein_id="ABU81496.1"
FT                   /translation="MKVLIVRSKSFAAGNERLDDALVAFVAVEPGDETVLDEVAEDLIN
FT                   FMKYSDAKVLVIYPHSKLSPMPENYHEAMKKIRELVDLLQRKGVPVKEVEAGAKGFVLE
FT                   TLGVPALHEFRSYGPRKRLQTVAEYVVNPEGEFKGIEECEDASLVSLIKFMKGGQKVEH
FT                   DPNVERFCRKFGFAEAEVTPRGFWTLLPHAYFMYLAFTVHVTSVLQALEVPTISVKTPE
FT                   VVRYGCDISCSDGFLRCDEFKEHKQVVEKYADPNDLPFALFEQLLLFREEEDTFPCYRT
FT                   KEFHVPKVRIFVPSFSEASDVALTLHELIHTEAEKLGMKYVVSYTVSEELFEEAKDLII
FT                   KLVKRDNRCAYLRVVKSNEIFIDAEMYVINSMGYPVELGTWKMRKALMWGREVYSVSAA
FT                   PLGSFERFAYVIFDKAAKDLKSGETPELPAWLSPIQVRVIPKSRDVLPYALTVAEELRE
FT                   RGIRVDVDDRNVPLSRKLKDAGEEWVPFLLLIDKREEKLGRVILMRRKTNDREDVSLEE
FT                   VIRVVSEEVGGYPQLPQTLPILYSKRPKFAKPDED"
FT   gene            complement(268286..271210)
FT                   /locus_tag="Igni_0314"
FT   CDS_pept        complement(268286..271210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0314"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81497"
FT                   /db_xref="GOA:A8A995"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="UniProtKB/TrEMBL:A8A995"
FT                   /protein_id="ABU81497.1"
FT                   /translation="MLHWTGYPPLVSAALLAVAWYYALKKQEEKAIKFVNLGTLVMTVA
FT                   WVLYVIPFVTLDFSLHEVYWNSSEGLPLWMRVATSWSGGGGSLFLYTFIATIALWWSRR
FT                   AGRAFLLIAIPLVLVGLFAAYMNDAFALIPGNPVTGAGLNPLLKSPWLYPHPLTTFAGY
FT                   ALLAISAVALALGHSRARVTYNVGWALLTIGIALGAYWSYETFGWGGYWAWDPVETSEL
FT                   SVWLTATVLPHLFPLAFRAALAYSPLVTSSVYQAMFVTRTGLSPLHSFAGANLGSAVLF
FT                   FTAVATFLWWVKEISDNYKEFVGIVKRVVEQKEPYYVGTALAFSSLLVAALFVYATLFV
FT                   PSLLVIMGREASIPQQSSGINYFHPVLYPLLVVMLVAMPLVFLNEAGWRVILSAEAAAL
FT                   LLSTSMAVAAYLGELNLAYFSPKLTNVMMAFGIPLAAFSLVTAIYYIIKRYKLVRDWGI
FT                   ALLHAGVALTAIGVFMSGTYAYNNSYFFDFNLRPDETHSLPGGSKLYFSNYKYELSDSM
FT                   VDIKSKYLERSSTYFYAWLALKTISQDLSMLMQFLKQANQTINSEPLLKELLTILKEKR
FT                   PTFANQGMLVYSLGPVEPFSANYTYLNISDVTTGKYRVVKERGKLFFGNNEGVVYFMFD
FT                   PNGNVRYYFALLTRGLGIDYKGNLTFHEVVYARLERPVKFKIGDFNVTAKGFTVYPMGN
FT                   LLEVHGLKSFTQALEVVDGNVTAGGKEYPNGATVTSGFVTYLQALNDPVVSTILEDKEL
FT                   FEFLSNPKNVEKLITPPKGHKCLNPHCEGYVNAPQYVPETIRLDLDFYSEKGGQRHAFH
FT                   TSIRYEAYGEIQGIHGLVPKVVHPSYGLTDLYVALNPPVVFSKTSNMISYHDMLLMYLN
FT                   KVFERYNVSERLALAALFAAGYNINVIKQVPQTHLPGFLEQAAIELYLLAKNYRSHIPE
FT                   NGLYVQAKMIPGVPFVWLGSLVMTIGSLIGAVAYKVPRAVSPKL"
FT   gene            complement(271268..272425)
FT                   /locus_tag="Igni_0315"
FT   CDS_pept        complement(271268..272425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0315"
FT                   /product="acetylornithine deacetylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81498"
FT                   /db_xref="GOA:A8A996"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8A996"
FT                   /protein_id="ABU81498.1"
FT                   /translation="MSPQEVLDLLSQLISFDTVSPEGKQYEDLVHFLKGWLEERGVSAK
FT                   VEYVDDEYRSSHCPQGPKPLLFAWVGEGEPLLEFNGHYDVVPPGDGWEGNPFEPKVVGE
FT                   YLVGRGATDMKGGVAAVAASLAELSNWKGNKVQAVFVPDEEVGGRCGTGYRVSKLKEKY
FT                   EIPRRVVVAEPTDHNVWIGHKGVVWLRVEVPGKQVHASTPWMGENAFVKASALVLELNR
FT                   ALTDKFSKRYSKYEYSPEHPLTKFNAFNIGGVAYSTSNKENVVPGSFVFSVDVRVIPEE
FT                   DEREVVEFVKEVIGDRAKVEVKLLEPGILNENSELAKLINEVWGEPLKVHKAASDMRYY
FT                   RGYDVVTWGPGDHRESHTPNEKIKISEVVEFVGRYARLAKLLAGG"
FT   gene            272555..274015
FT                   /locus_tag="Igni_0316"
FT   CDS_pept        272555..274015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0316"
FT                   /product="Thioredoxin domain"
FT                   /note="PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81499"
FT                   /db_xref="GOA:A8A997"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8A997"
FT                   /protein_id="ABU81499.1"
FT                   /translation="MRLGGPGRLDFKKFKEEKRAGTALLILALVGSAVAAGLVWYESYV
FT                   SNNYVSTEAYTIYNVPAFEKLLKENKYVAVMFRSLTCPHCEKMLPYWLKLEMSQGKVRF
FT                   VDVVYGTNTATLFQRYKVEGTPTFILFKDGKPVARHEGEFIAENVTEAMLNWALSAVGT
FT                   PVLAGYQTYLAKCSVCHGAPASTSREDLLEWAKSERNGIGRLLLEAYRKRVTLEELLGS
FT                   EDAIKERIWGMARRNNVPLDQKTVDETAKFLQAVSEVLIGKKEVNAASMSAGTTEIPSS
FT                   GSAAPALMFLVGLAAGVGAAVSPCNFPLFVTYVTRGLRERRSSALSAVSCAAAAAVGVA
FT                   FLGALFLAFSTAALELQKFLIPVVGTVIVAISAASLLKVPISFSAGSLGKTGGKAFCFI
FT                   YGFLSVQCNLPLVIGALLLIASGGGFQTLAGFALGVAAPLFAVSWAGPRVRGLAEKIVR
FT                   NSERIELITNAFMLAAGIYLLFYGATLM"
FT   sig_peptide     272555..272662
FT                   /locus_tag="Igni_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.977 at
FT                   residue 36"
FT   gene            complement(273994..274761)
FT                   /locus_tag="Igni_0317"
FT   CDS_pept        complement(273994..274761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0317"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81500"
FT                   /db_xref="GOA:A8A998"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="UniProtKB/TrEMBL:A8A998"
FT                   /protein_id="ABU81500.1"
FT                   /translation="MIVEVPLHVSGLWRPVWRRSAISTGSLGAGVLLKPGAVCSPGGPR
FT                   PPVPTALGEVRCKLPVPVGKGFATSAAIALASAIFKYKSFVEAAARAHVAEVLNKTGLG
FT                   DVMAIAYGRGVAVRTEAGGPGWGRVESLEVPRKVFVVGFTVKGLFADTPSMLSSLDVRE
FT                   AFEDAWKALLDGFDFYSFLEAAEAFSARVGFLKFVEPRLLKLPGVMGGYVKKSAGVLFV
FT                   EGAYADEVLEEVKKVYKVARAFTPASFYMRVAP"
FT   gene            complement(274795..275598)
FT                   /locus_tag="Igni_0318"
FT   CDS_pept        complement(274795..275598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0318"
FT                   /product="HhH-GPD family protein"
FT                   /note="SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81501"
FT                   /db_xref="GOA:A8A999"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A8A999"
FT                   /protein_id="ABU81501.1"
FT                   /translation="MRYPKESLALYAFSWQFDGRCGYGELDGRPFKFCPPDELHGDPEV
FT                   ASKALGLHEDLDELYEALKGDPLLGCVAERYWGLRPRALGIWEAAVVGIAQQNASFKQA
FT                   WSSLYKLHIIASKRINVFGKEYLRFPRPEEVDERALKAAGFGYRAKFVTALKEALRERP
FT                   LTCSNVDSLKGVKGVGDYTLGLVKLFACRDYSAPVLDRWLKAVYEEAYGGLERYYEFGK
FT                   WKGLVSLLTTVALDAVPLTRALERVRRGEVCPSEEPSPLTLWKYF"
FT   gene            complement(275595..276566)
FT                   /locus_tag="Igni_0319"
FT   CDS_pept        complement(275595..276566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0319"
FT                   /product="methyltransferase"
FT                   /note="PFAM: protein of unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81502"
FT                   /db_xref="GOA:A8A9A0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR040601"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A0"
FT                   /protein_id="ABU81502.1"
FT                   /translation="MLAVAVPKGEAQRVLEELRRKNVVDQNYKIKEVGDKVLIPVKAPV
FT                   EGYEVVEIELERRERPKSLKECLEERLGKGDWPRSFSVVGDLAVISLKDEELLKYSKEL
FT                   WECIKASQKRVKSLWAKLGTEGEHRVAKLVHLGGEKRTETLYKEYGLIFKVDLAKAYVN
FT                   PSLSEEHREVSEAVRDGERVLDMFAGVGFFPIHIASKRTATVVAIDLNPNAVKLMIDNI
FT                   KLNKKKLRGTIIPIMGDASEVTKFFKDKSFDVVIMNLPHKAEEFLNEAKRLAKRAILLY
FT                   VVGTEEEVERKYPGCKKKGVLDYSPGKRVWRVELVPECWGEA"
FT   gene            complement(276493..277536)
FT                   /locus_tag="Igni_0320"
FT   CDS_pept        complement(276493..277536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81503"
FT                   /db_xref="GOA:A8A9A1"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A1"
FT                   /protein_id="ABU81503.1"
FT                   /translation="MEPLIAKVLVAYSLATFTVALTLAPVFPKLHIDFMRAAVVTFPHG
FT                   VALAYVASLSKGERRELLPLNAPLLALPFWYDGLKHYLAAPALHVALWALSSSSKWKGA
FT                   FRRSLQAVAISYFALTIYSITSADPVTDAVRLLAYPFALIYAVSCQSFPKTFGEEANWP
FT                   LAFASSALSLALLAYPHPSYALGFFSPLVYLVAAKFYNLPKYYKKVKGLEGVARRAQEY
FT                   FWWGHALVIPSSFLPLLAKEPLTSLHASLLGFVALHIFIHFPMMVPIILKVPNRRRYCK
FT                   LPLPLALLSATVWPHQRHLAYALFLLAYSTLLLSTFELPGGGLAGGGGAEGGGAKGPRG
FT                   AQKEERR"
FT   gene            277637..278860
FT                   /locus_tag="Igni_0321"
FT   CDS_pept        277637..278860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81504"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A2"
FT                   /protein_id="ABU81504.1"
FT                   /translation="MGARVLFRALKAGAGLPDSKLNVEQRDLHDCVLLPEVHKGVVLGF
FT                   VKGKETFLMACGSSEVPTYFEARFRADVQVGSDEDLFSISLGALPGKRYCVTKLSELNL
FT                   VVKLFESEKDKSEVEMVASLVKSMLAAAGGGGLGPAGLVFHARKILALFSELRGVYVNL
FT                   RVETDKGSVNLDRFMYFKILDSEPRYTEIKVLSKLPLAPGEPVKLLVKNKSNETVVFQV
FT                   WGDYKMAEDDLLYEAYLRPGEVRDVELELYEGSYLYLRDLYLRECPLAEYEKTGECSVV
FT                   GSIPYFNALTLLELAKVKWFEGDSEVTESELGPGRYKVCVEPPPLVPDLDMHATVTLRV
FT                   ILDRKLLPDRTLAVERVTLTSLTDFKVCINFIIDEWSFTDEWSARGIKLELKGYGLKLK
FT                   LDELPRRR"
FT   gene            complement(278815..279405)
FT                   /locus_tag="Igni_0322"
FT   CDS_pept        complement(278815..279405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0322"
FT                   /product="Cyclopropane fatty acid synthase-like protein"
FT                   /note="similar to Cyclopropane fatty acid synthase and
FT                   related methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81505"
FT                   /db_xref="GOA:A8A9A3"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A3"
FT                   /protein_id="ABU81505.1"
FT                   /translation="MEKVVPFIPSPLKVVKAALELAKVGPGDVVYDLGSGDGRVVVLAA
FT                   KLYGARAVGVEVDDALVLLSQMKVREEGLEDKVKILKKDFKEVSLEDATVVYLYIYYDV
FT                   IRDLMLEKLEGLRPGARVVTLEIPVPGWMPVAKRGVQDEAGVVRTLYLYVKGVSDPSSW
FT                   KNEEADPKWVEEFRENLWGHLRRGSSSSFSLSP"
FT   gene            279553..280800
FT                   /locus_tag="Igni_0323"
FT   CDS_pept        279553..280800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0323"
FT                   /product="translation initiation factor 2 subunit gamma
FT                   (aeIF-2g)"
FT                   /note="PFAM: protein synthesis factor, GTP-binding;
FT                   elongation factor Tu, domain 2 protein; Initiation factor
FT                   eIF2 gamma, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81506"
FT                   /db_xref="GOA:A8A9A4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A4"
FT                   /protein_id="ABU81506.1"
FT                   /translation="MEEREVQPEVNIGVVGHVDHGKTTLVQALTGVWTARHSEELKRGM
FT                   TIKLGYADGDIYKCTNCPEPDAYSPEPKCPRCPKGSEPVLQRRVSYVDAPGHEVLMATM
FT                   LSGSSLVDGALLVIAANEPCPQPQTKEHFMALDIIGIRKLVVVQNKIDVVSKDQAMKNY
FT                   QQIRKFLEGTWAEDAVVVPVSALHKANIDALLEAIQEEIPTPPRDLDSPPLMWIARSFD
FT                   VNRPGTPPEKLVGGVVGGSLMRGKLRVGDKIEIRPGYAVRSGNKVEYVPLESEVVSLRF
FT                   GNVEVEEAKPGGLVAVGTRLDPSVTKADALVGSVLGRPGELPPVYDQLTLEYHLLDRVV
FT                   GFRGGEMKMAPLRRGEVLMMTIGTNITIGMVVDLKKDEMTVKLQRPAVAWKGARVAFSR
FT                   RIQGRWRLAGWGVVKN"
FT   gene            complement(280797..281825)
FT                   /locus_tag="Igni_0324"
FT   CDS_pept        complement(280797..281825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0324"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81507"
FT                   /db_xref="GOA:A8A9A5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A5"
FT                   /protein_id="ABU81507.1"
FT                   /translation="MSFPRLRPRRLRKNLYLRDLVAETRLSPRDFIYPIFVKEGIDKPE
FT                   EISAMPGQMRWPVGEELVKHVQEALDLGVRSVLLFGVPKHKDDLGSSAYDDQGVVQRAV
FT                   RLLKKELGDEVVVFTDVCLCHYTSHGHCGVLAKRCRGDLCEYVVDNDKTLELLAKVALS
FT                   HAKAGADVVAPSSMMDGMVLAIREALDKEGFTDVAIMSYAAKYASAFYGPFREAASNAP
FT                   QHGDRRTYQMDPRNGEEALKEVMLDVKEGADILMVKPALSYLDVIRRVREAFPHYPLAA
FT                   YNVSGEYSMVKAAAEKGLVDEKKITLEILHSIKRAGANIIITYHALEASRWLKEGLDLK
FT                   MF"
FT   gene            281891..282595
FT                   /locus_tag="Igni_0325"
FT   CDS_pept        281891..282595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0325"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81508"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A6"
FT                   /protein_id="ABU81508.1"
FT                   /translation="MRWSLEGEAYPVIRVELEEGEKLYAEAGAMMMMKGDVKVDTVLID
FT                   LEEEGNVLRALAEALGRKLLAGETVFHNVFEGPGVVWLSPSLPGGVEYIEVKGECWTVQ
FT                   DYSYVAHFGDLKLDLAWKGPKGLFLGDLVWLRACGEGGLWVSSYGDIMKVEVEDEMVID
FT                   NMHFVALPDDAEWRVEKFGGLKSFITGGEGYVIRVKGPTTVYVQTRILPPLAAAIARFM
FT                   PSRWAELFRARL"
FT   gene            282698..284269
FT                   /locus_tag="Igni_0326"
FT   CDS_pept        282698..284269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0326"
FT                   /product="CRISPR-associated protein DxTHG motif"
FT                   /note="TIGRFAM: CRISPR-associated protein DxTHG motif"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81509"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A7"
FT                   /protein_id="ABU81509.1"
FT                   /translation="MKALVISTWGNSRAWERVTYRPDDHLKDALEDVLEQEVTSCNVLK
FT                   LFKKENTRKVVLLPISLLDEKANDLKEAEDKIKETVVTSNENDDCRKDLKEILNSSEVK
FT                   IVLGSGTFLSNKVIKKFEVPFNTVLSDLYLKLYESLKEEYKRAEEELEVILDITHGVNY
FT                   YPVSSRAILEKLLAVMSHRGKSRLYVASSDPFVRGRGGSVKETMNLEYHLIEKKAFPKN
FT                   AFLTLAIDIEFKNVVKGKSEINDELEELKKIKKYIGLLSVPSLLAWSYLKYVLENNNAI
FT                   KKAENLLLRISKELEKFSIEDDKFKFSVEFNPKSVFDLIALIEVGEALKDLKGEKNCDF
FT                   FAVEFDDLNASNNKYKDLMEDVSKRLWEKEFNDLKLTIRSYERVKEEARSALEELKNID
FT                   DLRNLAVSEEKLREKVEKESTERLKCKLEELRKYIMDGWLPYSFLRVGSEVSGGGESIR
FT                   KKLQEEALWWAVWALRVNRDDCSADEATVRNFVAHAGLEMNVTFVKNDKVAYYLPSLEC
FT                   IIEKLT"
FT   gene            284384..285220
FT                   /locus_tag="Igni_0327"
FT   CDS_pept        284384..285220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0327"
FT                   /product="CRISPR-associated RAMP protein, Cmr4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr4
FT                   family; PFAM: protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81510"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A8"
FT                   /protein_id="ABU81510.1"
FT                   /translation="MKKDVVPALMSAVTHVHVGWGRGQADVDQPIIKDPMGIPFIPGSS
FT                   VKGALKTKFLIEGGCTSSSNGGEGYCEKCAEVCCLFGGEMGGEGASRVVVADFYPLLIP
FT                   VPSLDYGYVYVTSDSLLQYAESLGIKVIKGEGEGEEIFVGTQKVSVNAVHLDERVARLH
FT                   PFLKRFLRSDSDKYVRVYKVDDDHLSRLVDAALVRLTRVKVARGTKTVERGKLWTEEYL
FT                   PHGTVLAGAFVYRPWRNVYCERCERCEEIWERLKDVLLTIGGKETIGKGLVKITAF"
FT   gene            285517..288594
FT                   /locus_tag="Igni_0328"
FT   CDS_pept        285517..288594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81511"
FT                   /db_xref="InterPro:IPR013407"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9A9"
FT                   /protein_id="ABU81511.1"
FT                   /translation="MTCNNLIKKKMVALLHDTPEKAWLMYVKKKHEEYAKERIGDVLGE
FT                   EYLDYFKDVKAYDVISSTIDRWVVPSRMNIDRVIRLINPFDPNFFYEIDLGQISKEKIE
FT                   DYWNKLKTCLSKVSGDRERYHAQYVLMELLWYKTVKVPLPADTRFPTHTVFDHVYATAS
FT                   MINIYNNDSKKFSGFIVGIDIPGIQSFISGGRRPGDWWIRSWLISATVWYLIKELVWNL
FT                   GPDVLLSPSARYNPFYYATVAHRVQAVRECLDENLTSPEQPLMPATVTLLLPACSIELM
FT                   RSELVEKGSLKEGEGVSDPSVIISRYFKERLKEAWKNVIEDIQTRLRSTADNLIKTLEK
FT                   VRVCTGTCTDVASADDLIERMIEIIKHAERAPFDVKTVVINLEEAFEEFVKEFRRIEGK
FT                   MRAELEQLISSEGLAVGKDVFPYSKDLSDVMSDLEKKLFFHWLVTKKYPEEFRKAKAVR
FT                   LDPLLLDGWTLEVTKARYESCKDKSAPMCTCGRPAAVHNPSEASSPLLRSHEALCPYCL
FT                   ILRLLQYYTDALTSIVEADHVKAPKVVMSTLAALPELVKWLSESGGAVEIMDENGNNVG
FT                   LPKDQLLESLTRSLKEYSSFDFYQNKYSRFSLEEVLEELQKNETVERLIRDDSKNLYIR
FT                   VLVRKDRDSSKLLSLNKYIAMVKADADNMGNLKGGRLGYDAEAYFETIYRQAGPRRGVG
FT                   QEEKLYKLAGSLVRSVIERLHEIYPKEVYGENDSSLPTVLVTPTYLFQLSYSLMTEALV
FT                   DKEIVEKNYGLLVFAGGDDLLALVPARSVSRGSGRAEPLGGLEEFLSRELLEIVKEFYF
FT                   SPALWVWWLTRLNHWGLLRSPVGFRYTDNFFAPALLAYGRSYGIAIRHYRDPLAKVFED
FT                   ASELEESAKNVSKKKDGVGVSYGRLGARGVALSNSLGVEDKGDLKEPASLGPIIAKLSS
FT                   FHRRGLSNNFYYDIVRELQKYFGHDAKHEWAAAKGLTTPIIILLKYIISRNVADEEKYS
FT                   QNLKKEVEEVLEFLKLTNEYIFDVLEFGFAWHKAVR"
FT   gene            288601..289665
FT                   /locus_tag="Igni_0329"
FT   CDS_pept        288601..289665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81512"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B0"
FT                   /protein_id="ABU81512.1"
FT                   /translation="MIAIEPLSFVSFRKPGPFGLTQRGPLSTSSTYFAKTTALVGLLAY
FT                   LAYSKGFECEAEGLFEATKKCVGQCFKGSLRGPYVLHRDSSCLYFGEENLFNLTVLFEK
FT                   WNEIKTAVKKYLEGEAELGRKKKGIIDYFTTPSYNEALAGGSSPQKRGVGWRELISHQF
FT                   SNKLSRSKKMSEFVFVRERFYARKVEMFFEVGEVEPRCLDDALLPLGGDGGLTRVEAKD
FT                   VNPVEEKLKDLWGECWEGCEGAQSVVVVISPLIMGSEGDYSDYRRPFKEVLDFEGASRE
FT                   LLPLYDRYTIKAYPLGWDLMRDCPRPFVPAVAPGSAVVGKLKKPPKEIYWKGLGLFRDL
FT                   GFGTVLPLPLDPTT"
FT   gene            289795..289873
FT                   /locus_tag="Igni_R0011"
FT                   /note="tRNA-Gly1"
FT   tRNA            289795..289873
FT                   /locus_tag="Igni_R0011"
FT                   /product="tRNA-Gly"
FT   gene            complement(290035..290451)
FT                   /locus_tag="Igni_0330"
FT   CDS_pept        complement(290035..290451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81513"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B1"
FT                   /protein_id="ABU81513.1"
FT                   /translation="MNSNGAFSNIGCSHVGKDEKEMSKYKGLVICNIGRRSCKSTDAPA
FT                   IQRLTSRGPEGPPHALSDQQPNDLIDKVLGVTYKLEAALALKALGYRVPKDLLEVPSIS
FT                   LRTKAEKAFVYGLVGSPRGRDSWRRLGRLACWRS"
FT   gene            complement(291016..292575)
FT                   /locus_tag="Igni_0331"
FT   CDS_pept        complement(291016..292575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0331"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81514"
FT                   /db_xref="GOA:A8A9B2"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B2"
FT                   /protein_id="ABU81514.1"
FT                   /translation="MLSSLGKGILTASTALFFKSMGYTTTAIKIDPYVNVDASTMNPYA
FT                   HGEVFVTEDGGETDLDLGHYERFLHQNLTKNNNITTGKVYLNVIEKERKGEYLGQTVQI
FT                   IPHVTDEIKRMIDEVAKDFDVAVVEIGGTVGDIEGLPFLEAARQMWVERRGDVAFVHVA
FT                   LVPVLSTTGEQKTKPLQHSVQELRRIGIQPHVVVGRSTKPLEPETKRKIALYSNLPEEA
FT                   VFSDPDVEFVYEVPLRLAEQGYPKYLTKILGLEERKIELEYWVDFVNKLKSLPEGPTVA
FT                   MVGKYTKLKDSYLSIIESLKHSAVEAGFMPKLKWVEVTDVERGKLSPEEAAEADGAIIL
FT                   PGFGKRGAEGKIAVIKELRERGVPTLGICFGMQMMVVEVARHLAGLEGANSEEVDPNTP
FT                   HPVVALLDEQRKLKYLGGTMRLGAKPVIIMKGTKLWEAYKKTLVKERHRHRYDVNPKYL
FT                   DKLEEAGLRVSAWSEGVPEGVELEGQEFWGVQYHPEFKSRPLQPSPVYTRFLKTLKFSA
FT                   SS"
FT   sig_peptide     complement(292507..292575)
FT                   /locus_tag="Igni_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.901 at
FT                   residue 23"
FT   gene            complement(292640..293686)
FT                   /locus_tag="Igni_0332"
FT   CDS_pept        complement(292640..293686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0332"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81515"
FT                   /db_xref="GOA:A8A9B3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023819"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B3"
FT                   /protein_id="ABU81515.1"
FT                   /translation="MLWLVYSSSKCNLKCKYCGGSWPDLPPKPVYPVSTLKEYLEAVDP
FT                   RPAIVFYGGEPLLNPKFIMDVMDNVEATFGIQTNATLHHLLPPRYWERMKNVLISIDGP
FT                   EEFNDSRRGRGSYAKALELAYKARRLGVKRVIARMAVDLESDIYRDVKHLLSLPFTHVH
FT                   WQLSVDWVPKWDLRGWAERSYLPGIRRLAEEFKEHYLRTGELLGIVPFIALLKAHKEPW
FT                   DWVPCGAGRKAYSVLTDGSVVACPIAPYEGWAKAGSVYERSPPKALSYPEGVPCERCEY
FT                   KGYCGGRCLYWLYERFWGDEGMKEICWVTKKYIDTFFEVVGDLADEMAEHEEVASYDPL
FT                   EDSTEAVP"
FT   gene            complement(293686..294030)
FT                   /locus_tag="Igni_0333"
FT   CDS_pept        complement(293686..294030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81516"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B4"
FT                   /protein_id="ABU81516.1"
FT                   /translation="MEEAFLLVVALSGFYRDAKLVNPMKFKALRTLVKYSKLVRSKCNK
FT                   IFMKVQTQHIISTGFYRVVLKSFVYKANTEMIRKELEDSEVTVSIVMRRLAPEEAEEVK
FT                   NVLESACKRR"
FT   gene            294150..294566
FT                   /locus_tag="Igni_0334"
FT   CDS_pept        294150..294566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0334"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81517"
FT                   /db_xref="GOA:A8A9B5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B5"
FT                   /protein_id="ABU81517.1"
FT                   /translation="MQKPLVSIIMGSKSDEHVAKKVIEVLEEHCVPYELKVISAHRQPE
FT                   ELDKYLKESKEYVKVYITIAGLSAALPGVVASKVEQPVIGVPVEVKLMGLDALFSIVQM
FT                   PPGVPVAAVGIDNGKNAAYLAIRILKLAGFRPCK"
FT   gene            294580..295182
FT                   /locus_tag="Igni_0335"
FT   CDS_pept        294580..295182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81518"
FT                   /db_xref="GOA:A8A9B6"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B6"
FT                   /protein_id="ABU81518.1"
FT                   /translation="MNVTNVLRKAAKLAYKSKAFDLLAYVKSAHMNYVAFALTIINLVV
FT                   ILNGVVLPYLRVPAPLRLATTALILLAVGATSLILGWIDVNAGVTRKTVEKQAYWRRPT
FT                   WAQAATLTLRVADLPSVVSLWLRLKGEGTADEELKRCFRNAVHNTVEWVYFSHLEVGKP
FT                   PMSQDVRCLERLASMLGLDVSDIKDEILEILKKPEFR"
FT   gene            295179..295706
FT                   /locus_tag="Igni_0336"
FT   CDS_pept        295179..295706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81519"
FT                   /db_xref="GOA:A8A9B7"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B7"
FT                   /protein_id="ABU81519.1"
FT                   /translation="MRGMSKLHRALKVYVYVRLGLGNYLSFTLAVFNTASLVWYFAGLK
FT                   EVIGFGEFLLLFFAIYFPLAAFLGYHDLKRLVGKTMAEVSPYWRRPNYFLSNYYLGSMM
FT                   YLHHALAFWKLSGDDRVKECSKEAVMNHLKRLISEGEMRPHGSCFCKLAFEEGLMDEEH
FT                   YEMCVKALRELE"
FT   gene            complement(295689..296324)
FT                   /locus_tag="Igni_0337"
FT   CDS_pept        complement(295689..296324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0337"
FT                   /product="Endonuclease V"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: Endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81520"
FT                   /db_xref="GOA:A8A9B8"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9B8"
FT                   /protein_id="ABU81520.1"
FT                   /translation="MTFDRRRASELQRKLSELVKEEDCFDPEAVEAVGGLDVSYKGDVG
FT                   VSALSLIDYKTLRPLKHYYVVARVPIPYVPGFLAFREAPLHLTLIKKVKGYDLLLVDGH
FT                   GRTHPRGLGIASHVGVTSGVPTVGVAKRRLVGEEERCGERECLVHEGKVVAYVIRRGKQ
FT                   KLYVSVGHCVSLETAYQIVKRLTVRRLPEPIAWADRISRSLARSLQLP"
FT   gene            complement(296321..297136)
FT                   /locus_tag="Igni_0338"
FT   CDS_pept        complement(296321..297136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0338"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81521"
FT                   /db_xref="GOA:A8A9B9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9B9"
FT                   /protein_id="ABU81521.1"
FT                   /translation="MNEIQRALEKWRNIIDKELEELIKNTYEERVINVAKYIVNGGKRL
FT                   RGALVMLVNEALGGNPEDALPAALALELVHASSLSIDDIIDLDFVRRGRPSAWVAKGVA
FT                   NTVMVSNLLIPHAIMLVKRYGKRAIDKVVEVWWEVSKGEVWDVHGPPEGKGVEAYEAII
FT                   EAKTASMFALSAYLGGLAAGEEERLEGLWRYGFLLGKAYQIADDLKDVEGDASFSAKLF
FT                   REWLKEAGKEGVLKRLKEIVEECERIGSEFGPLLASFPRRGVELMGVKL"
FT   gene            297180..297563
FT                   /locus_tag="Igni_0339"
FT   CDS_pept        297180..297563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81522"
FT                   /db_xref="GOA:A8A9C0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C0"
FT                   /protein_id="ABU81522.1"
FT                   /translation="MVAGRYTEILLTCRNPYPGKAVDFLVAFFYSDYCPTCDDVRPHWE
FT                   EFVELHRGEGTFIRIKKSPETAKLFKSLGVSWVPTVVFYHDDKEVKRIEGFFTLSDLER
FT                   AMRRFLSRVSARTSPRACSPQKA"
FT   gene            complement(297469..298623)
FT                   /locus_tag="Igni_0340"
FT   CDS_pept        complement(297469..298623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0340"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81523"
FT                   /db_xref="GOA:A8A9C1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C1"
FT                   /protein_id="ABU81523.1"
FT                   /translation="MVALWRAFSALAELSRRWSEAWLRKLLSSPGTPMRPEGRVSLYLH
FT                   VPFCRSLCKFCHFVRFPYSEDLASKYFKKLIKDVEEAHSSGVEAVEVYVGGGSPSSKPE
FT                   ALGELVDLVWSLWRPQISVEVHPVDVAFLGAAEHLDPKKVTRVSMGVQSFSPEGLKKLG
FT                   RPVSPETNELAIEILKSKKFKTFNVDVVWGLEDPTPDAVKALECGADQVTFYPLMPFPK
FT                   RGPEGERLCFQNYQRIVREASKRGFVRQNAWTFSKTEAMVDEYVARAEEFLGLGVSSFS
FT                   LVGGAAHLNVFDLEEYFKRGWSEPWHSVKLNPLEGLAFKVAMALHSSPPLRAEALWYSG
FT                   LVALRELYGVLGEFRLSVVSKLWEKYAPKPSRGSASLPARGQRA"
FT   gene            complement(298680..300146)
FT                   /locus_tag="Igni_0341"
FT   CDS_pept        complement(298680..300146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0341"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /note="PFAM: protein of unknown function DUF557"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81524"
FT                   /db_xref="GOA:A8A9C2"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C2"
FT                   /protein_id="ABU81524.1"
FT                   /translation="MKVPKLMATQHPDSTVVLMPQDEVEEAIQDVLPLDQGGRGCDEKM
FT                   VDYEGKATPYNQMRDIIEEVRKYDVVPGEDFLITPRVPNPKLEDKDRHLLAITAAVTAN
FT                   MYSQMYFNTDAIKYIILPMSTSTLELAEVQRRILKVERLVSEEFSLRIEEWIKLIPLFE
FT                   TAESHMHIDEIVEGLRIAFIKEIGMFENEFRIFMGKSDSGIHSGHIASSIGVRMGLLKL
FT                   WNWQKDTMFKVYPIIGMGKPPLRGHMAEWVIEDWVEAWRGYYTATVQSALRFNTDRKDY
FT                   VHTITVVTKNSGKQPPLELLGYAKEMVNVAWRASEVYLSRLERLADMISFMAKFVTRTR
FT                   ARLDSYKRRAKTGKEMPRAIRFCASLYSMGLGPTLIGAGVIEELASGTAEKLEHLLKFV
FT                   PLLPKDFAFDYAFTDLEVFKRYVDEKTFEIIKKDVDVVKEYFANVEPPKSPPEGYFEKL
FT                   RELRGALDEAEVSRAKAIVMELAEMRGFLG"
FT   gene            300240..301523
FT                   /locus_tag="Igni_0342"
FT   CDS_pept        300240..301523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0342"
FT                   /product="pseudouridylate synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81525"
FT                   /db_xref="GOA:A8A9C3"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C3"
FT                   /protein_id="ABU81525.1"
FT                   /translation="MRITEEALEVVKHYPLCDHCLGSLFARLGKGLGNEHRGEAIRRVI
FT                   IMELDRMVREGEIKKEEAEKIMSNFDSDEVEELAKNMGYSVRRRSCYVCGGKWRELVEE
FT                   WSKKVVDALKEYEFDTFLVGCSDCGGMVERQREIISAFRLPYAESVKNSLKREVGKRVK
FT                   ELLGKEPDFEDPHVVAIMNLREDKVDLQIKPVFIYGIYKKKARNVSQSEWKYPYSVERA
FT                   VRKALSPFGGEVVLHASGREDVDVRALGTGRPFVAEVKRPKRRRLPVEGSEYEDELVWL
FT                   RFERYVNRDWVQRVKGDESKKEKVYLALVYVPEGVDEGDLRALEEFFEDVTIKQRTPKR
FT                   VLHRRADVVRERKVYWVKARKLNDKSFEALIKAQGGLYIKELVSGDEGRTEPSFSSFLG
FT                   KEATCASLDVVWVSLPQAELRGGGEERG"
FT   gene            complement(301431..302267)
FT                   /locus_tag="Igni_0343"
FT   CDS_pept        complement(301431..302267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0343"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81526"
FT                   /db_xref="GOA:A8A9C4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C4"
FT                   /protein_id="ABU81526.1"
FT                   /translation="MEGPRKLALKVAERARDFLRSKFLDESYLKVVEEHKSDVSRKIDL
FT                   EVEDLIIKTLREEGFKGGIVTEEKGVVGEGPPYAVVDPLDGSLNYAVGSPHWAVSVAIA
FT                   EGEDFSTLVASAVCPGFGHPCYSASDKAYSGEGEVIPGAPEKVLVFYGEPEDERQSKYL
FT                   VELRKLLGRPKVRVPGAIALDMVNVARGKLLALVDVRNKIRNVDVAGAYLIIKRAGVPV
FT                   PEVYESFPTDEVSVVGNLFFGRDERVLSALLSSASKLGLWQGDPDNVQARAGRFLP"
FT   gene            complement(302251..302910)
FT                   /locus_tag="Igni_0344"
FT   CDS_pept        complement(302251..302910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0344"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /note="PFAM: B3/4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81527"
FT                   /db_xref="GOA:A8A9C5"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C5"
FT                   /protein_id="ABU81527.1"
FT                   /translation="MISRDAYSKEKGAYLYFAVVKGVEVKEADDEVEALLREAEEGARA
FT                   RLTLESLKEDPKVRAYRKFMWDMGIDPTKVRPSSEALARRALRGRLPRINSLVDLGNAI
FT                   SLKYLVPIGIYDLDNVVGNMTLRRAERGEPFEPIGSDPFELKGIEIVLADEKGPMHLFP
FT                   YRDSRRTMVTLNTKNALVAGAGVPGVPEEDVEKAVEEIVKFLERRGAEVGEVGRTP"
FT   gene            complement(302944..304341)
FT                   /locus_tag="Igni_0345"
FT   CDS_pept        complement(302944..304341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0345"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81528"
FT                   /db_xref="GOA:A8A9C6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C6"
FT                   /protein_id="ABU81528.1"
FT                   /translation="MKEYDVLIVGAGPAGMFAAHELATLGEGKLRVGIIEKGYFAHQRK
FT                   CPLQEPKVGKCTYCEPCHIIYGVGGAGTLSSGLINLRPDVGGDLHELVGSWEKAWELIE
FT                   YVDQVFLKFGAPPDTLHEPDPEATKEIEKRAAKVGAKFVPIRQRHIGTDNSVKVIDNMT
FT                   KFLQERGVDFIVGTTAIDVDKINSRFVVKTNKGEFTSKLLLLAPGRGGADWFVKVSRKL
FT                   GVELEPGPLDVGVRVEVPAAVMEDVIKVEVDPKIIIYTKTFDDKVRTFCTNHRGFVVKE
FT                   LYDDGTVGVNGHAYLSKKSDNTNFAFLVTINLTDPMEDTIEYGKNIAKLATRLGGGNPL
FT                   VQRLIDLESGRRSTWERIKRGIVRPTLREVTPGDISMAYPYRVITNILEGLKSLDYIIP
FT                   GVFSPHTLLYAPEIKYYSMKARVDRNMETVVDGLYAAGDGAGLSRGINVAAATGVIAGR
FT                   AMAERLL"
FT   gene            complement(304343..305362)
FT                   /locus_tag="Igni_0346"
FT   CDS_pept        complement(304343..305362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0346"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81529"
FT                   /db_xref="GOA:A8A9C7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C7"
FT                   /protein_id="ABU81529.1"
FT                   /translation="MPVRLVVGALFGDEGKGKVAAYLSFVERPEFLVRTGAINAGHTVV
FT                   HMGKEYKLRALPSGTVTCDVCKAAVAPGALISVGVLANEVKELGISKERVFVDENTGII
FT                   EEEHVRREREDAHLRSRIGSTLTGVGAAMSDRVMRRLKLARDFKEEIEKYATVTDVPSL
FT                   LYDAVDSYKVVHVEGTQGFGLSLFHGTYPYVTSRDVTAGALLSETGLAPSDVEDVILVT
FT                   KSFVTRVGEGPLKGELSLEELQRRGMVERGTVTGRPRRAAPLEENLDLLKRAARANGAT
FT                   KIAITKIDVLFPKAKGVTSWSDLPPEARLWISDIEKEVGVPVCYVGTGPEALETVGVC"
FT   gene            complement(305408..306544)
FT                   /locus_tag="Igni_0347"
FT   CDS_pept        complement(305408..306544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0347"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81530"
FT                   /db_xref="GOA:A8A9C8"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023678"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C8"
FT                   /protein_id="ABU81530.1"
FT                   /translation="MDEKIRLIMREPTEEVLTPELLKEYIEQGVPLKHYIGFEISGFVH
FT                   LGTGIVTMRKVADLQRAGVKTTLFLADYHSWINKKLGGDLDTIKRVALGYFKEALLQSL
FT                   KAVGGDPESVEVILASEFFEKLGIKYFENFLRVSNRLTLARVKRSITIMGRKEGESVNF
FT                   GQLVYVPMQVADIFSLGVNLAHGGMDQRKAHVIAIEVGPKEFGYKPVALHHHLLLGLHI
FT                   DEETREKLLKAKREGDREAFEEGIVEIKMSKSVPQSAIFVHDSPEEIKRKLKRAYCPIG
FT                   EVEMNPVLEIVKYVVFPWLEDLGRSFEVVNKKTGERKEYKSYQEVERDFAAKALHPLDL
FT                   KLAVAEYLVEMLKPVREYFVEGPGKKYLEEMKEIQITR"
FT   gene            306631..306993
FT                   /locus_tag="Igni_0348"
FT   CDS_pept        306631..306993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0348"
FT                   /product="Sec-independent protein translocase TatA"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81531"
FT                   /db_xref="GOA:A8A9C9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9C9"
FT                   /protein_id="ABU81531.1"
FT                   /translation="MAGGKRVLPVALFSLGPNEMLILLIFAILLIFGPSKIPELARSIG
FT                   VAVREFKKAAEGEYSEEVEVKKGTSSEGVSDEELKALAKKLGISTEGKSAEELKKEILE
FT                   VAKKEGLTGEKKEEGS"
FT   gene            307034..307714
FT                   /locus_tag="Igni_0349"
FT   CDS_pept        307034..307714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0349"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81532"
FT                   /db_xref="GOA:A8A9D0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D0"
FT                   /protein_id="ABU81532.1"
FT                   /translation="MGKIIYDPSLSERVKVYKDRRHAGRVLGSFMKSHSLIPDLIMAIP
FT                   AGGVPVALEVAKVLGVKMDIIIVKKVLYPWTTEAGFGAVGPLGTVVLGPSPLSEEEVKL
FT                   QLAEALKKVEERERLLRKGKPYPDLTGLTVAVVDDGIAAGYTMLAAVEAVRKMGAREVW
FT                   AAAPTASVDGAERVARKADLVIVPNLRSGPYFAVAEAYEVWYDLDEEEVLQLLEEAKSL
FT                   GLLL"
FT   gene            308325..308603
FT                   /locus_tag="Igni_0350"
FT   CDS_pept        308325..308603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81533"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D1"
FT                   /protein_id="ABU81533.1"
FT                   /translation="MDDCEGPLKALERVYSEVGVVKFNDVDVKLALFVRVLVPGELKGL
FT                   SLEVQGEPQGSASGEEALKPRALLVMLRRYSKVQRNGREAPRFSRVG"
FT   gene            308648..309364
FT                   /locus_tag="Igni_0351"
FT   CDS_pept        308648..309364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0351"
FT                   /product="purine or other phosphorylase, family 1"
FT                   /note="PFAM: purine or other phosphorylase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81534"
FT                   /db_xref="GOA:A8A9D2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D2"
FT                   /protein_id="ABU81534.1"
FT                   /translation="MKPQHLTAKPGEVAEKVVVVGDPARARDVANKFLEDVKLVSENRE
FT                   LLVFTGTYKGSRVSVAVHGIGAPSAAIVIEELAMLGAKEVVRLGTAGSMKKEIDVKDAV
FT                   VVTGAAHYCGGTLGVYAPNVCLPNSPDPWLTVKLYEKAKEVGLRVHYGPVVSNDAFYAE
FT                   SPDFVEFWTKRGVVAVEMECATLFALGWMRGLRTGALVVIADSLVDPNKKDLLHHEELA
FT                   DAMDKAARAVLEALTS"
FT   gene            309361..309966
FT                   /locus_tag="Igni_0352"
FT   CDS_pept        309361..309966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81535"
FT                   /db_xref="GOA:A8A9D3"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D3"
FT                   /protein_id="ABU81535.1"
FT                   /translation="MNFKVYLSIKKLLSEGCSELPAAWAAELKLLDCYEDGGKVCCPSP
FT                   EEVALWAVIRGVMGEHEAASYLNWKAFESYVARALEEAGFETLKNVRVRAGDKLAEFDV
FT                   IGYDGDKVIVVECKRWSAFRRSALLKVAEEHKAKVERAAYWLAKLGKRALPVVVTLRGT
FT                   PIREGALIVPIKSFKGFIEEVDLAFLEGPVVTLSSSRS"
FT   gene            complement(309947..310510)
FT                   /locus_tag="Igni_0353"
FT   CDS_pept        complement(309947..310510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81536"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D4"
FT                   /protein_id="ABU81536.1"
FT                   /translation="MDVWKALEDAKASVNAKVEALERVRERIPFEGAKAVNLANVYTYM
FT                   IDVLERISSILECLGNAKETNAVSVGKNYLRVRDSKWFVEVADGGVVLKRLNPALTITV
FT                   TPESVRIATRTKEDKEIKREAVLTNSEFEIRRDKLEVKGRYADYDQVYENSYYIRKAFR
FT                   ELAREVMKKGEPLIQHMKFMNVSC"
FT   gene            complement(310555..311283)
FT                   /locus_tag="Igni_0354"
FT   CDS_pept        complement(310555..311283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0354"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81537"
FT                   /db_xref="GOA:A8A9D5"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D5"
FT                   /protein_id="ABU81537.1"
FT                   /translation="MIVPERPLLKLEAFHCTVKEKVNRFVVRASVGEEELLVHNTNTGR
FT                   LEDLIWEGNEAYCSPKGGGKLKYKLVAAKTPFGFAVTDTNLQERALERAFELGYLSWAR
FT                   GCEVKRRPRYGSSTFDFELRCPEGRALVEAKSADLASWRGFGMWPDCPTDRGVRHLEEL
FT                   GAFEGRKVVVFVVGFPKASGFVPYCKGDPRVCELLAKLDLELRAVGMYFEPLTSSVVLY
FT                   AELPALLLEGREEPLPKVVA"
FT   gene            complement(311280..311921)
FT                   /locus_tag="Igni_0355"
FT   CDS_pept        complement(311280..311921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0355"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81538"
FT                   /db_xref="GOA:A8A9D6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D6"
FT                   /protein_id="ABU81538.1"
FT                   /translation="MPRLVTIKVDVNQKYLDKAAELRRLYDKYGVKVFEFLGSPGSGKT
FT                   ALIEALVDRLKDKYEILYLGGDVASTLDAERVSRHGVEGVEINTGGICHLEPDHIFEAL
FT                   KDVDLSKYDIMFIENVGNLICPFNFPLGAHKRVMVVSVAEGEDKFVKHPMSTKRSDVIV
FT                   ISKVDMAGPLGVDVEKMVNDAKSLNPRAPVVLVSVKTGEGLEELQRALGL"
FT   gene            complement(312097..312621)
FT                   /locus_tag="Igni_0356"
FT   CDS_pept        complement(312097..312621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81539"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D7"
FT                   /protein_id="ABU81539.1"
FT                   /translation="MRPVYAQGYYFLIPLKNSWRVHEVVNYYYYDEEGEMSELLHKPSE
FT                   YEEEVYRAWEVMQEELEKEEVMINGVKTVPKVNWASLNFLAFAELPYYTFLIEFEGPSR
FT                   EGTNCFENRFEDWVAEYDYEAFWYLPPGYRFSEVQTSCEYEVSEDGRALGIWCRKGEEV
FT                   RGYERICWRST"
FT   gene            complement(312618..312842)
FT                   /locus_tag="Igni_0357"
FT   CDS_pept        complement(312618..312842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81540"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D8"
FT                   /protein_id="ABU81540.1"
FT                   /translation="MLFRLVTSAEREDSLLEALHDLEKEGLLKINDELKITNLGVVEFN
FT                   KTFARLLDEEPEAALSLLRNLYLLRRGSA"
FT   gene            312967..313521
FT                   /locus_tag="Igni_0358"
FT   CDS_pept        312967..313521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0358"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81541"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9D9"
FT                   /protein_id="ABU81541.1"
FT                   /translation="MERYKTIKVDSKFRFKCTRRAFCCRGGPNVSLTVHDLIRIAKFLK
FT                   KDWRELIPTYVKVIVADFVPFLALRGVRGECVFLRKGEEGYECEIYPVRPYRCKLYPII
FT                   PKAIGSEEVYLDLKCPGLWEGPEKGVPKESLERYYKEVKEHYEIIMKYILQGLEPEEAL
FT                   EKAVEELWSRVEPVEDEGLPP"
FT   gene            313518..314198
FT                   /locus_tag="Igni_0359"
FT   CDS_pept        313518..314198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81542"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E0"
FT                   /protein_id="ABU81542.1"
FT                   /translation="MSEEGVATFDWKETLKEYLEGEVFLKDELIKFIDKALNKEFEGVE
FT                   RADILALYLRGFVNVKRYLIHGINMLLNNLELESSREKDEPELLSFVFPHRVPDSCDLR
FT                   LLPLSLSVAVADHSDLCWISSSFTVNKGGVPEETRAFRCLKFLASTYLLVNGVPGIAFK
FT                   KGSDCILLLEFIALRMPQPFMFNASLASAVSARMTEDLKEILEIVDAVIVRKADEGLPP
FT                   EYIK"
FT   gene            314236..314337
FT                   /locus_tag="Igni_R0012"
FT                   /note="tRNA-Pro1"
FT   tRNA            314236..314337
FT                   /locus_tag="Igni_R0012"
FT                   /product="tRNA-Pro"
FT   gene            complement(314316..315068)
FT                   /locus_tag="Igni_0360"
FT   CDS_pept        complement(314316..315068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0360"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81543"
FT                   /db_xref="GOA:A8A9E1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E1"
FT                   /protein_id="ABU81543.1"
FT                   /translation="MSNTKFQKEKIRELIWNTLKPYALPPFPIRGRIPNFKGAREAAER
FT                   LRGLRERASAEVVKANPDSPQRWARLAALEEGKVLIMATPRLREGFLLIDPNEVPREKF
FT                   KEASTIRGAFKWGRKLKTVDDLLNNVKRVDFVVEGSVAVDLEGRRVGKGAGYGDLEFGI
FT                   LTELGLMDVNVPIATTVHDVQVLEGPLPQDPWDVPLTFASTPTRLLKFKPLPRPRGVLW
FT                   EALDERKLEEIPLLKELKGLRGGGAAGI"
FT   gene            315142..315642
FT                   /locus_tag="Igni_0361"
FT   CDS_pept        315142..315642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81544"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E2"
FT                   /protein_id="ABU81544.1"
FT                   /translation="MRACASLESREAPCLEGELKVYDLRKELKEGFWRAALKVYFDEPC
FT                   EALCLGGGPTSIVLFAASMLRRDEACVLLEGQRFNLKGLWTIMQLNEPLRTVALYVVAR
FT                   GEASPKDVVEEIGERIGLTKSQKSLKLAWSYLNELEKKGIVVKVSRGRYSPREELFWCP
FT                   DNQ"
FT   gene            315677..317113
FT                   /locus_tag="Igni_0362"
FT   CDS_pept        315677..317113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0362"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; Prolyl-tRNA synthetase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81545"
FT                   /db_xref="GOA:A8A9E3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9E3"
FT                   /protein_id="ABU81545.1"
FT                   /translation="MKLNKEENFSEWFDTVLRESGLYDYGRYPVKGMGVWPPFGFKLRK
FT                   LVLNIIRDLLDSTGHEEVLFPVLIPKTLLEKESEHIRGFEGEVFWVTKGGHEDLDVPLA
FT                   LRPTSETAISYMESFWISSYKQLPMKLYQIVPVYRYETKATRPLIRLREVSTFKEAHTA
FT                   HESFEGADSQCAEAIEIYKKVFDRLGIPYMISQRPPWDKFAGALYTVAFDTVMPDGRVL
FT                   QIGTVHHLGQNFSVPFEVRFHTEDGDKDYVWQTSYGLSDRVIASLVAVHGDERGLVLPP
FT                   EVAPVQVVIVPIPQKEEEQQRKVLEEAKRVEEELKARGWRTVLDDRDELTPGAKYYEWE
FT                   LKGVPFRIEIGKKEVEGDELTVARRDLKKRVKVKKGEIHQRLKEMSDDMLNNMRERAWS
FT                   FMKSRIKRVRSLEEAKELVEKRYVVELPWCGSKECGLRVDEEVGRVLGVPLDEDAEAKG
FT                   ERCAVCGREAKWWIRVAKTY"
FT   gene            complement(317110..318273)
FT                   /locus_tag="Igni_0363"
FT   CDS_pept        complement(317110..318273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0363"
FT                   /product="protein of unknown function DUF100"
FT                   /note="PFAM: protein of unknown function DUF100"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81546"
FT                   /db_xref="GOA:A8A9E4"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9E4"
FT                   /protein_id="ABU81546.1"
FT                   /translation="MAQKTTISVIKADIGSLAGHHTVHPDCMAAASRVLAEAKKNGVIN
FT                   DFYVTHVGDDLILIMTHTKGVDHPDVHGLAWEAFKKAAEVAKELGLYAAGQDLLSDAFS
FT                   GNVRGLGPAAAEMEIEERPSEPIVIFAADKTEPGAFNLPLYKIFADPFNTAGLVIDPRL
FT                   HDGFVFEVVDVFEDKGVHLNTPEELYDLLALIGTPSRYVIRRVFRKDGKIAAVVSVERL
FT                   NLIAGKYVGKDDPVMIVRAQSGFPAVGEVLEPFTFPHLVAGWMRGSHNGPLMPVPVRDA
FT                   RPTRFDGPPRVIALGFQVKNAKLVGPSDLFDDPAFDEARRTANKVADYIRRHGPFMPHR
FT                   LDPSEMEYTTLPQVLERLKDRFKPVKDLPVPKVKHSEMLSGAEEAHD"
FT   gene            complement(318375..319961)
FT                   /locus_tag="Igni_0364"
FT   CDS_pept        complement(318375..319961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81547"
FT                   /db_xref="GOA:A8A9E5"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E5"
FT                   /protein_id="ABU81547.1"
FT                   /translation="MVVDVLRILMEDAGCERFDVNCINNILELVSENKYPKLDEEEKAA
FT                   LDQSLAEQISKQRLKSQELAEKAERVGLNKTADALRGMGGEEEEEAKPFVEETLEKAPP
FT                   SPPPPPEPEAPPGTPEQGPLGTVAEAPKAPIREVKVVTKTSKAPIVLSIISLALSALAL
FT                   GTLVGLVQGIPINLKLKDVELLKNESSTIMNRLDELERAFEAQIKGLRNQLTQIMKEYK
FT                   SLNENLNKLKDQFNTKIIALNIELNKTKTDLMKTKGEMASLSSAVIEMQRTLDQLKTSL
FT                   EALNQTFAKRASELELKLTSFVPKVETLEKSLNELYKEVKDLEVAQATFATKEDLKILI
FT                   SNVTNLALELGTAREELNAVKKELESLKKVSSYLEELRAKLSEIKKVEEEIANLKSGYA
FT                   RLNATLAQVISNQTSISKELTEIKNNIEKLRLESLKTREILNTTVSRLNSLEDKFEAFK
FT                   SNLTLIMVELLNRPEILEALYNNLIEKYKIDKMVAERLLSNYSVLVMLIRNVVAEELAK
FT                   AAAPGGYVKLG"
FT   gene            complement(319966..320622)
FT                   /locus_tag="Igni_0365"
FT   CDS_pept        complement(319966..320622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81548"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E6"
FT                   /protein_id="ABU81548.1"
FT                   /translation="MSAQIFTRRVGFVKKDGTGCTGARDMWRTINLLGMDVSAAIYVKN
FT                   LSDFTIAIFLDVESPDYMGVVEVQTKLPTPKPLRGPSYLSAIAAEAAKMAINAYENAEV
FT                   ESGGEPKITLEGKTVDLINMCDVRDFQKVPDAIELKTIVNGVEGVCSSPIYVNLEDVLN
FT                   DLPAFAAAAARGSSNALKPMCFTDPFLVAVASSSIGLTVITSGAEEASFQAEFGF"
FT   gene            320726..320995
FT                   /locus_tag="Igni_0366"
FT   CDS_pept        320726..320995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0366"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /note="PFAM: DNA-directed RNA polymerase, M/15 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81549"
FT                   /db_xref="GOA:A8A9E7"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E7"
FT                   /protein_id="ABU81549.1"
FT                   /translation="MSVTFCPKCKALMQVVRKDGKVVLKCPRCGYEVEVKKPARIVRAV
FT                   EKDKHIITTSKVVKAEERRTLTEEEKEMLQDYYRDIFLENFGGE"
FT   gene            321035..321334
FT                   /locus_tag="Igni_0367"
FT   CDS_pept        321035..321334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81550"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E8"
FT                   /protein_id="ABU81550.1"
FT                   /translation="MNPLAALLAFILTVMFLESGHFEILLVLLIAIGALPPEHAAALAR
FT                   RLGKLYYEVNKALDSLTKGGPAEWLGKVGYWRAKRAAGALKGSPYEVLKETKRP"
FT   gene            321331..322596
FT                   /locus_tag="Igni_0368"
FT   CDS_pept        321331..322596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0368"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81551"
FT                   /db_xref="GOA:A8A9E9"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9E9"
FT                   /protein_id="ABU81551.1"
FT                   /translation="MKPLYVHLLRKDTKYSAYSVVAIVESSGFEATLVKDPAQALELAK
FT                   KRPVVFGVSLMTTDLLDENLLRWIKALKGKAFLVAGGPHATGDPWGTLNLGFDAAVHGE
FT                   AEETLPELLRALEEGSDWRRVKGVYSDEGFSGPRGLADLDRYPPWPHWRGLVGPIEITR
FT                   GCPFACSYCQTTFMFKAFVRHRSIENVIKYASIMRDMGLKDMRFITPNALSYGGDGRRP
FT                   NLEAVEELLARLKKLGVRTFFGSFPSEVRPEFVNEESIKILKKYVSNKRLVIGAQSASD
FT                   AVLKRIHRGHAWEDVVNAVEVSVKHGFVPEVDFILGLPGESEEDMMETLRGMRKLASMG
FT                   ARAHLHYFMPLPGTPLAYADPTPLPERVRKEVAKLVGEGKGWGQWLKQEEVSWKIVELR
FT                   RKGVILPKRRALISSPGLPARG"
FT   gene            322627..323802
FT                   /locus_tag="Igni_0369"
FT   CDS_pept        322627..323802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0369"
FT                   /product="GTPase or GTP-binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81552"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F0"
FT                   /protein_id="ABU81552.1"
FT                   /translation="MEGGKYLEVTGPAAVRLVRGSAVLMGKTLEENDVIVVPQWRTYAF
FT                   KAIKDSELDVSITSTTKVEIKDKNVMDEWVKGLSKIVGAKRVVILGPTDSGKSSATATL
FT                   VNMNLNEGYEVSVVDSDVGQSNLCFPTMVCKAKVKGYVFTLSDLEAEEQRFTGTITPAV
FT                   EKSRIISSVSSLSKGRVIVDTDGWVDGFEAGCYKHELLRAVSPEVVVYMGKAPWWAKGP
FT                   WELVELPPSTGKERSRNDRRSIRKNKYRKALEGCKTKDIDLTKVNALMSVIFNNPWGDE
FT                   VLKEGVKELIGVKPLLVVPWGNKVVAVIKRGLKYKKVPNVEVLEEGEERGLLVGLGDGS
FT                   GNERLGVVVKIDHLKKVMKVKTCMEEEPLYVIFGRVKLEEDYSDKVVKKPF"
FT   gene            complement(323799..327824)
FT                   /locus_tag="Igni_0370"
FT   CDS_pept        complement(323799..327824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81553"
FT                   /db_xref="GOA:A8A9F1"
FT                   /db_xref="InterPro:IPR018765"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F1"
FT                   /protein_id="ABU81553.1"
FT                   /translation="MTEVKKGGVAGLIALIVIVSILLAAVVLMVNVLSKQVAISEKTVQ
FT                   AVQRQQLATSVAQSLSACYVFIKKDPWAEGPVLVIKTNDIPAFCQYVKAIQVYMSSGTS
FT                   NVSKIYTKDKWISSNTKVTSACQHNYEPIYKEFGTLKIPAALVINLGEGDKVYSVRMLI
FT                   EGVGWKEVDDCLKTTGGVLQQTTIQQTTTVFSIGPITVLAGGNVNPLQYICPPPKTVVG
FT                   DNYAYQIALILNPEFSGTRNYVPTSVVIDLKDIVEKAAPASSPLRYYLDYVYLRNITVM
FT                   RITSTPQVYQVSWSAGSYLPWSYTFTNLTAEKPLWRSSGVLTFNFTAPAPMRPDSLVQY
FT                   SAVVCLYLGIAGQYPKGSDGTPFDGKILEHEVKFPGLAYPCASFSGYDVCYAPAANLTT
FT                   TYAVNVTTASGLKFLGLQYPVDSTVRSYKITIENPNSEALFDQVIRVKLPAQLNATPIT
FT                   IIDELGAPVKFCYETVVGNCTSVPVQRNGPARSDGYVWVKVPYLPAGGKVTLTVLVGEN
FT                   GASDPREVFPVYVDFYGARVELDSYSWTWNFPGYAFTMTGVVFDDPQNKLNFVANRNSF
FT                   SVVAVVRWDGAFNFADEDQLNYYIDPTWRDDSFFIRAPYVGYWLFPIAYQTDPTTGTGW
FT                   MLAIYRGAPALFQITNYGYRIIPKAVAPTTLVPGKKYMIVATFNNATDKWEVYVKSLET
FT                   LEGSLPPSPVLGDVLSEINQVSSGGGLASLMYELFNGNTPAFVISDASRYYDYNIDEET
FT                   MAAFSGVIYNVTVYGDSFDSLQTAFQCFEAYDAAQCPPVYAYTLEPDAHGLYAYVAGAG
FT                   KEKAKVYMLYWYPYRLGRPRISFPQLYDYSNSDGCLPLVGQINATIVKGLQVVKSTIYG
FT                   APLNGEPGVVTCTPLWKAAETVRAGIINAQRNGIVLNSTWLSQRVVWNFWLWPEVPRGS
FT                   FYEVRVGMNGGSYGDYFGGWNIIYPYVPGAVSDGKSWLKWMLYEDVDDWHRFVTSRNGF
FT                   WSNAWRSYLVEYASEPAYKLSSPDKVYYNVVKYDLSTPAVYFNIHENGPLGELFYYGTL
FT                   DLSAYKLKVEYSQLLPDQVKYIGFSYADRNNATTVSKLGTDDRVYYYMFVRTLPKIPLD
FT                   DYVTVEVPDVYSPKVDAPIVYVKSKGYAVINVTGPYNATLQVDVLGNLTSLQLNEYGSY
FT                   ATTKNPFYNYTDFMTNVTVAAFWNGELAWHNSTSGLPTVFAAKLNLPVSSADKWNAVAF
FT                   NKTAELLSTNVTNYYNNLTLAVSLTDDYLITFNNMTTKVDDVKSFVIGLSNDDYGAVPP
FT                   LIVIMRSYANNTSKNVDAILTWSSLTKPSELNGTSIIMINKANWHVLVNGPYCVKCS"
FT   sig_peptide     complement(327750..327824)
FT                   /locus_tag="Igni_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.875 at
FT                   residue 25"
FT   gene            327949..328521
FT                   /locus_tag="Igni_0371"
FT   CDS_pept        327949..328521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81554"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F2"
FT                   /protein_id="ABU81554.1"
FT                   /translation="MKRAQSELLAAMLLAAIVLGALTWLVAQWEKGVGNLIKRVNEVTV
FT                   RSAKLSIRIDCSGNYLVFLDPTVPSVIDAESTEYNNLRYCYAELGASSYKAYFVLPFYC
FT                   NGEPSAYFIFGTFSRNPVDNVTLYTFKPSSSSAVVPQVACDKINFMPFATLHIVFPDSS
FT                   EKVVSCFTNITLVNGEYLWGVSSCVGA"
FT   sig_peptide     327949..328020
FT                   /locus_tag="Igni_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.411 at
FT                   residue 24"
FT   gene            328506..329006
FT                   /locus_tag="Igni_0372"
FT   CDS_pept        328506..329006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81555"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F3"
FT                   /protein_id="ABU81555.1"
FT                   /translation="MRRGLGALEVAILSAVTVVAAALLGSALLRPPAEPQTPALVEVEA
FT                   AVALGPQKDSAGQTVSASQQCSELASALYAEGLLSSKKIIEIGNSGATYAYAVLIRVMS
FT                   PGEVKGVKLSSLETGQTLFVAQKRVALSPGRYLLCVYRDKYYPSSVVELLGASEVCVSC
FT                   AVR"
FT   sig_peptide     328506..328568
FT                   /locus_tag="Igni_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.602 at
FT                   residue 21"
FT   gene            complement(328987..329595)
FT                   /locus_tag="Igni_0373"
FT   CDS_pept        complement(328987..329595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0373"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81556"
FT                   /db_xref="GOA:A8A9F4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F4"
FT                   /protein_id="ABU81556.1"
FT                   /translation="MRVLRPRSEEDVRRALIEAKEVLESGGLVIIPTETVYGIASKLEF
FT                   AEKIYEAKRRPRDKPLPVQTPLGRHREVGEFDEAAEALAKAFWPGPLTIVVKAKPWLPE
FT                   AVTAGTGKVGVRVPAHPFALKLLELVGPLAVTSANLSGGKSPKSAEEVTVEADLLIDMG
FT                   PVEGTPSTVVEVEGKKVKVLRRGPISEEEIQKVLSALRS"
FT   gene            complement(329592..330527)
FT                   /locus_tag="Igni_0374"
FT   CDS_pept        complement(329592..330527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0374"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="PFAM: Sec-independent periplasmic protein
FT                   translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81557"
FT                   /db_xref="GOA:A8A9F5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F5"
FT                   /protein_id="ABU81557.1"
FT                   /translation="MKSLIKKLKSPFECNVEEAERVEDITYHLEELLKTIRRSIVAFFL
FT                   ALLLVALFPINWVTCPLMHLYCSPEDVGNAVGAQYIAELIKWIGYVPAMVALLRIITLA
FT                   IMHMGVKPVICHAESLFNAYVMVIIWGALVISAPYIIYQFLCYLWPALHEHERRMLRNG
FT                   VLATFGLFLLGELFAFTVVVPFGFELVVFFGQAAGAQSIWCLSDIIEFAVMTAIITGLS
FT                   FLLPIVVYYLVLLGLLRPEQLKGRNLRIAFLAIMFLAAVITPGGTGISMLAIGIPMFVL
FT                   YYLAIIMAERALRERQQKTPSFEFNYKGGS"
FT   gene            330676..331179
FT                   /locus_tag="Igni_0375"
FT   CDS_pept        330676..331179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0375"
FT                   /product="protein of unknown function DUF84"
FT                   /note="PFAM: protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81558"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F6"
FT                   /protein_id="ABU81558.1"
FT                   /translation="MKVVVGSANLVKVRAVKEALEELGIEAEVEALEVPSGVPPLPVGE
FT                   EVFRGAENRASAAAERGDVGVGLESGLFLLNGKLFMISVAAVKAEGLHFGLSPGFELPE
FT                   SWAPKVLKDTSEFYKMMEAYGGRELGKGKGLVGVLTKGVVTRKDFCKMAVIMAFSKAFN
FT                   EVWR"
FT   gene            331246..332289
FT                   /locus_tag="Igni_0376"
FT   CDS_pept        331246..332289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0376"
FT                   /product="putative hydroxymethylglutaryl-CoA synthase"
FT                   /note="TIGRFAM: putative hydroxymethylglutaryl-CoA
FT                   synthase; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81559"
FT                   /db_xref="GOA:A8A9F7"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F7"
FT                   /protein_id="ABU81559.1"
FT                   /translation="MVGIAGWGAYVPLYRVSTEEIALHWGSDPKVPLSLGVKEKSVAGP
FT                   DEDSVTIAWEAAVNALTRAQVDPKDVGMVFIGSESKPYAVKPSSTIIADALGIAPETMA
FT                   VDAEFACRAASEGLRHALVLVSEGAVRHALIIGTDTAQGAPGDVLEYTAASGGAAFVVS
FT                   NENVVANFLDAYTFVTDTPDFWRRDGSQFPAHGEGFTGEPAYFYHLYNAIKELMERNSL
FT                   KPSDVAYFVPHQPNVRFPMKLAKMLGFKREQLMIGLTTADIGNTYNASAFLGMTRVLDN
FT                   ASPGDLVLMAPFGSGAGADAYLFEVTDRVEEAKALAPTTQSYIERRKVIDYATYLRFRN
FT                   KIKKLAR"
FT   gene            332295..333356
FT                   /locus_tag="Igni_0377"
FT   CDS_pept        332295..333356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0377"
FT                   /product="Acetyl-CoA acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81560"
FT                   /db_xref="GOA:A8A9F8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F8"
FT                   /protein_id="ABU81560.1"
FT                   /translation="MYVCSANVVKVDRHYDKSSSALAVEALAPVVEACGEPDALVVSTY
FT                   LSRYQESFGNLGALLAEYLGFKGEVYEVSAGEASGGAAVALAYKLVRSGLKRVLVVGVD
FT                   KTNDFQSKKAVKHLQTLLSPYESFYGLTYAGAHALAASLYMKEFNVSREELAHWAVVMH
FT                   DNATAVPHAQLRFPVTVEKVLNSNSVAEPLKLLDSHPFSDGAAAVMLTSETSPVALEVA
FT                   AASSKLTLAERDLTFMESAKAAMEALGNPEPEAVEVHDPFSVAGVIALESLGLAPRGKG
FT                   IKYLLENAHSVNPSGGLKARGHPVGATGVYQVAEGFLAITSGLGKLGKVSSFLAHSSNL
FT                   MGATTYLTYMREV"
FT   gene            333360..333755
FT                   /locus_tag="Igni_0378"
FT   CDS_pept        333360..333755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0378"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81561"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9F9"
FT                   /protein_id="ABU81561.1"
FT                   /translation="MEISPAAVWREKPYRYRLEVRRCPSCKRVFREEVTHCPRCGVETV
FT                   RERLPWRGKLLAWTKICQVPEGFEDQAPLYVGLVELENGERVVARLTDVMEEPKEGSEV
FT                   QAVLRKVRADGETGLIEYALFFRVIPK"
FT   gene            complement(333742..335166)
FT                   /locus_tag="Igni_0379"
FT   CDS_pept        complement(333742..335166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0379"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81562"
FT                   /db_xref="GOA:A8A9G0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G0"
FT                   /protein_id="ABU81562.1"
FT                   /translation="MYHDPGKPVHKIIEERARESPDKVALVYEDGTELTYKDLISKAKA
FT                   VANLLYENKVRKCDTVFLIMFNRPEFVTSLLGALYAGARVVIVDALTQKEDLAFQLNDS
FT                   APKVVLADEEVLQRESETLKGYAVLTEKDLSSASGEHEVVVGYEDDARVFYYAGIAGRT
FT                   MQVIHSHRSFTGAIMPLVQAEGINANDVSLVTVPLTHVLGLDAALLSALVSGATALLLK
FT                   KFNMDKIKEMVARRSPTYLVAVPLVFQTLMKEDEEFVKSLGQSLRWAMSGGAYLPPDDQ
FT                   RRWEELTGKPLLQVYGMTEAPQIFATTPEKHKIGSLGFPLPGVEALLVNPETLEPVEDQ
FT                   GELLVRGPQVMKCYPDPEENSKAFVEVNGKVWMRTGDILAKDEEGFYYFRGVRKRMLKY
FT                   KGYPIFPKDLELILLKHPCVAEAEVVGEPAGEVGQIPVAKVKLKEGCKATPEEIMDFVN
FT                   KRVAAYKKVRKVIILE"
FT   gene            complement(335205..335582)
FT                   /locus_tag="Igni_0380"
FT   CDS_pept        complement(335205..335582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81563"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G1"
FT                   /protein_id="ABU81563.1"
FT                   /translation="MERVELGQKAVEELTEALKGKKVFLAFIDGETFRNVVPLYLGEVG
FT                   EVKEGEGSLEVEGSEGKFKAFGVGNKTLIVVKGKEANEIAIVDVPIDELKSFLTEEEGY
FT                   EADESLLEGAEEEGEEEWEPE"
FT   gene            complement(335616..336473)
FT                   /locus_tag="Igni_0381"
FT   CDS_pept        complement(335616..336473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0381"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81564"
FT                   /db_xref="GOA:A8A9G2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G2"
FT                   /protein_id="ABU81564.1"
FT                   /translation="MIEALVPLIPQFLWATNFVVSKVVISKGLHAMTLTALRWAIAGAL
FT                   LYAYSRLKGLRVVLSKELLLPSLTGITGFSALTYLGLTYAKASVVGLTMALIPIFTSVL
FT                   AAAFLKERLTPLLIASVAAGSTGVTLLTLDSSGLSWLGALLGSLAALDWAVYTVASKKA
FT                   MRELSPIESLTSNALMAQPFNFLLALPFFSLAPMADPEVLAGLLYVSLVPGFLAYFLWL
FT                   YSVNLVGAARAGVYINALPLLTLALASASLGEALSGPQLAGAALILLALALVTLDYLKR
FT                   LSTS"
FT   gene            complement(336507..336827)
FT                   /locus_tag="Igni_0382"
FT   CDS_pept        complement(336507..336827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0382"
FT                   /product="Protein of unknown function DUF424"
FT                   /note="PFAM: Protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81565"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G3"
FT                   /protein_id="ABU81565.1"
FT                   /translation="MDALEERLFWVKVHEVEGHVIVAVVDEELMGKEFKEGEKVLKVDE
FT                   YFFKGELVDEDVALARMSAATSLYVIGERSVRLAVEGGFVHPKAVGKVAGVPYAQMILV
FT                   TA"
FT   gene            complement(336829..337755)
FT                   /locus_tag="Igni_0383"
FT   CDS_pept        complement(336829..337755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0383"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81566"
FT                   /db_xref="GOA:A8A9G4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G4"
FT                   /protein_id="ABU81566.1"
FT                   /translation="MYRALVTDKVHPAGLELLREKGIEVVEDLEAYKPEVLKERIKGFD
FT                   VLIVRSRTKVRREVIEAADKLKVIARAGSGLDNIDLEAAKEKGIKVVNAPDALKNAVAE
FT                   LVIGMMVVLARRAHYSYRKLLEGEWEKVMGFELAGKTLGVVGFGRIGREVAKKAKALGM
FT                   NVIAYDVVDLSETAKEMGVEFTQDLEELLRKSDVVSLHVPLTEQTRNMINRDRIKIMKD
FT                   GAILINAARGEVADYSALLEALESGKLWGVGLDVYPEEPPKSEELLKLIRHPRTFATAH
FT                   IGAQTEEAQRRTSLEVAQRILEALGLQ"
FT   gene            complement(337790..339004)
FT                   /locus_tag="Igni_0384"
FT   CDS_pept        complement(337790..339004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0384"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81567"
FT                   /db_xref="GOA:A8A9G5"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G5"
FT                   /protein_id="ABU81567.1"
FT                   /translation="MKGPARASGRGSLLKFVPPEEVKNVRGSLDLWEYVEKVMPVVKEV
FT                   KARGLEAVKKYNKAFDNYEGCVSLSQEDFASYSKESLVSLFEEVLEQLSAFHKQTAPKD
FT                   SAFSSKGVRAVTLWRPVERLGAYVPGGLYPYPSTALMTAGVAKALGVKEVTVATPPKFA
FT                   TSEVMASAFLASKVDSVLAAGGAHGVSALAYVAGAHKVVGPGGPYVQAAKLLVSVDVPI
FT                   DMIAGPTELAVIADSSADPEEVAYDMLAQAEHGPTSFALLVSTDEGLVLEVEKRVKGEE
FT                   VEGGLYATVVRDLEEAKRLVSELAPEHVSVYAETYEPPVAGAASFKAPSPFLDYSAGPN
FT                   HVLPTSGWAKARGPLGPVDFMRWTTLVEVFPEAADLLKLAAELARLEGMKYHAKAIEYK
FT                   LSKIL"
FT   gene            complement(339020..339571)
FT                   /locus_tag="Igni_0385"
FT   CDS_pept        complement(339020..339571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81568"
FT                   /db_xref="GOA:A8A9G6"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G6"
FT                   /protein_id="ABU81568.1"
FT                   /translation="MLLRPSESLRLAEELGLPVPPWGEGVEPPAYVKADVPLPHKTEAK
FT                   AVIYVETKEELERAREELEERFGSAIVQKAVRGDLELLVSSKRDPVFGKVLVVAAGGVL
FT                   ASLLKESLVTLCPLCVVVFEKKLNRSKLGEALKSRKKLDLNCVENVLVKLCASEYKVFE
FT                   VNPLIVSERGCWAVDVKVWV"
FT   gene            complement(339562..340929)
FT                   /locus_tag="Igni_0386"
FT   CDS_pept        complement(339562..340929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0386"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81569"
FT                   /db_xref="GOA:A8A9G7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G7"
FT                   /protein_id="ABU81569.1"
FT                   /translation="MDFLFKPSSVAVVGATPKVPKPGYVILSNMKRSYKGKLYAVNPKY
FT                   KEVLGVPCYPSLREVPDEVELAVVAVPTSAVEAVVDDAIEKDVRALIIITSGFSEVGNE
FT                   ELENRIKEKALSHGIRVVGPNCLGIYYYPSGLDTFFFREAGTPRPRPSGLALVSQSGAL
FT                   AASLMDWAASRGCGVGAAVSLGNKVDVGESEVLNYLFGEGFNHFLMYIEGLREGEGKAF
FT                   LETVLKLRLGGARIGFYKGGRKRESAAAVASHTASVAGDYKAYRDLLFEFGATPLYDFA
FT                   EVKAFVSALQYSPELRGDKLLIVTDAGGIGIMLTDLIEGYKMPRPVDGELERELPSYLR
FT                   LNNPLDVGGDADDERYRKALERLAPKYDLIIVAALMESPATSLYLADIVKESMERTGKP
FT                   HLLLGFGGTMAEALERRARELEIPFAFGVDEAVAYARVLLRDKFARELAEARKSCC"
FT   gene            340953..341243
FT                   /locus_tag="Igni_0387"
FT   CDS_pept        340953..341243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0387"
FT                   /product="LSU ribosomal protein L13E"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81570"
FT                   /db_xref="GOA:A8A9G8"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G8"
FT                   /protein_id="ABU81570.1"
FT                   /translation="MEAVSVILTSLGGALRGREVEERPVAYVLTPVLRKDAGKKPKMRR
FT                   GRGFSKGELEAVGLDFKKALKMGIPIDKRRKTVHEWNVEALKKWLSQKGGE"
FT   gene            341338..341931
FT                   /locus_tag="Igni_0388"
FT   CDS_pept        341338..341931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0388"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81571"
FT                   /db_xref="GOA:A8A9G9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9G9"
FT                   /protein_id="ABU81571.1"
FT                   /translation="MRLALAITGASGLPIAFELLDSLKGFEVDVVVTPGALEVAKLEPC
FT                   TLEDEGCDLIKELAKRRVRIHTNMRSPLASSSRAPDAAVCAPCSMKTVASVAYGIGDTL
FT                   ASRLLLNMLRLRRKVVVVPRETPVGAIELEAMRRVAEAGAAVVLPVLAFYNRPKSLRDA
FT                   VRFVVGKVLDALGVENELYGRYLAGELDDRHAPD"
FT   gene            complement(341893..342774)
FT                   /locus_tag="Igni_0389"
FT   CDS_pept        complement(341893..342774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81572"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H0"
FT                   /protein_id="ABU81572.1"
FT                   /translation="MFVGGEPHKLALRELEDALKLKDPGACLMALVTSPSNSASLDTVY
FT                   VPTKLTKAVLELKNEGCNNLYVLIYAFGGSIYFPEIFEKVVRGIGIDEIAFIVPTRSGA
FT                   NASLLILSNYNKLYVNSWTIMDPFNITISVPPAAPKDISLFLGISEYLMSLVKGEKKDL
FT                   ASQISGQALSIMASHGILYEYIEAERLLNYLDTIIENKIKPKLKVSLQEFKDSFVGTEE
FT                   RPPVSLSGLEVAEMFKDVVVMDREEAEIGRLSNNLENLLMEMVESRGAGGVLLTRKREV
FT                   LIGGVPVIQLPS"
FT   gene            342828..343901
FT                   /locus_tag="Igni_0390"
FT   CDS_pept        342828..343901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81573"
FT                   /db_xref="GOA:A8A9H1"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H1"
FT                   /protein_id="ABU81573.1"
FT                   /translation="MVGLELEALAVEPEPMDRERWLKLLGEVDGEELKDPCTGQVIGKR
FT                   TNEFVVKTDTTSAIIEISVEPGPKAISKAFQALELLGVRPYARAYYPPPGRRWYLKNAT
FT                   PRGHYRLLHWYGYSHWEIATMASSQVWLDVSKEELPRVLDAINKASPWLLKKYSNSPFA
FT                   GWKEYRVRAWQLFSERSWASAPYPWAPKPFSGWADVLEDLTSGAPQEAEPCLDLSLNAW
FT                   EELAEAFAKGKVLARRADMGLAYATPQGVLKGMQRWTFRPAIARWRPKPSPRPEALKGA
FT                   LEGNPKPFLDSLEKVMVEVRLLPYLPQERLEEAVEDLLKLARAEPPEVGWAELREAYVR
FT                   AAMGKRLPEWASWPEGV"
FT   gene            complement(343917..345161)
FT                   /locus_tag="Igni_0391"
FT   CDS_pept        complement(343917..345161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0391"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81574"
FT                   /db_xref="GOA:A8A9H2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H2"
FT                   /protein_id="ABU81574.1"
FT                   /translation="MWTKLVALSAIISITFSASNVALPYFLMYLKGELKTLNAELLNAS
FT                   KVALEFGALTSTFMGTRVVIAFLSGYIAERIGMKRSVVVGLILYLVSGIWLIVTENYWE
FT                   VLVSRALQGVASAMVWPVAESMIVEFAGGKKTRALMLYVMAFNVGMILGPAVGGAALQA
FT                   SSSLPLPVAVRVPFALLPLGALAGLLLIFKLPDVRYKTKMKVRELHAKIKSALYVFFFN
FT                   AFANGFSAGIFMSVLIIYIMQYVTSVPIKLSSLVALSGLLGMALASPLMKRLDEFDFTN
FT                   KLKVAIGLGLLHKLALAAVGLTKSYFILLAILTVQNFAITVVIPLIRSLVSDLVPRELT
FT                   AKVFGMQQAYFNLGMIVGPLVGAALYKWLEASGVGGGLAFPVAAALGAAGVLTLLRVDG
FT                   REVEGMKGEPVKAEG"
FT   sig_peptide     complement(345099..345161)
FT                   /locus_tag="Igni_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.396 at
FT                   residue 21"
FT   gene            345247..346038
FT                   /locus_tag="Igni_0392"
FT   CDS_pept        345247..346038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0392"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81575"
FT                   /db_xref="GOA:A8A9H3"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9H3"
FT                   /protein_id="ABU81575.1"
FT                   /translation="MKKVTIRDIMKKYKNGEKIVMVTAYDYPFAKLVDEAGVDMILVGD
FT                   SLGMVVLGYPSTNQVTMKDMLHHVAAVARANPKAMIVGDMPFGSYEVSEEEAVRNAVEL
FT                   VRAGAEAVKLEGGKEVADKVEAIVKAGIPVMGHLGLTPQKRHALGGYRLRGKTEEEARE
FT                   LLEDAKALEEAGVFSIVLEFVKAEVAKKITEEVGVPTICIGAGPWCSGQVLVIHDILGL
FT                   APFSPPFAKKYFDCGKAIVEAVKKFAEEVRSGEFPGEGYYW"
FT   gene            346096..347550
FT                   /locus_tag="Igni_0393"
FT   CDS_pept        346096..347550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0393"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81576"
FT                   /db_xref="GOA:A8A9H4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H4"
FT                   /protein_id="ABU81576.1"
FT                   /translation="MSANIPLKRVGTYEWMIEKGVKPCMKVPAIIFADEYLLEKMKSDR
FT                   TLDQAANVACLPGIQRASYVMPDGHQGYGFPIGGVAATDPEEGGVISPGGVGYDINCGV
FT                   RLIRTNLDEKDVRPKLKDLVYTLFRNVPSGLGSTGKVRLSVSELDKVLEEGVYWAVERG
FT                   YGWSDDPEHIEEHGRMKYADASKVSMRAKQRGAPQLGTLGSGNHFLEVQVVDKIYDERA
FT                   AKAMGITHEGQVMVMVHTGSRGLGHQVASDYLIKMERAMKKYGIVVPDRELASVPFNSP
FT                   EAQDYFKAMSAAANYAWTNRQLITHWTRESFKEVFKTDPENLDMHIVYDVAHNIAKIEE
FT                   HDVDGKRKKLVVHRKGATRAFPPGHPEIPQDYQSIGQPVLIPGSMGTASYVLVGVPTGA
FT                   RVWYSTCHGAGRWLSRAAAVRQYRPREVIEQLSRQGVVLKAAQARVVAEEAPGAYKDVD
FT                   RVVRVVHEVGISKLVARLRPIGVVKG"
FT   gene            complement(347540..349012)
FT                   /locus_tag="Igni_0394"
FT   CDS_pept        complement(347540..349012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0394"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81577"
FT                   /db_xref="GOA:A8A9H5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H5"
FT                   /protein_id="ABU81577.1"
FT                   /translation="MEAEVIISMIGLTLLLAKAAEELTLKLGLPSLLGPLSLGLLGSQL
FT                   TQLKEEYRYAPLLFVVGLNFTAFLLGSEELGKLIREVKGRHVIKGTIFFLVPFAISFAL
FT                   LQTSLDFKSSILLATIFSMPSTLRAYTLLKHVELENFEEVLTILSVSEITAVTIIFLLS
FT                   LKNVLMLIIVSIGLIITIRYGTVVFRKVLEAEEQFLAKELPLTLIISMVLTLGYASESF
FT                   GLNSAVVSLLLGVLASEYLAERPWLTSKLKTINHSLFEPLFFVGSGALVNFATVTYPTL
FT                   LLLITTNFIVALVKTMMIKWWSGWRWRYSALTSVKGGIDTALLASQYKVNGISLDLYSS
FT                   SITVVTLNTLTFGSLAVTRKRGRKVALRFCDLKLVRAAVELSEPLTSALKMFEEGIEAV
FT                   VVVDAANWPVGYLSAADVLHLKDKADKVRVYEVYREGVPVFDCEDRLTKAMVLEEEIDE
FT                   YPVIAVVKGSFGYFGSVQTRAVLKKLAEAVSP"
FT   gene            349120..349650
FT                   /locus_tag="Igni_0395"
FT   CDS_pept        349120..349650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0395"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81578"
FT                   /db_xref="GOA:A8A9H6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H6"
FT                   /protein_id="ABU81578.1"
FT                   /translation="MRAVILVGPMVDEYEVVVPYSLFKAYGFEVDIASFKAGEEVVGKR
FT                   GVKLELVPNKSFSELKADEYDAVIIAGGYAPDKVRRDENVKRFVREMYEKGKLVLSICH
FT                   GGWVLISAGVAKGKKVTGSKGIWDDLRNAGAEPVDEPLVIDGNVVSVKTWREFDHLIKN
FT                   FDKVLKAIKGTSG"
FT   gene            complement(349631..350038)
FT                   /locus_tag="Igni_0396"
FT   CDS_pept        complement(349631..350038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0396"
FT                   /product="Ser-tRNA(Thr) hydrolase"
FT                   /note="PFAM: Threonyl-tRNA synthetase, editing region,
FT                   archaea"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81579"
FT                   /db_xref="GOA:A8A9H7"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H7"
FT                   /protein_id="ABU81579.1"
FT                   /translation="MKALFIHAKKFCFKPTKKALKSAEELSSKEEVCRENPLVIFLTVE
FT                   KGDTEELLEKLLEDVRVQFQRVKPSGLVLYPYAHLSNELAPPGEARELLRRACERLGEE
FT                   FEVVCAPFGWYKEFLLHAHGHPLAELSRRYP"
FT   gene            350168..351349
FT                   /locus_tag="Igni_0397"
FT   CDS_pept        350168..351349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0397"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81580"
FT                   /db_xref="GOA:A8A9H8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H8"
FT                   /protein_id="ABU81580.1"
FT                   /translation="MVFWETTKACKLVCKHCRAEAIEEPLPDELTHEESLALIDQITEF
FT                   GRPYPHLIMTGGDVLMRKDFWDLARYSISKGIRTLVAPSVTPLLTEEKIKKMKEIGIIG
FT                   MSLSLDGARAETHDSIRGINGIFERTVELMNFVKKDVGMFLQINTAVMRDNVEELPEVF
FT                   KLITDAGVDAWEVFYLILTGRASKDLDLTKDEYWDVSNFLYDASKYGKTTIRTTEGPFF
FT                   RVVYRLRTVLDEMGKGPEELGVGELYYKLRERLEELMGPVPHGPPKQKRAPSAYTRDGY
FT                   GIIFVAYNGDVYPSGFLPYKVGNVREASLKEIYQNSKALKMIRDPSNFRPPCGTCKFNF
FT                   MCGGSRARAYSYFKDPFGHDPACKLPEVLESLDPQVVEEALRPFGRAKSFTNV"
FT   gene            351364..352503
FT                   /locus_tag="Igni_0398"
FT   CDS_pept        351364..352503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0398"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81581"
FT                   /db_xref="GOA:A8A9H9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9H9"
FT                   /protein_id="ABU81581.1"
FT                   /translation="MKVLKFSKLYVGDGSVLKDVYVGFEGEEITYVGGERPEGELLGEF
FT                   PVGTPALVDPHSHIGMDRAGEPYYEEEANETMDSLLPYLEAQNSVYMDDKAFEESVEWG
FT                   VLYSAVTHGSGNIIGGKVALLRNWKKNVRDAFIKHVGVKAALGYNPRSTTSWRGTRPST
FT                   RMGVIALFKKAFDKAAADLEDLRKGKKEWKDLEPTSKALVPVLEGRLPLRVHVHKEDDI
FT                   AVLISLAKTYGFKYTIDHACDVHTEEGFKMIKESGASLVYGPVDSHPYKVELKHESYKN
FT                   IKLLIKYMPEVTALMSDHPVVLQRNLMLQLRYFMMYGMPFEEAIKLVTGNAAKVVGLNA
FT                   GEVKVGKLVSLVAWNGEPYVLGSAPELVVAEGEVLEVRR"
FT   gene            complement(352527..352603)
FT                   /locus_tag="Igni_R0013"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(352527..352603)
FT                   /locus_tag="Igni_R0013"
FT                   /product="tRNA-Ala"
FT   gene            complement(352643..353479)
FT                   /locus_tag="Igni_0399"
FT   CDS_pept        complement(352643..353479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0399"
FT                   /product="Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase-like protein"
FT                   /note="involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81582"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I0"
FT                   /protein_id="ABU81582.1"
FT                   /translation="MRAVVLAGGNRVKRFKTYFLGKMVVEYPLKALEKVYDVALLTSGW
FT                   TLDGYETVVQRTPGVLGAIRDAAEELGLPLLVSYGDVVAEEGFYTSLDSPCSVAAVASV
FT                   PSSRHGKIGGPQSSYVFGGLLSLDEECFEKIMEIGDLAGALNELINSGIMSVKRFDGVW
FT                   HDVDEPSDVLKMFEDFFRYLSSGYSKVAIDLEGVHLKGPVIVEPGATVEPGATLIGPAF
FT                   VGSGAFVESQAVVKRSSVEPGATVESFAYVRGSSVQPGAVAESYKKYVGAVVEKNL"
FT   gene            complement(353476..354813)
FT                   /locus_tag="Igni_0400"
FT   CDS_pept        complement(353476..354813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0400"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81583"
FT                   /db_xref="GOA:A8A9I1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I1"
FT                   /protein_id="ABU81583.1"
FT                   /translation="MHVCPFQWRYGSEEMRKIMSQEERLKKMALVEYALLKALKEVGEV
FT                   PEEVDPEEVLRAAEEVTVEEVEELERELGHDVMAFLEALRRRTKTAGKYLHLGATSYDV
FT                   VDTAWALIIRDALAKVYKDLKEIIKKFLEISEEYADLPMVGRTHGQWAVPITLGFKFAN
FT                   YAYELARSYERLKEAERRVVRLKMSGAVGTMAAWGEKAFEVERLVSEELKLPPHPITTQ
FT                   VAPRDGFAELLADLAILSSVLDRFALEVRELSRPEIRELVEGVRRGQVGSSTMPHKANP
FT                   VTSEKISGLAKVMRSLVLGELENVPLWHERDLTNSASERVLIPHAFLTVDEQLKSTKSL
FT                   LNKLIINEEAIRKHLEEAGCEVLAERVMIYLTKEKGLARNDAHKVVMDAIRVHGSLRRA
FT                   LEEGHELSKYLTSEELEALCDPSSYLGKARELIARTAKYVEEVVGL"
FT   gene            354883..355191
FT                   /locus_tag="Igni_0401"
FT   CDS_pept        354883..355191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0401"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81584"
FT                   /db_xref="GOA:A8A9I2"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I2"
FT                   /protein_id="ABU81584.1"
FT                   /translation="MIVILTTFGNEEDAKKVARTLVEEGLVACAWVTQKVRSFYVWKGK
FT                   LEEDEEVVVVLKAPKKTFEKAVKRLRELHPYEVPEIIAFEANYVLPEYLKWAEEVCG"
FT   gene            355182..355469
FT                   /locus_tag="Igni_0402"
FT   CDS_pept        355182..355469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0402"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81585"
FT                   /db_xref="GOA:A8A9I3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I3"
FT                   /protein_id="ABU81585.1"
FT                   /translation="MRLRFDARKGAELAKVKLSEEELQRLQKDLDEMAEMLSVLLDLDL
FT                   EDVEPMYTPSEALNAARPDEPGETLGDSWMYLVPRKEEQGDKKFVKAPRP"
FT   gene            355466..356566
FT                   /locus_tag="Igni_0403"
FT   CDS_pept        355466..356566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81586"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I4"
FT                   /protein_id="ABU81586.1"
FT                   /translation="MTDIFVDIFFKKVEGLKPPRGDPPEPLPLSELPEPEDGEVVGVDG
FT                   GGGGARLGGLNFLVARAVAVGEGYLDKDLEVEALQWDSSAALEAMRSSMELKLASRSPR
FT                   TTFVDGSAYTELVKWVARVVRVARGTAKLSEIVALPKTLEALYYWQELAKREDVAFVSK
FT                   HPMVKTFREYLEVKKRGGKVFEKYVRGKLTTKELKELIKKPVVPDAESLRGEGVTFGLA
FT                   LGLPEGARNLLLPRRWKAIMEMALENYRLYVGEEPEAKLPEDLCFSKAPVAWWASYGRW
FT                   KVLVEEFSGKPLCLSRYREEVSERPKNLGALLAGSGSTYNAWLALAHGLSTLKGEQLME
FT                   YIKIIGVKLGISVDEVREDLIYLMRG"
FT   gene            356582..356824
FT                   /locus_tag="Igni_0404"
FT   CDS_pept        356582..356824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81587"
FT                   /db_xref="GOA:A8A9I5"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I5"
FT                   /protein_id="ABU81587.1"
FT                   /translation="MLNAHFQDYIIVTNPGDVINPYQTLATQGILTPLQNLIQNTIANY
FT                   TPEYIVPATIMYVVIAMFILALFLYIVTRIVSPLV"
FT   gene            complement(357054..357575)
FT                   /locus_tag="Igni_0405"
FT   CDS_pept        complement(357054..357575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81588"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I6"
FT                   /protein_id="ABU81588.1"
FT                   /translation="MKARKRLYEVGEVEVDGVKLPVLILKKSETVEVNVKKKDSADALS
FT                   TALMKDLIELEEKGVEGVYVEYVATSGKLEIRVGGGRGLKGELSKWPTKLKRVAVMRES
FT                   PKEVDLNSLKWHEVSGEVYVYEGKPKGQFKALLLDTEDGAYLILSDEALEEEVKEWEFE
FT                   DEGAEEGEED"
FT   gene            357633..358754
FT                   /locus_tag="Igni_0406"
FT   CDS_pept        357633..358754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0406"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81589"
FT                   /db_xref="GOA:A8A9I7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I7"
FT                   /protein_id="ABU81589.1"
FT                   /translation="MSFEDLTAESTLKFVSKAKSMAREIRANLGLGEPDKRPPRKLVEL
FT                   LQEASRVKPTYSPPVGLPEAREAVAEWLSGRYGLDISPKEVMITPSGKAALFLALGYAS
FT                   TRYSSSLLFDPTYYSYEPVLRAFGVKVKKVKMLRDENSYVFPEVELGKEIVVLNSPSNP
FT                   TGAVLGARTLEYVDEALRTGALIVSDEVYDVFVYGRRHVSVLEHERWRDAAIFIYSFSK
FT                   VLCVPGWRLGAVVAREEVIEKLAAAASNVYGCACKWEQIALAEYLKNYKNDLENHIKNM
FT                   VEDYSRRREFLLKELKEVASFPGVGEGTFYAFPEFPKDADELALELAKRGVIAVPGTVF
FT                   SEAFGKRSLRLSFSAPLEELRVGLETIKEVLGS"
FT   gene            358802..359692
FT                   /locus_tag="Igni_0407"
FT   CDS_pept        358802..359692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0407"
FT                   /product="glutamate synthase (NADPH) GltB1 subunit"
FT                   /note="PFAM: glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81590"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I8"
FT                   /protein_id="ABU81590.1"
FT                   /translation="MCGIAGIMFSDGKKEVGEQLYEMLKSLQHRGMDSAGVIVYDDKPG
FT                   DWLVRVVAEDGEEALSKIKYRLNVSKYEKPKKLNDGTYLIEFTVPRSVKLEEIREVIRK
FT                   LKYPILSLGRYSVISKDVGLVDDVNRVYGFKEQLGTHGIGHVRFSTESAVDAIHAHPFQ
FT                   TPEFPDIAIVHNGQITNYWKMRELLELEGHVFQTDNDSELIIHYIVNKLRKGYELEEAL
FT                   KSAVNDLDGPFAFLLSMPEGIGMARDRLGLRPLVVAEGDGVLAAASEEVAIRKILPESK
FT                   IYYMRPGEVRVWMRQ"
FT   gene            359677..361830
FT                   /locus_tag="Igni_0408"
FT   CDS_pept        359677..361830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0408"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81591"
FT                   /db_xref="GOA:A8A9I9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9I9"
FT                   /protein_id="ABU81591.1"
FT                   /translation="MDEAIIDASALTPREINKKLREYAKQYKRIIIRNPNAKHYIAAGL
FT                   TADVEVVVEGSAGYFLGTMIHGPKLLLLGNAGWYAGDNMTMGEVVIEGHAGNGAGQYMY
FT                   GGTVVVKGDVGDRSGALMKGGRVLVAGDAGLMTGLYMMGGEMVVLGDINDYAGEMIIRG
FT                   KIFVGGSPKSLGKNAKIEEAPQEEVERVNELLRKYGLPTKDSFYVITPKSLRPVYKASG
FT                   GVPAMKNLMPKYRVEFKYDICIGCGTCAMVCPENVIKMKGYKPVAAREADCIGCYACVN
FT                   YCPTDAVKVERVAESLTNRARIDASTFNYIRKMASLGHPPVVGMGAENKYFPSLDQLTF
FT                   IPGQTSRPPIDSYREPCDTEVVLGDRFAERPLKLKAPILIGAMSFGSVSKEVKVALAKA
FT                   AGRLGIAANTGEGGMLPEERKYASVLIVQYASGRFGVSASYLRAGDAVEIKIGQGAKPG
FT                   MGGLLLGEKVTEDIAKMRGIPVGADAISPARHLDIVGPEDLKMKIEQLREITDWKVPII
FT                   VKYAAGRVADDVKIAAKAGADIIVIDGKPSGTGATPYIVTEHTGYATMAATVEAHRALK
FT                   EIGMRDEVSLVVGGGIKTGADAAKVLALGADAVMIASSTLVPIGCTYCGTCHNGKCPYG
FT                   IATQRPELRRRINVELAAKRIENYLRAFIEEMCMFAQLAGKSKLSNLEKEDLRALTFEA
FT                   SLLTGVKLMGVERPASELLREDI"
FT   gene            complement(361781..362818)
FT                   /locus_tag="Igni_0409"
FT   CDS_pept        complement(361781..362818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81592"
FT                   /db_xref="GOA:A8A9J0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J0"
FT                   /protein_id="ABU81592.1"
FT                   /translation="MRKRLLLLGIALLSLGYGYYTTAARVSGDVSEAGAVAVAELASAA
FT                   SATFFGWLADKKGMRKASLAAPLAGPLSALGLDPLSVFLTLSFFYSAFVVALLAANEAG
FT                   PEELGASVGALSLGWGAGVALVPYFRGPQVPAASFFAGSLAVVAAVPDVPGRANFLAAV
FT                   PKLKRLVPPLAAFMGAEYLSYALTAWRFYELADPTTFVLSYAVGPGVTAFLGGLVAGRA
FT                   LERFGPERVLLGSLLAYPFVVALALLAPPPACFFAWSVPVYPFYEAGLVATVTKFVPEA
FT                   KGASLGLTYTTMALSSFLMAPLTRFKDVKVIATISITLMLISTIIIKRIICPPSRARRR
FT                   ASPRP"
FT   sig_peptide     complement(362738..362818)
FT                   /locus_tag="Igni_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.297 at
FT                   residue 27"
FT   gene            363308..364246
FT                   /locus_tag="Igni_0410"
FT   CDS_pept        363308..364246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0410"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81593"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J1"
FT                   /protein_id="ABU81593.1"
FT                   /translation="MYALPNTDAEKVRAGGLEVLKLDADPVSKRENYIKSYLIVGPEAR
FT                   VLVETGPRNAFEVLKDSLESKGFSLRELDAVLLTHIHLDHAGGLGEVLKECNCKAYVHP
FT                   KGLRHLVDPSKLNEAAARTLGKEIFEAYGPATPVEESKLVATEEGALKVGEVEVRVVHT
FT                   PGHAPHHQAFLVNGLLFPGDALGEVTTWKGAYTPTTPHRTIVSMMIDSINKLMELEPWA
FT                   AAYTHRGFVVGKDNILLQMAGEVEQLRTWLQTIMIRKDECKEDVWCYLRHLKVADPLLE
FT                   ALEDELERSSLLKNSVRMSIDGIYRYVLKVS"
FT   gene            complement(364233..365054)
FT                   /locus_tag="Igni_0411"
FT   CDS_pept        complement(364233..365054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81594"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J2"
FT                   /protein_id="ABU81594.1"
FT                   /translation="MPRVIALKHVFGVVRGSELLGLVELAEEVRIIPLEEDEPVMIIVN
FT                   KENIENVDENALYLVLIKADKLSQILSLKLPKAEEVQREEEKSTKRDLIEEIYEKIKWN
FT                   LAEISNNAPFDIIDFVKEKDEDTGLWVFKFRLEKKKTISISIHGAAKMLWQYVMKVLKE
FT                   ERYPQPVILAVSMEGKVIFMIADVVLDEMIRAVATSVGLVLKDYIVLLDMANEMVDVIV
FT                   LAEKSPDAKVGLFSGYKVSEEIAKVVKERMMRKLKVRVKLKVGLFDYVKIL"
FT   gene            complement(365067..365627)
FT                   /locus_tag="Igni_0412"
FT   CDS_pept        complement(365067..365627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0412"
FT                   /product="thiamine biosynthesis protein"
FT                   /note="PFAM: thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81595"
FT                   /db_xref="GOA:A8A9J3"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J3"
FT                   /protein_id="ABU81595.1"
FT                   /translation="MFSGGLDSFYLLQVLRPKRVAHFIVNFRQTLLALRALSALDPEVV
FT                   LYDHRPFLKAVSAELAKHQMGEYLCLACKRGMVLRASQHGVPIMGDSLGQVASQTLQNA
FT                   AFVSRGVKVLRPLFGSDKEDLGVEDPLAQAGSAVQCPFKPEPVATKPPRGAKARALEFI
FT                   IRKNLHLSRRVAVRRASELTALG"
FT   gene            365668..366804
FT                   /locus_tag="Igni_0413"
FT   CDS_pept        365668..366804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0413"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81596"
FT                   /db_xref="GOA:A8A9J4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J4"
FT                   /protein_id="ABU81596.1"
FT                   /translation="MTIPQELVQKTVEAIRGLAKEAVKKKNKEVIKIMHVCGTHEHTVT
FT                   HNGLRSLMPPEVELIAGPGCPVCVTPAAAVDALIDLSLSGVRVYAYGDVYKLPGTKGSL
FT                   AVAKARGGDVKVVYGFLDAIRDAKQYGKEAVFFGVGFETTVVTVAGPIYDGRVPKNLKV
FT                   LSAYLLTAPGLKRAIEAHEATGIPLDGIIAPGHVSSVIGANAWKYLPEEFGFPTVVAGF
FT                   EAYDYLLAVAEILRQIVRGEAKLVNEYSRVVRPEGNVTAWRKVMEVFDVVDAYWRGIGV
FT                   LPESGLAFKEKYKDYDAAAEYGIEIKPTERELPPGCKCAEINLGIAKPTDCPYFKTRCT
FT                   PTTPIGPCMVSDEGTCSIWARFGGGGLVEELARLAGIE"
FT   gene            complement(366858..367925)
FT                   /locus_tag="Igni_0414"
FT   CDS_pept        complement(366858..367925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0414"
FT                   /product="NMD3"
FT                   /note="PFAM: NMD3"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81597"
FT                   /db_xref="GOA:A8A9J5"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J5"
FT                   /protein_id="ABU81597.1"
FT                   /translation="MGRRRRRFCVKCGALEAPDNPIVDGLCLKCLTEERPLFEVKSKRK
FT                   LVVCPVCSSYLVDNSWVKGTGDVEETIRMLAHRMVEEGLRPVPPAEGAELLSVEVVRRR
FT                   GGKYFAEVTAEVIVKGAKTVQTLTVPLDVEKKPCPKCLMKSGKDYDAVLQIRSESGRVT
FT                   LEELRTAGELFAKAGSGEDVVELVDQKNGLDVLLVSKEVAKRAAQLMRFNMGAKIIESY
FT                   SVVGMRKDGKVRTRLTISVRLPKLKGGEGLLFFGEPAIFEGFNKGKFSLYLLHSDKELK
FT                   LPTDEWWQLRKSGKIKYLDEVYLKVGTVESENPLKVNVGGEVVEAEGPPDLELGEEVYV
FT                   IEYKGKVYALPKEPR"
FT   gene            complement(367963..368613)
FT                   /locus_tag="Igni_0415"
FT   CDS_pept        complement(367963..368613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0415"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /note="PFAM: glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81598"
FT                   /db_xref="GOA:A8A9J6"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J6"
FT                   /protein_id="ABU81598.1"
FT                   /translation="MNVLADDFMITQLGMRKAQVRRVKDLNGVTLSPVEGEEVVYKVFR
FT                   DVEPVHQYDLRADVTVLYPGALPDGEFYRTHGHFHPEGPWGKPWPEVYCVLRGRGKFLL
FT                   HDLERVYVVELKEGDVVKVPEGMAHVLVNDSDEPLLTCNYVSKSVTPDYGRVKALGGPA
FT                   AFLTKDGIVLNRNYDVKEIKVCKPLPLNLDSLVATHAVKPSVEEWLTCFPYKG"
FT   gene            368619..369584
FT                   /locus_tag="Igni_0416"
FT   CDS_pept        368619..369584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0416"
FT                   /product="(S)-2,3-Di-O-geranylgeranyl glyceryl phosphate
FT                   synthase"
FT                   /note="PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81599"
FT                   /db_xref="GOA:A8A9J7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023547"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9J7"
FT                   /protein_id="ABU81599.1"
FT                   /translation="MPPRLQVHVLSALTPGPRVEASGKLRAYLELVRAHNLLGTVLGVI
FT                   AGAALLGEVNVAAAIASASAAAVAAGGYAINDYFDVEIDKVNKPERPIPSGRVGAEEAR
FT                   KLALALLALGPLLGLAVGPLTGAYAALNAVLMYYYSKSLKKTGLPGNLAVSFSTASTLL
FT                   YGSLATAEWAGEVARVLRTIPIILMVFLMTLAREVVKGVEDYVGDKEGGVKTLAVVKGP
FT                   DFALRAALALACASLALAYLAAPLLSLGYAFLAFVTLGGLLSLASVAACLRSEDPVRCA
FT                   AKPRRAMKVAMFLGLIGILVDRLVQPVFYPHVLHAGGEEG"
FT   gene            369581..369844
FT                   /locus_tag="Igni_0417"
FT   CDS_pept        369581..369844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0417"
FT                   /product="Alba, DNA/RNA-binding protein"
FT                   /note="PFAM: Alba, DNA/RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81600"
FT                   /db_xref="GOA:A8A9J8"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J8"
FT                   /protein_id="ABU81600.1"
FT                   /translation="MTKEVIVVRDKPVSEYVLNAVVAFNSGAEEVEIVGRGRYISKAVV
FT                   VFNRLRERLEETLKVVNVEIGSEESRRGRPVAYIKIRVTQGL"
FT   gene            complement(369816..373079)
FT                   /locus_tag="Igni_0418"
FT   CDS_pept        complement(369816..373079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0418"
FT                   /product="Reverse gyrase"
FT                   /EC_number="5.99.1.3"
FT                   /note="PFAM: TOPRIM domain protein; DNA topoisomerase, type
FT                   IA, central domain protein; SMART: AAA ATPase; DNA
FT                   topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein; DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81601"
FT                   /db_xref="GOA:A8A9J9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005736"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040569"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9J9"
FT                   /protein_id="ABU81601.1"
FT                   /translation="MIEAVYQRSCPSCGGDVERERLLAGLPCSKCSEPRGLLAWKEVLE
FT                   EEYEAFANFFKKAYGFELWGPQRAWAKLALSGSDAVLLAPTGTGKSTFLAALSSFLKRK
FT                   GKRVLYVVPSKSLEEQVKERLAEEVDVITMRRLVRDPRAYRGYDVYIFDDVDSVMKSPK
FT                   SATALIIALGLEEAVPIVNEMVDIIKKGLSDEGRRGRYEELKGELERLKDKKGSQVIMA
FT                   SATAGGGSLTAKLILSLLGLSPASAPPAIRYVDDVKMFHEDPVEGAAEVVRYFTSEGLK
FT                   GIVFVHEGFPIEEVERALRERGVAAEVVKSGKLKALKKLEKGELDAVVAYSSRYGVAAR
FT                   GIDMPDVIRFAVFVRPPFKKFDLERGLNNPLTLLRVMKKLEMKEDTVKLFKMLSKLSEV
FT                   ELALLRRAMEEGGELEGFLGDALSALKEMKGKVLERLKGEKVVDKGFVVKDGKVFLLDP
FT                   KTYLQASGRTSRLTPKGMTHGVSVVVYDDEDLMKAFEESLKDRVEFKEELVTPKGPKPV
FT                   KAKNVLIVVESPTKAKTFARIMGGGGKVEVGGVAAHLAVHEFGGEALFAFIVATKGHLF
FT                   DVTLDEVGTYGVELGEPVRVYYAPINRCRRCNLAWASSDPRCPKCGLPAESSSKVVEAL
FT                   RRLATVVDEVYLATDPDEEGEKIAWDVMAMIYPFNSNIKRMKYYEVTLRGLHEALSFLT
FT                   TVDEGTVRSQIVRRLDDRLVGFAVSERLKAAFGDPNHGLGRVQGPVLKFVVERAKARKA
FT                   SAGYSVTLHLSNGDTLRLFVKTKEEALKLASVEEVKILKVEEEVEELKPLPPYTTDTML
FT                   EDASKLGLDPSRAMRVAQDLFEMGFITYHRTDSTRVSDAGIAVAREWITSKFEGLFAPR
FT                   RWGEGGAHEAIRPTRPLSAEDLKLDFALNGMSFEALRLYDMIFRRFMASQMKEAKVRKV
FT                   KVVYEVAGKRVESAWVAEILEPGWTSVWNIKTKDIKLEKVAKVVSSEVRRASLVQLPKV
FT                   FEVIRWMKERGVGRPSTYAKTVENLRRHGYVVITPNNYVVSTKKGVAVAEYVERNFPEL
FT                   AEAEYTRRLEEAMELAKSDFWGAFNNTLRAFRALASLES"
FT   gene            complement(373139..374701)
FT                   /locus_tag="Igni_0419"
FT   CDS_pept        complement(373139..374701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81602"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K0"
FT                   /protein_id="ABU81602.1"
FT                   /translation="MMSVKRLKVRLLTPPEDVSWGPKYIATALGSKGFQIVEPHEGKIV
FT                   LDKPEPPVHSVLWSSQGTLYLGTEDKIIVLDRNLEKKYSFEVPSQVEHMVETKDKKVLA
FT                   VGEGWLAKIEGKGIEIFNVGYSVWRVAGKGEFVALGSKDGRLLIFDLNKGKVIWSADFQ
FT                   SIITGLSWGPFLLASDASGHIYSINTKDETFEFKVLAKYKNVSDLMWNPKGDEIVVSIS
FT                   SEKRLAFLNQLGSEVSSVDLEGTPTSLDYSPTSIEVVVVLENGELETVATPKAGKVVEE
FT                   LVKASKCIKEGKVVCEALEKALWRTIGMLAPDVNVDEFYALKQLGEKMPELLVCLQKRI
FT                   TDLRKVIRNIITLEDVVEVLKGGCERFERWLDTIVNNATCIVKLSEELEKLFDIASADL
FT                   LAAQVPTSVHLAEQMGCERALELVKCAIKTYKKMKDVWDAEEELGISLPPPGEVVVYLF
FT                   LVGDCEEVYQKVSRLSELKELARQKAAEGDVESVIKIVREANAIAEELREKVETALPEG
FT                   ILE"
FT   gene            complement(374817..375605)
FT                   /locus_tag="Igni_0420"
FT   CDS_pept        complement(374817..375605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0420"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81603"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K1"
FT                   /protein_id="ABU81603.1"
FT                   /translation="MLCHYPGCSTRGIGEDMEIATRNVLKALGVEYKEIEGWVCCGTGV
FT                   VEDASPLGTAVLVASNLSLAKEQGCSSVFTACGICAAQLMFWKGRMMKEEPLREEVKDL
FT                   LESKHLKFNIDVKLLHILDLLLENFKEEHVKRPLYNLRVSLYPGCGAKKFYNFYQGKDV
FT                   FKMMEEVVKRTGAEVARRVDTCCGFPLMTYDKKVATDLARKVVSESAGADVIVTLCPFC
FT                   QYQLDTSQKGVPVWHLHQLVGYAMGLSEKELGLDKHVNKL"
FT   gene            375671..376345
FT                   /locus_tag="Igni_0421"
FT   CDS_pept        375671..376345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0421"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81604"
FT                   /db_xref="GOA:A8A9K2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K2"
FT                   /protein_id="ABU81604.1"
FT                   /translation="MRELRERLLSGAPFMLFDFPGREEEVDLVYYAPAVTAASVYNLRT
FT                   LAGGLICFATTEEVGSALGLEKAWKTLSKQGYSKLVKKPKYGDYPAFSVWVNHVDVRTG
FT                   ISDEDRALTIRKLAEVAELALSDPEEAKRRFEEEFYAPGHVPVLLASKLEERRGHTELS
FT                   VRLLEALRLTPAAAFAEMLDYGRSMSLRRAEELSRSLGIPLIKGEEVLAFLGMRSDSNV
FT                   ER"
FT   gene            complement(376359..376637)
FT                   /locus_tag="Igni_0422"
FT   CDS_pept        complement(376359..376637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81605"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K3"
FT                   /protein_id="ABU81605.1"
FT                   /translation="MDLDRLADIAIRIASRMRIREELLEGVSQEELEAAKRVAEMVREE
FT                   RKGLVYCAICAKGSFTKRGFYLHLMRVHKDDIKVLLERELSAPLAGQ"
FT   gene            complement(376706..377368)
FT                   /locus_tag="Igni_0423"
FT   CDS_pept        complement(376706..377368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0423"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81606"
FT                   /db_xref="GOA:A8A9K4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR009185"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K4"
FT                   /protein_id="ABU81606.1"
FT                   /translation="MEYDGARWELLRRKREKAIRVMERLAPFSPVVHGSVARGDVNEDS
FT                   DVDVAILFPVEPYKVEAALGFSKSHGYIIMATPRSTPKVYLALDEKEEVVVSFPLGKLT
FT                   TKEREFYAFGGELDLKGLKEGKRVPGVNKDLLLIVPTPYGHEEEPVIGREEHVAKVLGI
FT                   SAETVKERVRLLTKRREKGRTGVFLEFKFWGPAEEAIHELAKTNKAFRRRVVEEGLL"
FT   gene            complement(377310..378560)
FT                   /locus_tag="Igni_0424"
FT   CDS_pept        complement(377310..378560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0424"
FT                   /product="AIR synthase related protein domain protein"
FT                   /note="PFAM: AIR synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81607"
FT                   /db_xref="GOA:A8A9K5"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K5"
FT                   /protein_id="ABU81607.1"
FT                   /translation="MDLEDAIKFLLEKGLNKDQIISLVLPFLTVRKGLSLERALKLAEG
FT                   LYEDAVQVLSNSGPYAPSPLGVRAGEGGVGSRGLGDWAVHEALTSLSGGGDAARVGDLV
FT                   LAVDGFHSRLSSVPLLMGFHAVRAAVRDVMVSGGAPVASLIDVHVADDTDVAYLLDVTA
FT                   GAYVAGELTGAPLVGGSTLRIGGDAVIGNRVTGGAFAVGRKVRDWSRFNASPGDELYAT
FT                   VGKGGGTVTAYALTHGRPELVKLTLNVDFVYDIKRAMEVECVKGAFDWTNGGIALDAFE
FT                   ISRKLGVKVVLWKSVYEAVHPELLKAFEEDGIDPLRTSVDSVVFVAERGCELPFVKVGE
FT                   VEAGEGVYLEGEELEPAFREAPYTHSKRAVEGLERGADPEELKEYLTKRIEELRGAVLG
FT                   VRRGPLGALEEEEGEGD"
FT   gene            complement(378551..379288)
FT                   /locus_tag="Igni_0425"
FT   CDS_pept        complement(378551..379288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0425"
FT                   /product="geranylgeranylglyceryl phosphate synthase"
FT                   /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; geranylgeranylglyceryl phosphate synthase;
FT                   PFAM: PcrB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81608"
FT                   /db_xref="GOA:A8A9K6"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR010946"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9K6"
FT                   /protein_id="ABU81608.1"
FT                   /translation="MGAYDELMKRRGRALLPLLDPDKVISEEDYYERAVKALCEYAATF
FT                   LVGGSTGVGQIETEKTVALVKKNCDKPVTVFPGSPCQVAPSADAILFMSLLNSTNRKYL
FT                   IDYQLEGSLLVYRYGLEAIPTAYIIVGEGGTAGWVGEAKAIPPEKPELLSMYVLAAKYL
FT                   GFKVVYLEAGSGVKRSVPPEAVRLAKKLLGEEVILIVGGGIKDEEVAAEILRAGADGVV
FT                   VGTVVERDLSAAERIARRVAGWT"
FT   gene            complement(379291..379527)
FT                   /locus_tag="Igni_0426"
FT   CDS_pept        complement(379291..379527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81609"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K7"
FT                   /protein_id="ABU81609.1"
FT                   /translation="MPTVFQCPNCGAHALIIDIIQNKKTKEMKAIIRCAECGLVHEEPV
FT                   ESPIIDRAVIYGRFIDKFYAGEIKVPEGGEEEE"
FT   gene            complement(379538..379927)
FT                   /locus_tag="Igni_0427"
FT   CDS_pept        complement(379538..379927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0427"
FT                   /product="zinc finger, SWIM domain protein"
FT                   /note="PFAM: zinc finger, SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81610"
FT                   /db_xref="GOA:A8A9K8"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K8"
FT                   /protein_id="ABU81610.1"
FT                   /translation="MRPRASNLKSLCPKEKTKVGIPVIKVVNRDLPEVTVYRGESGDYL
FT                   VADDFCTCPSFLRNLDLGKLEPCKHVCAEKRVTKSTTLVLEDEDFDTLLISLLTHERSA
FT                   TLNLLLATYEGELGGEEEKEEEDRS"
FT   gene            complement(379924..380589)
FT                   /locus_tag="Igni_0428"
FT   CDS_pept        complement(379924..380589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0428"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81611"
FT                   /db_xref="GOA:A8A9K9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9K9"
FT                   /protein_id="ABU81611.1"
FT                   /translation="MSGKEAVARRAAELVASEAPEVLGVGSGTTVRLFIKYLKEFGFSG
FT                   LTVPTSYDTALELKKHGLKVLDLMSVDEVELSVDGADEVFTMNGSLYAVKGGGAAMLRE
FT                   KVLAYISRKRIYIVDEGKVSGSPCSRGVPVPAEVVPSSLPAVARGLKLLGVGWKLREAK
FT                   GKLGPVVTDNGNLVIDMDCKSSINVIEKVEALPGVAVTGLFGPDLIDKVVVGERGELP"
FT   gene            complement(380793..381035)
FT                   /locus_tag="Igni_0429"
FT   CDS_pept        complement(380793..381035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81612"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L0"
FT                   /protein_id="ABU81612.1"
FT                   /translation="MKSLAVLVTLLLLALAFREGFFLALGVVAYLYLLFVVYQFVKYYG
FT                   KALEAGRSAEHYSKEVVDELKALVKAIHLVKSKRC"
FT   sig_peptide     complement(380946..381035)
FT                   /locus_tag="Igni_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.566 at
FT                   residue 30"
FT   gene            complement(381032..382969)
FT                   /locus_tag="Igni_0430"
FT   CDS_pept        complement(381032..382969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81613"
FT                   /db_xref="GOA:A8A9L1"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L1"
FT                   /protein_id="ABU81613.1"
FT                   /translation="MSVIITTMVITVTFIFLDRGAGGGPSKKLVGLGRGRPPHRSVPRS
FT                   SSSSPSNPPDPGGLRVGSLRLPAGALGRVRLSELPNYLLLLLKKPSEWERAALPDVREV
FT                   APLLSRRLNFKLLKPAGGREGEARLLSEGAWRAAGKWVKGCSCSPDLGYPCYERWAELF
FT                   DVRSCFSFSPKVHYLTVPVAPTKGADVKYPWFFTRAYHFARGAVLGVSPPREFFRLVKP
FT                   YSGPGWANAMEAGLRALNLTYSFGNNQYSVEIVEQLLAALLYILVNVEVGVYTSNHTMC
FT                   DLYGLTVSSLALGRAWRPLARAAWEVRESLVYELRKQLDGWDYEGSTAYHLLVLEGALA
FT                   TLYAAKELDESYFERVWPEVKGPLSEASELLASVTLPDSSFPLIGDNGSDRALVLESLE
FT                   FDYTSTITALALARKLGLLKSFPKLEGPAKEEAARALSSLGGTYPEERALRTSDKPWLH
FT                   SYNDGELLVTLACAPTSKGAPPGHHHDDKGSFTVWRKGWVVLDPGTFTYTGMKEVKDLM
FT                   RSSYFHDVLRGCCTFPDTFDASCNCTCKFYGYMKVEVFPGWRREVYVKKDRVVIKDVVD
FT                   FKGSMSLVLPSRPEQEGDYLELPNARIKVPGAYEVTEAFYSPSYGVIKKGYLVRVRDVG
FT                   PGEATTEVVF"
FT   gene            complement(383194..383946)
FT                   /locus_tag="Igni_0431"
FT   CDS_pept        complement(383194..383946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0431"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81614"
FT                   /db_xref="GOA:A8A9L2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L2"
FT                   /protein_id="ABU81614.1"
FT                   /translation="MKVDPSKRPWLVAYLTLNYPDERTFLKALEYLKDKAELVEIGIPP
FT                   KFAKYDGPTIRRSYKAVSSKGLGLHNFEGELRKACRAFPEERIIVMTYYDDVKENYEEF
FT                   LDKACGGGVLFADAVIDFADRLEEIASKAKERGKSAVFFVSPTTPDHVIRKAAELSDPV
FT                   VYLGVRPATGIPLPVGIPNLLRRVKSLTNKYVVVGFGLKEEEVPQAVGAGADGVVVGSA
FT                   LVKALGEGFDNFKKVVDRYLALLSLPKR"
FT   gene            complement(384049..384234)
FT                   /locus_tag="Igni_0432"
FT   CDS_pept        complement(384049..384234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81615"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L3"
FT                   /protein_id="ABU81615.1"
FT                   /translation="MVYIIRKIDVFDESKITMVPQYPPLKRFTELVEWSRTGPYSGYVR
FT                   RRDPATGEEIIVYIKP"
FT   gene            384410..384892
FT                   /locus_tag="Igni_0433"
FT   CDS_pept        384410..384892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81616"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L4"
FT                   /protein_id="ABU81616.1"
FT                   /translation="MFKELRDKYLEYLSNTTFSGVRNDVVRSFEWNLLALAYSLRNSEK
FT                   SEAKEIVKQYPQKYYDLLEIYHKLKAIDRLSEREIIEKIKRKESKIYGIVVEYYPYLNH
FT                   LLTDDGLWSDPETDTLILTTIRGKLDHILAKYAIQEGWDLLIFELVRALRARSRGS"
FT   gene            385255..386265
FT                   /locus_tag="Igni_0434"
FT   CDS_pept        385255..386265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81617"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L5"
FT                   /protein_id="ABU81617.1"
FT                   /translation="MKLELLWTFDQPSNGIKDMAFSPNGNLGIASKDRCAYILDPNGNL
FT                   LGKECGGGIMAGAGYSNRVFGFVNTDDYVYLFYEDGTFWKKIEVGDSHDLAIALFDNGF
FT                   VACDDYCAKYDFNGNKLWDTEVDGVADVVVHKGYVYAANWWSNKLQILDLNTGRTINEI
FT                   SYDYYSDDYCSDSVNACGNYLAVIAGELYVYDISDPTSPKLLWKSNGLDVHGKHTPAFS
FT                   PDCKYIAVADNYWDDEPDGNNMLKIFDINGNLVYSKEMYGIWNVAWWKDRLAVGYVLYD
FT                   GLIYDGEVEMYKIIGYEPPPEPSSASEPLPNLTEAIPCGSSSSSPSGPSRRQKEG"
FT   gene            386453..387235
FT                   /locus_tag="Igni_0435"
FT   CDS_pept        386453..387235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81618"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L6"
FT                   /protein_id="ABU81618.1"
FT                   /translation="MWKRLDVGEEYSKALALLNEGLISCGELCGKFDLDGNGLWSFELG
FT                   GEAAGVVVNKDFAFVLDKENKRLLVVDLDSGRAVRERKYLREPLAIASCGKYLAVATSN
FT                   KLFLYDVGDRRRQRALSQARLELGTPSLAFSPDCKRLAVLGGGRLRLLDLNGEVLCEAP
FT                   LPRASSVAWWRDELIIGFEDGRLAAYELEGYKPTVKVVKERSVDLPVLKFFPMEVKGKV
FT                   FEAELKLVPEPLSGRWSCSKVGEGTKRSFTSAGGTRKP"
FT   gene            387238..387951
FT                   /locus_tag="Igni_0436"
FT   CDS_pept        387238..387951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0436"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81619"
FT                   /db_xref="GOA:A8A9L7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L7"
FT                   /protein_id="ABU81619.1"
FT                   /translation="MRVAKGFVEVLVGEAPTVTPSQFSSFLKEVSRQALLKHPYLLEVK
FT                   GYSEEYPLVAYEFADGGSLEYQLARGWEPLPEEALAVGIRVGEALEYLHSRGFVHGDVK
FT                   PSNVFAFTKGIVKLGDLQSLKKAMARTTGKLYFTPGFAAPEQYFLDLREPGEEEKVDSY
FT                   QLANLVLYLLKRESVDGEELASGNADLEEALGGLGELGEVLKRGLKVRPSERASVGELV
FT                   EEFKALLEKLGGGEG"
FT   gene            complement(388035..388694)
FT                   /locus_tag="Igni_0437"
FT   CDS_pept        complement(388035..388694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81620"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L8"
FT                   /protein_id="ABU81620.1"
FT                   /translation="MQVPTVTDRRELNLFITIADKARRVRAVSLPDQLLDLAFQYASQK
FT                   FAEILDKLRAGKPITDSEANFILLFMVLNQTKVSYEVLSKQIELNRVELREVEKRLDKR
FT                   IDEVEKRLNSRIDETNKRIDEVKEELNRKIEDVRNELNNRIDETNRKIDQLWEEMKLME
FT                   GRLNKRIDELKEELSKRMDDIEQSMDELKAGMAGLNSQMKLVADMLGKVVEALAKR"
FT   gene            complement(389316..389420)
FT                   /locus_tag="Igni_R0014"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(389316..389420)
FT                   /locus_tag="Igni_R0014"
FT                   /product="tRNA-Thr"
FT   gene            complement(389444..389971)
FT                   /locus_tag="Igni_0438"
FT   CDS_pept        complement(389444..389971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0438"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81621"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9L9"
FT                   /protein_id="ABU81621.1"
FT                   /translation="MRLKVGSCEVVLTEGDITEFEGNAIVNAANSLMIMGGGVAGAIKR
FT                   KGGEEIEREAVEKAPVPVGEAIATSAGKLKVKYVIHAPTMERPAMRVPPENAYLATKAA
FT                   LKVAKELGLKKVAFPMMGAGVGGLSVGTAAKEMLKAIKESCEGMEVWLYAYGEKAYEEL
FT                   LRAAREFAEGGS"
FT   gene            390007..390714
FT                   /locus_tag="Igni_0439"
FT   CDS_pept        390007..390714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81622"
FT                   /db_xref="GOA:A8A9M0"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M0"
FT                   /protein_id="ABU81622.1"
FT                   /translation="MEGERGLIERLSAIALLLLTAHALWVHASAGEVEPLEVVALEALW
FT                   APVLLRAPCDKRALLVVFAGFSGYFLPRLIPYDAFLKLAITDVIFNNYVLRPLGVEMKV
FT                   TNGEIVIFYDQRPYAVYAVGCSSLRSGAFLALMPLAARGSLGRRLLAAALGYLLSYPFN
FT                   ALRVAAIVVAGEALGADPFLAHLLVSPLASVLIATLIMVVQELVLPGYLEEVSEGVECL
FT                   LKLAKPWWRSRST"
FT   gene            complement(390674..391771)
FT                   /locus_tag="Igni_0440"
FT   CDS_pept        complement(390674..391771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0440"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; GtrA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81623"
FT                   /db_xref="GOA:A8A9M1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M1"
FT                   /protein_id="ABU81623.1"
FT                   /translation="MVDVSVIVPTYNERENLPVLAKRLDKAMGKAGISYELVVVDDNSP
FT                   DGTAEVARNLKLEHGKVKVVVRKDERGLASAVMKGFEVAEGKYFVVMDADLQHPPEVVP
FT                   ELVKRLKEDCDLVIASRYSKEGRIEEWNFVRKVISKGATILAKLLVPATKYTTDPMSGF
FT                   FALKREVVERAKLPLNPLGYKILLELLAKGSFEKVCEVPYVFGKRLAGESKLGGRVMLE
FT                   YLIHLMKLAKETGELNRMLTFAAVGASGIVVNEGALYAVYELLGAKSLGALGLAAAGLA
FT                   GFEASVVYNFLLHERVTFKDRRKGSVVKRFLHYEAASVLGAAAQLAFLLGLTYAGVHYL
FT                   ISNLIGIVVGLGIRYSYSATKAWPA"
FT   gene            complement(391778..392707)
FT                   /locus_tag="Igni_0441"
FT   CDS_pept        complement(391778..392707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81624"
FT                   /db_xref="GOA:A8A9M2"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M2"
FT                   /protein_id="ABU81624.1"
FT                   /translation="MALTIDELEGAIQRGVTWLKTRQLECGGWGACDSSQTGLTGLVIV
FT                   ALREAGLSSDDVSIRQAVKFIIERQRKDGFLQWTSPTEPGSFYGTARALLGFLVGSDDE
FT                   TLKYYEKSVASAVHALAMGEMPCGGWEANPGGGLSEWASAEVLYSMFYAGRKYVDEIFR
FT                   SPMHYYVRMRRWFEKRQSLNGSWDNNCLDCTARVALFLSLYGYRGIEVQNAVSFLLAHF
FT                   KDDKIGESPWATGWGVLGLLAAAGLKNPIVREAVEKSVLTLLEAQLSDGGWPVFYDSNL
FT                   AYESVTAVVVWALSLYRNLRHGLFSVLG"
FT   gene            392769..393812
FT                   /locus_tag="Igni_0442"
FT   CDS_pept        392769..393812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0442"
FT                   /product="IMP biosynthesis enzyme PurP-like protein"
FT                   /note="PFAM: IMP biosynthesis enzyme PurP-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81625"
FT                   /db_xref="GOA:A8A9M3"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9M3"
FT                   /protein_id="ABU81625.1"
FT                   /translation="MRVTDVLKEYDLSKLTVATVASHSALQIVHGAKKEGLRTLLIVKK
FT                   DRYEFYSSFSHLVDSFIIVESWKEVLNEDVVNELLASNAVLVPHGSFVEYVGAQGLLDY
FT                   PVPIFGSRKILLWESDQKKKMELLRRAGIKVPREYRSPDEVDGLVIVKLGGAKGGKGYF
FT                   LAKTPEEVRRGLEALGNPSNYIIQEYVIGVPAYYHFFYSPIYNRLEITGMDIRYESNVD
FT                   GLRRLPPELASGIRPSFTVVGNIPVVLRESLLIDVYKYGKSFVRTTEELLGEELVGPFC
FT                   LESIITEEGEVVVFEFSGRIVAGTNLYVNGSPYSYLYWDEPMSAGRRVAREIRKARDSG
FT                   RLEEVLR"
FT   gene            393910..394365
FT                   /locus_tag="Igni_0443"
FT   CDS_pept        393910..394365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0443"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81626"
FT                   /db_xref="GOA:A8A9M4"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M4"
FT                   /protein_id="ABU81626.1"
FT                   /translation="MDCLACVALSALPAVEVRGSVPCLALAGCGAHYAALSYLLSSSTG
FT                   ALVYLLLEKLFPLVEEFLKGRWELGAKLLEKVVERTKKKASKKVEEMGTLGLAAFVALP
FT                   VPGTGVWTGALAGYLLGLKRRDVVLALFAGNAVTTAIMSLSYLLQSP"
FT   gene            complement(394353..394742)
FT                   /locus_tag="Igni_0444"
FT   CDS_pept        complement(394353..394742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0444"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81627"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M5"
FT                   /protein_id="ABU81627.1"
FT                   /translation="MKVAEVAREAPWVTPATKVYEAARLMEESEVPCVMVKTVDGEFVG
FT                   IFCRRELVSAASENNCHDVIEDYVNTEPSFVSYDADVIDAIKLFNKYKEEELVVLNENE
FT                   EPYAVITTIDVVRIAGKILESIYGD"
FT   gene            394830..395789
FT                   /locus_tag="Igni_0445"
FT   CDS_pept        394830..395789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0445"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81628"
FT                   /db_xref="GOA:A8A9M6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M6"
FT                   /protein_id="ABU81628.1"
FT                   /translation="MPKVKFKVARYDPATKASWWQEYEVEVDKYTSVAVALQRVREEKD
FT                   PTLAYRPLCKMGVCGNCAVKINGRPALACLTNALEAAEEGNGTIVVEPLDNMPVVRDLI
FT                   VDRSDFERRMFSVKPYLVPKEEVLKSDKWYPMLPAVQMDLWSSAQCVWCGVCYSVCPVA
FT                   KVNEEFAGPHALVKVYRFAYDPRDALGRERVYLNEKSLWMCVACKNCGTSCPKNLKHGL
FT                   RFKRMRNDDVKSPRSEYAEKAVKHVIATIASIAKYGRADEVEIFTSTGLTEAVADALPR
FT                   LARGGWKRRPYKPKPGEADRRAVEAFRAAVSGLLKARV"
FT   gene            complement(396155..396553)
FT                   /locus_tag="Igni_0446"
FT   CDS_pept        complement(396155..396553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81629"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M7"
FT                   /protein_id="ABU81629.1"
FT                   /translation="MEVSKGAYLLVVELEEGLERWGLGPGLYAYVGSAWGPGGLFARVR
FT                   RHLTKGFSKPRWHVDYLTMKGKPLIAFLFPGLTEEELYSVVAKVLRPAVKGFGSTDTKH
FT                   LTHLFVAEPRRLPELLSRIRSLRKTDRT"
FT   gene            396618..397169
FT                   /locus_tag="Igni_0447"
FT   CDS_pept        396618..397169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81630"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M8"
FT                   /protein_id="ABU81630.1"
FT                   /translation="MVNLVITNSYEYSGDWIRGFAPLSFTTPYFFDETTRYYVFAKDFP
FT                   KVGRGRLPHPLVGGIKESVAKELHLEFKDFVVYPGIPVREAVISTGKVYKICTDCPPWG
FT                   NIISFMLKDAKRITVFPKQGSVSALAVAPLPQGGIEVILKVSAKSVFYLLYHDGIEGEA
FT                   FMVSWEGFGLTGRMEVQALG"
FT   gene            complement(397166..397906)
FT                   /locus_tag="Igni_0448"
FT   CDS_pept        complement(397166..397906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0448"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81631"
FT                   /db_xref="GOA:A8A9M9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9M9"
FT                   /protein_id="ABU81631.1"
FT                   /translation="MREAAELRRIGGEAVSDIGLGSWAVRDPKSFVETLVKAFEMGINL
FT                   VDTAEMYRTEPLVREAMEIYGSKEIFVTTKLYPWNVRHDCERALRRQVERLGKVPDLTL
FT                   VHWPEDIATEVRELEKMVDKGLTRMIGVSNVTKEQLEVALHATKKHEIVAVQNKYSPTF
FT                   TATEELFPTLEEKGIALQAHTPLDRGRALELDWVRRKAEELGAPPAAIVIAWLLSRSPV
FT                   VIPIPKTERVEHLMELLEGTKIKL"
FT   gene            complement(397903..398409)
FT                   /locus_tag="Igni_0449"
FT   CDS_pept        complement(397903..398409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81632"
FT                   /db_xref="GOA:A8A9N0"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N0"
FT                   /protein_id="ABU81632.1"
FT                   /translation="MACWRGREHKAEAELRSYWGKDFYVVRKQPSYLIIKYKGDPFEAV
FT                   ERLKELVDPRYTVLLKAVPYDFSVPADIEDVVKAVSKAAQKIPEGETFRVTLEGPLFEL
FT                   RGDQWEELDREEAIRRIASVVKRPVKLEGYDWVVYVKSLPLRGSQFAGVSVHRPSQVFK
FT                   VKPYK"
FT   gene            398495..398824
FT                   /locus_tag="Igni_0450"
FT   CDS_pept        398495..398824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81633"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N1"
FT                   /protein_id="ABU81633.1"
FT                   /translation="MLELLCALLSSLAFAFSYLAWSSSGSCEALLRGIRAVYKKLEDLE
FT                   EKEKCLKANAVLSLVEAARLLAEDARRLYEKTGDAEFLNVATKWEEFVRTNEAAVKKAL
FT                   GYASK"
FT   sig_peptide     398495..398557
FT                   /locus_tag="Igni_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.720 at
FT                   residue 21"
FT   gene            398864..399187
FT                   /locus_tag="Igni_0451"
FT   CDS_pept        398864..399187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0451"
FT                   /product="LSU ribosomal protein L12AE"
FT                   /note="PFAM: ribosomal protein 60S"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81634"
FT                   /db_xref="GOA:A8A9N2"
FT                   /db_xref="InterPro:IPR022295"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N2"
FT                   /protein_id="ABU81634.1"
FT                   /translation="MEYIYAALLLHAAGKEITEDAVKKVLEAAGVEVDETRVKALVAAL
FT                   SEVNIEEAIKSAAFPVAAAPAAAPAAAGGEAKEEKKEEEEEEEKKEAVSEEELSAGLGA
FT                   LFG"
FT   gene            399220..399969
FT                   /locus_tag="Igni_0452"
FT   CDS_pept        399220..399969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0452"
FT                   /product="Protein of unknown function DUF137"
FT                   /note="PFAM: Protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81635"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N3"
FT                   /protein_id="ABU81635.1"
FT                   /translation="MSFVPPDHPRFLSLMYRERLVEKFKEGVVVAQGLIAHGRGEAFDY
FT                   ILGEQTIPPALEAEKAAAALLKLARKPVISVNGNAAALVPGELVELSKALNAPLEVNLF
FT                   YRSEERAKRIAELLKAHGAEEVLWRPDQELPGLSSERRRVSSKGIASADVVLVSLEDGD
FT                   RTEALKRNGKKVIAIDLNPFSRTSLTADITIVDNVIRAIPNITKFVKAMSEREAEEALE
FT                   RFDNARNLREVVKWIKKWLDAKTSELL"
FT   gene            complement(399955..400674)
FT                   /locus_tag="Igni_0453"
FT   CDS_pept        complement(399955..400674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0453"
FT                   /product="Proteasome endopeptidase complex"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81636"
FT                   /db_xref="GOA:A8A9N4"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019982"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N4"
FT                   /protein_id="ABU81636.1"
FT                   /translation="MAFGLASQLGYDRAITVFSPEGKLYQVEYAFEAVKRGWSTIGAKC
FT                   KEGVVVAASKKKVQTLVDFDKLEKIHFIDDHIVTSFAGLAADGRVLVDVARRAALNYRF
FT                   LYDEPAPVEYVTKAVSDLKQVYTQHGGVRPFGVSLIIAGVDDEPQVFMTEPSGQYMSYK
FT                   AVAIGQNHHILMEFLEANYKYDLSLDELVKLVLKAFLQVSESEKDPELYEVAVVPVDTK
FT                   TARKLTVEEVAKHLEEL"
FT   gene            complement(400720..402339)
FT                   /locus_tag="Igni_0454"
FT   CDS_pept        complement(400720..402339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0454"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81637"
FT                   /db_xref="GOA:A8A9N5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N5"
FT                   /protein_id="ABU81637.1"
FT                   /translation="MFSVVALIMVIIVAIVTMGIAWWSYRRVRSVQDFYAAGRSVPWIL
FT                   IAWALTSNYLSAASFLGVAGGISNFGLDRVWDPIGYFAGWVLVLLVAAEYIRKVGKFTV
FT                   ADILTERFSGAPELRALAMIATVIISVFYMIPQMIGAGSLMSLLLDWPYHVAVVVVGAI
FT                   VVLVVMLGGIRSTLYSQVFQALVLWFSMLLIFAAYMVAFGGPSNLLESSWKVPPPALAK
FT                   KYFEPKEIDVNQITFRTALQESLKAAEEVLQKNPELPRLPQPGAFARDVWNQFSLALGI
FT                   IMGTVGLPHVLVYFYTVPKPSDARKGTVGAIFNIGLFYLFSIFVGFAAGTALFYVITNW
FT                   LVTGYVPWAKNMPVVMSGKLLGGELLMGLAAAGAFAAILSTVGGLMVAATNSVAYDLYA
FT                   NIVRKGKASEEEQLFVARLVALGVGAVAIVGGLLLKGFDVSYLVVLAFGIAASSFATTL
FT                   IMNLWWDKFTRSGAVASMLVGLLTSVLFVLLRLSGTKALGPIPVLVQPALYSVPASFIA
FT                   GIVVSKLTSDTGSEEFLKKLHS"
FT   gene            complement(402339..402548)
FT                   /locus_tag="Igni_0455"
FT   CDS_pept        complement(402339..402548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81638"
FT                   /db_xref="GOA:A8A9N6"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N6"
FT                   /protein_id="ABU81638.1"
FT                   /translation="MSRRALILKLLAPYLVVYFGMALLFGAFKGLAGAPLFGGLSVGLA
FT                   YALLMFPITWGVVAYYALKAGGEE"
FT   sig_peptide     complement(402450..402548)
FT                   /locus_tag="Igni_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.851 at
FT                   residue 33"
FT   gene            402628..403050
FT                   /locus_tag="Igni_0456"
FT   CDS_pept        402628..403050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0456"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81639"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N7"
FT                   /protein_id="ABU81639.1"
FT                   /translation="MVDFLLAYDGSSPAKKALEEAAWLAKELKGKVYVLYVVDTNALTE
FT                   VFPDYTGEVAEIALNKAKEVVNEAVEALRKEGVEAEGLVEAGSVAEKIVEVAKSKNVKY
FT                   IIMGAHGYSGIKKLLIGSVSDKVIRLSDRPVLVVKG"
FT   gene            403136..403915
FT                   /locus_tag="Igni_0457"
FT   CDS_pept        403136..403915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0457"
FT                   /product="4-hydroxybenzoate polyprenyltransferase,
FT                   putative"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase,
FT                   putative; PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81640"
FT                   /db_xref="GOA:A8A9N8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N8"
FT                   /protein_id="ABU81640.1"
FT                   /translation="MRPPTLKEAVLVFTALFGIRSFALAVNNIVDMEIDAKNPRTAKRP
FT                   LPSGRVSVREAWALALVSLFIYFVSAYLLNVYALLLSPIFPIMAYVYPYIKRKYPIAHF
FT                   WLGSVLGGAVVGGAIAVSGDAPSLLHALLSVPWAYVAAVACWVASFDVLYAVLDVEFDR
FT                   KEGLHSLPADFGVERALRVSKACALAFAWLAIWSVKLYSLNAASAALTAAGLALLFELF
FT                   GEARKDVVGAARRSLDVNILVGLAVGGAPLLKLLPLP"
FT   sig_peptide     403136..403213
FT                   /locus_tag="Igni_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.966 at
FT                   residue 26"
FT   gene            403984..404709
FT                   /locus_tag="Igni_0458"
FT   CDS_pept        403984..404709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0458"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81641"
FT                   /db_xref="GOA:A8A9N9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9N9"
FT                   /protein_id="ABU81641.1"
FT                   /translation="MELLVGGWKPFSLVDVQGAITFTVWACGCNLKCPFCHNWRQAEWM
FT                   DCAPFLEERFLNDLMESREFVDYVHLTGGEPTLQPELVKKISSLSKSNGVPFSLNTNCT
FT                   TKQALELIRLADHVAFDVKVPFPALSGLDGKAGAVWETFERCTDELAKSGKPVEIRVPV
FT                   AKGLTSKHVDVVKRIVYKFDPEKARVVVNPLVGPPLTEPRDEGWCKEHCYPGRMDEEEE
FT                   RFWASQFPEYKVKVKRWIE"
FT   gene            404841..405545
FT                   /locus_tag="Igni_0459"
FT   CDS_pept        404841..405545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0459"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81642"
FT                   /db_xref="GOA:A8A9P0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9P0"
FT                   /protein_id="ABU81642.1"
FT                   /translation="MPGQIPLIGEKLPEMVVHTDHGPKKLPDDYKGKWLVIFSHPADFT
FT                   PVCTTEFVAFAKRYEDFKKLNTELLGLSVDNSFSHIKWKEWIKEKLNVEIPFPIIADPL
FT                   GQVATKLGMLHPEGGVVTVRAVFIVDPEGKVRAILYYPLNVGRNIDEILRLLKALQVTD
FT                   KLGRATPANWPCNEIVKDHVIVPPASTEQEAKERLQKYECFDWWFCHEKAPAEDVEEAK
FT                   KFLERPAKELCK"
FT   gene            405721..406551
FT                   /locus_tag="Igni_0460"
FT   CDS_pept        405721..406551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0460"
FT                   /product="CRISPR-associated RAMP protein, Cmr4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr4
FT                   family; PFAM: protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81643"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013410"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P1"
FT                   /protein_id="ABU81643.1"
FT                   /translation="MAEELVPALMSALTHVHVGAGRSPGTVDQPIIKDPMGIPFIPGSS
FT                   VKGALKSEALLSRGCAECPKPGEDDEECERLCCLLGPDDGEKGASRIVVADFYPLLVPL
FT                   PSLDKGFIYITSELLLGRAESVGLTEEALKVRELGEERVFVGTEPYVLKKVKFEGEAVL
FT                   SLHPFLKKRGGEAYLVDEENLPLMLEKSLIRLTRVSLDRKTKTAASGRLWTEEYLPHGT
FT                   VLSGAFAYRGWENEYCRSGGVGNWKRLLGLEGPKSLVLGGKETVGKGLVRITLA"
FT   gene            406562..407170
FT                   /locus_tag="Igni_0461"
FT   CDS_pept        406562..407170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0461"
FT                   /product="CRISPR-associated protein, Cmr5 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cmr5 family"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81644"
FT                   /db_xref="InterPro:IPR010160"
FT                   /db_xref="InterPro:IPR023101"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P2"
FT                   /protein_id="ABU81644.1"
FT                   /translation="MSRAERLSPVHLALDHIIKINELWRAIVASEEMKEKNLEGFVRRA
FT                   RQYPSLLAASGLVPSVTFFLSKIIDKDNPDEALRLLVEYLTAEDEDKAKEIMNKMRSEA
FT                   EALNALKEDAGKKESEGYLWFTGALLAALFAFSEAVGIKVQLSDEERFVHEVATFLRGL
FT                   QEGRKEALVLERLLLEYSSELKNLAAAYAGAVWGAKGEG"
FT   gene            407151..408071
FT                   /locus_tag="Igni_0462"
FT   CDS_pept        407151..408071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0462"
FT                   /product="CRISPR-associated RAMP protein, Cmr6 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Cmr6
FT                   family; PFAM: protein of unknown function DUF324"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81645"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010172"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P3"
FT                   /protein_id="ABU81645.1"
FT                   /translation="MLRVRADLKAIKKYVDEVLKGVTQENMKVLKRAVLDELLKIDKEY
FT                   YEEALNLAKELAEAVERGFEKANYSVGRLDLALKTEGLVGIGFGALKAVFEVGLNVDPI
FT                   LGLPYYPGSGIKGAVRAFLEGCAPSEAVEPLLGKSVAEGGQASKVIFADAYPVGCAGKC
FT                   SIFYPLVTTPHYFEGGKVVDNELKAKPVPVVYAGISRNTVFRLIIAVRRDEGVIKDVQK
FT                   LKDSLKDEGGCKIIKGILEKVLSSGAEDPNLPLKALVLITAYVMRRGIAARSQKGFNVF
FT                   EPLDKDLTSDVVYWFDVVGLRSSRG"
FT   gene            408078..411029
FT                   /locus_tag="Igni_0463"
FT   CDS_pept        408078..411029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81646"
FT                   /db_xref="InterPro:IPR024615"
FT                   /db_xref="InterPro:IPR038242"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P4"
FT                   /protein_id="ABU81646.1"
FT                   /translation="MSCEELFARKAAALLHDPPEKVWASFYKHESHEKRAKDAAKEFFG
FT                   EGFVKTLDEVKEHDRLASTVDRWTAVGTEVRGRLNEVSLVNPFDPEFSYKVKMPKIKDD
FT                   AIARYRITLKSILEKVEDSSKGVTRKKYHALYAFMEPAWYVEVGQPLPADSRFPTHTIF
FT                   DHVYATAMMVNIYDPKKNFDGFFVEVEIPEARSFLKGGRGPGDWWARGWLLSNITWRLV
FT                   EELVWEVGPDILLFPTARYNPFYYSLIQEKIPELKEEYERYLKPLGSVKNPVVPPAVSL
FT                   FLPRCAIELMKSYLEDKHPKDLKLDSTKIIKMYFETRLREAWEDFVKKLLEGLNSVGEA
FT                   GLEGLRTFGAEGELGAVLERVEDKPPFEVRVTVIDLRKALTEFNKVLKERSLIRGVKDE
FT                   LRELLAKKYRVRVGPGEDLVKVIKGKVSDKVLPYTRNENDLERDLERKLFFHWLVTSKH
FT                   EAVKGAEDVGVDPRLVDGWSLEEGKRTYESCVRNRPLCACGRPAAVHNPTDKDTKFVRA
FT                   HEALCPYCLALRLAQHVPLAEGLRAPRALTSTLAAAPELACWLIEKGKASAKGARGREL
FT                   VWTLARALLEPPPGATRLNLEALPEELEEKGELVAGLEGFVIRITKEDLRAINSMNKYL
FT                   AVIKSTVDRLDDLKKGRLPYGTEEYFREAVKKGTGSEGGKDLELAIDIIKIVVDFARGL
FT                   APQRAGGGEAGQTVLVTPTYLSQLSYSLMTQALVDAKLIELNFGLPALASGGELVALVP
FT                   ARTRCGPKGLPEELGKLLKDETLLKRVKEDYYSPALWAWWLTRLNHWGLLGEPKGFRRS
FT                   ELFFAPALLAYGRRYGIAIRHFKDPLAKVYEEAEGLEAPLRSTGDWTGVSYGRLGAEGV
FT                   ASPNSLGASRKEEVAERGLGPTTASLAFLNYKGLSNNYYYDLISFVGKYASAGGSSEAL
FT                   EALIEYVLKRNVVSGGEGAAKEALGRLKRALGAGAEGLEHLLEFGFHWHKAAR"
FT   gene            411036..412010
FT                   /locus_tag="Igni_0464"
FT   CDS_pept        411036..412010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81647"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P5"
FT                   /protein_id="ABU81647.1"
FT                   /translation="MISVEPLTGITFRKPGPFGLTQRGPLSVSSTYFMKTTTLLGLLAY
FT                   TKYSEDPSCAEAPEELPLGFSALASCLPCRPLRGPYASVRSQLYFGEERPFNLSALLEL
FT                   WEKGLKEEVEGLAEGRKVLEDGEGLMDYYAKSPDFERVSIISNKLDRRTKRSAFVFVRE
FT                   RLIMSGVEFFFEEEGCGGVREGVYALGSDGGLARVRRKPSNPVEGALKELWGERWGEPG
FT                   AKATVVAVSPIILGFKDPHDPRSHWKGALRDAAPVRLFSRYEVELHPLGWDMKRNCPRP
FT                   FAPAIKPGSAVVGTLEVSPEELYWRGVGELAELGFGSVLPLPM"
FT   gene            complement(412003..413493)
FT                   /locus_tag="Igni_0465"
FT   CDS_pept        complement(412003..413493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0465"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: Lysyl-tRNA
FT                   synthetase, class 1c"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81648"
FT                   /db_xref="GOA:A8A9P6"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P6"
FT                   /protein_id="ABU81648.1"
FT                   /translation="MEWLNKIVDEIIKKRGGRAFVVASGLTTSGPAHLGTLSEFIYPYS
FT                   IVQELRRRGYDAEFVFVADIMDAFDDIPQTLKDKEEELKKHLGKPLAEVPDPYGCHESY
FT                   GEHFLAEFLELMDKFGIKPDEVLRASELYAQGWYDDYLRLFVEQRDKVKKIMEETAMRK
FT                   LPDDWWGFVKPICEKCGRIDKTVVKKVEGDKIYYKCEACGHEGAVEVSSHRWKLAWRLD
FT                   WPSRQDFLGVDAEGGGVDHFTKGGSWDTAKRIHKEVFGKEPPVGFRYGFVLMNGKKMSK
FT                   SKGIGALHEIMALLHPSVIMYFILKHDIKENKNFKMDPRFLMQLYEEYRRVALGEDEDP
FT                   KRRRAWELSGGRVWRAGFADLLVYYQIYRDWKKVGELTGDPQAVKDLAPYVEEWVKRGF
FT                   VPEEYEVTVKQGKVSDPKGCEFLRALAEELREDMDAVEIHNKVYEVAKKVGLSPKDAFK
FT                   FVYKALLDKERGPRAGRLIKAIGVRKAKEMFEKACSPT"
FT   gene            414641..415246
FT                   /locus_tag="Igni_0466"
FT   CDS_pept        414641..415246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0466"
FT                   /product="anthranilate synthase, component II"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81649"
FT                   /db_xref="GOA:A8A9P7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P7"
FT                   /protein_id="ABU81649.1"
FT                   /translation="MRPVLLVDHRDSFVHNVEQIIMEEGFAVATLRQEELSPSAAERLR
FT                   PSAIVLSPGPGNPYAQKDKFETSIRIVNKFKGKVPILGICLGMQIINVALGGTLRKAKR
FT                   VYHGVVDEIVVKDRGPLFFGLPERFPATRYHSLVVDELGEGLVVEALSLSDGEVMAVRH
FT                   EELPLFGLQFHPESIGTLPAGQKIIRNFLALSKPLSLF"
FT   gene            415273..415839
FT                   /locus_tag="Igni_0467"
FT   CDS_pept        415273..415839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0467"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81650"
FT                   /db_xref="GOA:A8A9P8"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P8"
FT                   /protein_id="ABU81650.1"
FT                   /translation="MRTFAFCPRLYFFERHLGKETTLYQRIRMFLGRIWHALLEALEEE
FT                   AEVEVRGELAGTEVVGKADVVKEDAVVEIKSGDGPSDGAWYGDYLQASIYAALLGRKKV
FT                   IIKYRNGERTFEVDLEELERVLELFKLVAEGYLPPPKRSKWCSKCPYKDLCDALGDGWD
FT                   GWFPRLPYVKRAKGVPARGSSRARP"
FT   gene            complement(415787..416476)
FT                   /locus_tag="Igni_0468"
FT   CDS_pept        complement(415787..416476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0468"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81651"
FT                   /db_xref="GOA:A8A9P9"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9P9"
FT                   /protein_id="ABU81651.1"
FT                   /translation="MRRTQRYNGSGFAESCGRLRVAEGVFLLAGPPINDEGQAFLVKAE
FT                   CPFLVDSGAFGEMALQNLLMYEVRPEELEALINTHAHADRAGGDWLFHSLGVTVAAGER
FT                   DAYAIQKGDPIYTASKVIGVEFKPCPVGWVLRGDAEVCGAEVLWLPGHTAGSLGVYYEG
FT                   VLLAGDLLGPLSKDWGSDEGAWRRSLERALSLEPEVMCANNVCFYGREKVKAVLEKSLE
FT                   LGPPWLS"
FT   gene            416495..416935
FT                   /locus_tag="Igni_0469"
FT   CDS_pept        416495..416935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81652"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q0"
FT                   /protein_id="ABU81652.1"
FT                   /translation="MKTELLDETLLLKPIDGVALTLSMGDAKKYMIKKEVTVFSPDDPE
FT                   DVCSTALKYAQFWRTALNLRGERFGWCDEEDFSARYLAGTKGKYAVVVECADVTADPER
FT                   TSGSGFAPLGHVLPLVFYAVLCKAYVVRAKSLEELMEWVPAR"
FT   gene            416932..417516
FT                   /locus_tag="Igni_0470"
FT   CDS_pept        416932..417516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0470"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81653"
FT                   /db_xref="GOA:A8A9Q1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q1"
FT                   /protein_id="ABU81653.1"
FT                   /translation="MSVIAEGVTVAYGNKVVLKDVNLVLGPGKYWLSGPNASGKTTLLK
FT                   TLSFLIKPVKGRVVAFGKEDARGEVVYVPPSPVLLKGTVLRNLEFGVRIRGSGDPLWAA
FT                   KKLGIEDLLHEDVSSLSSGQAALVTLGRALAVRPRALMVDEILSYLDEENKEVALKALD
FT                   EAEVVVIASHEPLNLPRIRVKGGRAFLERAV"
FT   gene            complement(417479..418129)
FT                   /locus_tag="Igni_0471"
FT   CDS_pept        complement(417479..418129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0471"
FT                   /product="ABC-type tungstate transport system periplasmic
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81654"
FT                   /db_xref="GOA:A8A9Q2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q2"
FT                   /protein_id="ABU81654.1"
FT                   /translation="MGGAGEVAELVARSLWISGTAVALASSWSIPLTFLIVRYKALRPL
FT                   LSFFEGLVGVPTVLVGLFLYDLICPKCPLGSLGLLYTPYAVVLGEALLVTPLIVATSHS
FT                   ALNWAYQNYGELARTFGADEVKALLASAAEVVEELAGSIAMAFSRAVGELGVALIVGGN
FT                   IEGYTRTLSTAIALYAQMGEYEKATELGLILTFLSVGTSFVVKRLSRGRPSRP"
FT   gene            complement(418108..418971)
FT                   /locus_tag="Igni_0472"
FT   CDS_pept        complement(418108..418971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0472"
FT                   /product="ABC-type tungstate transport system permease
FT                   component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81655"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q3"
FT                   /protein_id="ABU81655.1"
FT                   /translation="MDKRALLALVAALAVAVAVWVLYPKPHNSLKVSTTTSLYDSGLLG
FT                   ALSSYFKKESGTELQFLVVGSGQALRLAKDGAVCLTLVHAPSLEKKYSDYLTDHIIFAY
FT                   NYFVIVGPKDDPAGIRNSTDAVEAFKKIYEAGERGEATFVSRGDMSGTNVKELSLWKLA
FT                   GLDPKGKEWYKSTGSGMAKTLIVANDLKAYTLSDISTFLKLKKEGKLDNLEILYSNSTE
FT                   LINVYSAYRVKGCNDPKALEFLKFLKGEGQEIIASYGKEEFGVPLFYPAEGKEAWLSQI
FT                   WEELAK"
FT   sig_peptide     complement(418915..418971)
FT                   /locus_tag="Igni_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.641 at
FT                   residue 19"
FT   gene            complement(418991..420352)
FT                   /locus_tag="Igni_0473"
FT   CDS_pept        complement(418991..420352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81656"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q4"
FT                   /protein_id="ABU81656.1"
FT                   /translation="MEVRGEVPGLDGNKLKLGLKGKVLLKGKEGERGKFGDKEFVFQVP
FT                   EVGALGKVNGVVIIYILGKGEYRGKVYGQRVEGRSEGEATFPVFPVGGAKASLEVGGIY
FT                   LEKELPHPDELSELDLDFPYSVVEVGEALKVKFEAPFYALDGERLEGERELPYGTVALY
FT                   QGVPEPLRRFKSEKVGEIWLGSVERAFKVRGGAVVHTSRTTVIIKDGRVRDLGIKTSCY
FT                   YDDNLYSIGDKAFVDGRRLELPSEPFSCVRFANKAIFSIPSRPVTSTLTLLSPTVIVAI
FT                   GPSSVPWKVPWSAFEKAKLYVAEEDYEVELSQGAYALYAGERLYAYNLFGEALAFDREL
FT                   RKVWRRDSNGVRDLDELGDKVAIKTFAPPRVRLYEGRKEVLKVHTSRTSSACLSDRALF
FT                   VLDGNKLRLFLLDKGFYELVSKVEPGELCAASGDLIAVISKEKVSFWKPLIRFA"
FT   gene            complement(420400..421155)
FT                   /locus_tag="Igni_0474"
FT   CDS_pept        complement(420400..421155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81657"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q5"
FT                   /protein_id="ABU81657.1"
FT                   /translation="MKVALLLALSALAALAMTCVSEDPDLRKACEEVAPKVEALWGKAR
FT                   ARVELRLGEANYASGVPGLHEYAVSLRELNYCTLAHELTHVIEMERGAYWPLWFAEGLA
FT                   ELSCYLLYPELYKRSGYAEWVTRGFGDLSPYFFGLTVLYYLYVNGEDVWSARKMSLYEA
FT                   AKVFAEAVSSGVTPYGVVPVPPPFGEVELEEGWAYGGSPSGEYWKFGKVEVFYGPGKVS
FT                   YLPFLALVLPPSWLRKCGRVVGRSARRRE"
FT   sig_peptide     complement(421090..421155)
FT                   /locus_tag="Igni_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 22"
FT   gene            421334..422815
FT                   /locus_tag="Igni_0475"
FT   CDS_pept        421334..422815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0475"
FT                   /product="Coenzyme F390 synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81658"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q6"
FT                   /protein_id="ABU81658.1"
FT                   /translation="MLSGRAVVFERYSRATPLGAYLEEGRRFREEGFIRTDYPPKRDEV
FT                   LWNPKIMRMPREELEKIKTQRLKAIVKWAWEHSEFYRKFWKSKGFHPDMIKTHEDVVKI
FT                   PVLTKKDLRADLQKNPPYGTIMVPELAKYIHFVGATSGSTGMPTFQGWGRVELDYFEEQ
FT                   QARYLWTFAGVKPGVVYANYLNMSGFYSWGPPLVETAMWRCGATAIAGGGETFFTWKDR
FT                   HMLIMKLWKVDVFATTPWLHRWIGEQAKLEGWVTPFKVLLLHGGAAAEKTKEKLMEVHP
FT                   NVEKVISVWGTTDGHMAIEPPDAPGTLVFWEDTQIFDIVVPGSYEERPEGEPAGQGERG
FT                   ELIATLLTHYTMPLIRYSLGDYVKNEFICDPTPELGITHCRFAELIPGRVEWMFKVKGK
FT                   LLFPIVVENAVSQIPDTTGAYNIVVYDDNMDKLKIKVETRKPIPPPPEYDKEAREIIAR
FT                   ELGLSPEDVEIEWIRPGESVWKGYKLQVFLDERKK"
FT   gene            422877..424103
FT                   /locus_tag="Igni_0476"
FT   CDS_pept        422877..424103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0476"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="TIGRFAM: 3-hydroxy-3-methylglutaryl Coenzyme A
FT                   reductase; PFAM: hydroxymethylglutaryl-coenzyme A
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81659"
FT                   /db_xref="GOA:A8A9Q7"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q7"
FT                   /protein_id="ABU81659.1"
FT                   /translation="MDELEKYVEMLEKGELSLSKLDKVLNPNLAALVRRRFLEKRIGKL
FT                   LPGIASTILDFEELVGRNIENPIGAVQIPLGIAGPIKVNGDYAKGEFYVPLATHEGALV
FT                   ASVNRGMKAVTLSGGANVKVLKDGMARAPVFRVPDVATAQELVEWVKEHFNEIKEVAES
FT                   TTRHGKLKEIQPFVMGNNVWLRFVYFTGDAMGMNMATIATEKACEYIEENFGRAQCVAL
FT                   SGNMCVDKKPAHLNVLLGRGKYVVAEALIKKEVLEGVLKTDARSVHEVNERKNWAGSAF
FT                   AGSFSYNAHFANIIAAIFLATGQDAAQIVESSMGFTWTEVRGEDLYISVTLPSLEVGTV
FT                   GGGTRLQTQREALEILGVAGGGDPPGTNALKFAEIVGASVLAGELNLLAALAARQLARA
FT                   HERLGRGKG"
FT   gene            424100..424921
FT                   /locus_tag="Igni_0477"
FT   CDS_pept        424100..424921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81660"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q8"
FT                   /protein_id="ABU81660.1"
FT                   /translation="MRLELEGKELAALSWGAAVGAKYEGGGFATFFDENVKNELSLEEP
FT                   AELVSCEESVCATYYGTKILITSYGTPLREFEVGVAPNWVLLDDKVVYLTYEEGVVAYS
FT                   LEGKRLWRGLYGPARGAARAKGLIYVGTPFGALALSHEDGKVVKEVELGNGSWRVTSSC
FT                   GSTLLLVNDEEASALALLAVKDLGDPEPVGEVKGVTGTPWISPDCLYVAVPSCGVSVFD
FT                   LRGNLVFSQSLEGNSDECYGVQAHWGEKLLVGVVDEGLMKSYVLTYEPFSR"
FT   gene            424991..426523
FT                   /locus_tag="Igni_0478"
FT   CDS_pept        424991..426523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0478"
FT                   /product="tRNA-guanine transglycosylase, various
FT                   specificities"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; PFAM: Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81661"
FT                   /db_xref="GOA:A8A9Q9"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Q9"
FT                   /protein_id="ABU81661.1"
FT                   /translation="MIWEPEARDGPARAGKLKVGAYEVETPALLAVVDPDPKKQLVPLD
FT                   EMRRAGVQVIMTSAFIAKKKVGPTNLKERLGWEGLLYTDSGTFQAYSRGVRVDPEESVR
FT                   YQISAGSDIITPVDLFSLPTDSKEVAAKKAEVSFRRWLRARELKEEVSAPVQGGLYPDV
FT                   RAAVARRYSEAGARLLAVGGIVPLMEEYKFKELVNAVLPVLASRPPEAAVHAFGAGHPL
FT                   AFPLLAFLGVDLFDSAMYAIAAREGRYLTPFGTFRLEELVMMREFPCDCPACSSLSPRD
FT                   LLSMSEEERTKFLALHNLYAAIKMVKEIRERIVYGTFHKWAIAFAHSHPRLYEAFAEAL
FT                   GKWRGYFERERNALPKSPVPEGCELCDSSPERDPVGEGTYGTRELFNVIAKRAYGKGLS
FT                   SEEPLEALRPPRASFSPRALRELCSVTLNSPPKGRAIRKKDLKEVNCLLRPNHEVLVLW
FT                   EGGEAKAVSLVSFAELSLASEEAVALLLPPEGLHGVKLGGLVGRVEAGDHGG"
FT   gene            complement(426443..427621)
FT                   /locus_tag="Igni_0479"
FT   CDS_pept        complement(426443..427621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0479"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81662"
FT                   /db_xref="GOA:A8A9R0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R0"
FT                   /protein_id="ABU81662.1"
FT                   /translation="MKYAELFLMSLKDMKSGGLRSLLVVMSVAVGAAALIAFVSQAEGL
FT                   RVNVERQFRGLAANVIILSARERPFSLEDALAFKAVEGVTDVFGVSVFRAKVSASGKVW
FT                   ILTFVGLNEKAFFSLFPSAKPRLGRFSLAPGTAVEGWQVAKEVLLPPGTVKFQVGKEEY
FT                   YVTVVGALESLGSSLFGFNPDKSIMVSEELGTRVVGGYNVLYLVAESPSKTKEVLKRVR
FT                   PLAELMDAEATAPLSLINMYSSAAEFAERFLFMMSMIAFVASGFGIANTMMITVLERRS
FT                   EIAVMKAIGYSPRDILLYYLFLASSFGVVGGAIGSVIGYFLADAVNKYVNVIGAQLKSY
FT                   IQAEFLKTAKAYVSPQLVAEAALFSVLTAVVAGLYPAYKASKLDPVEALRGE"
FT   sig_peptide     complement(427493..427621)
FT                   /locus_tag="Igni_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.925 at
FT                   residue 43"
FT   gene            complement(427618..430452)
FT                   /locus_tag="Igni_0480"
FT   CDS_pept        complement(427618..430452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0480"
FT                   /product="S-layer domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81663"
FT                   /db_xref="GOA:A8A9R1"
FT                   /db_xref="InterPro:IPR036238"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R1"
FT                   /protein_id="ABU81663.1"
FT                   /translation="MVTLALVWAAEQKPLPPSPVYLVPERANLTLGHLGSVRLKVCNPS
FT                   VTLISYATFQLATEDAAVTPSTFSVGDLRPRQCKEVILNVLPLKEVIRLSFVASAAYAL
FT                   GNSKALGATSGSLTLFVRSPQLVMEPVEVSEVGGNVTLKFRNVGEAPFKGNIVITKPFF
FT                   ATLPLEVPPGGEGAAKAEVPPTSPGKYEVEYKARYGKAELEGKGLMIVNPDPRVTFKLG
FT                   KVIEVCFPRKQQFVIRLFSRNAAPEPDSFKLELKGCTTLNYTVTPSSLPFTLSAVAKAG
FT                   NLVLNDSVAMSYCDVSFNATELWAGVDNAVEVKVNCPLPVKGAVTLEPSPGAVDPPTLP
FT                   LPGGAFVWSLPTSAKEAILKVKMFGKTFAYNFNVKPFNPEFTVTFEPRSVVEGSVVRER
FT                   MCVENAWNKAVKDVIVKVEVSNWSSVATFDEVAPSQRVCLEGLVAVPWEVESLKAKVKI
FT                   VAGSYSLEREEELEVKPNPEVAVPAIELETKSLGVGKDVVTIRVKNVGRGYAKGAGLSL
FT                   SSPYLLYPSYVYLGDMPPDSSKVINATFFVPKDAKSVKLNAALSYCSGPLGGTCLPSQL
FT                   KKEFEVPVRNYVPPNLVIAVKGEKLRGGKSNAVYVELANSGGDEARSVTLSASSGDSDV
FT                   TPSYFMLGDIPPGKKVTLKLFVTPPERAEEAELKLEARYTDPWGSSYSASFTKKFKVVP
FT                   KPSPHVAVNMLTTILKTGKSVLRFEVFNDGEVPAKGVELYVYSSGLPLSKSSFFIKELA
FT                   PGQRALVEVPCSPNYPGTYSITVRVRYGNVSDTFNYKISVATGPVLKVHDAATFPEELS
FT                   PGSSGILGFSLANVGDQSAADVKISVEAKGIRFTKKTLFLPRLSPGADVPAVFPFEVPA
FT                   EAEPGTVPVTLKVSYLFQGEKYEKVFSASVIVKPRVKLSAESLGPEAMALALVVPIILL
FT                   LLIKRRRSKTVVIE"
FT   gene            430537..431124
FT                   /locus_tag="Igni_0481"
FT   CDS_pept        430537..431124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0481"
FT                   /product="endonuclease (RecB family)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81664"
FT                   /db_xref="GOA:A8A9R2"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R2"
FT                   /protein_id="ABU81664.1"
FT                   /translation="MRRARSERLAEEVLRSMGFEVVSVNAPVKVGDKEVAEVDLLVKPP
FT                   PGPLAVEVKSGKVDVSAVRQAYANAKAIGAEPMVMGSGWANEEAKLLADKLGVKYLMFE
FT                   DVMVASKEELYDVVKGAVTEVLVRFINSLYPDERACVIAEAGSLEEAEKALGKEELRKL
FT                   LKRMGRAGGSEAVLAAARLSCLLWKLLKGVKG"
FT   gene            431121..432308
FT                   /locus_tag="Igni_0482"
FT   CDS_pept        431121..432308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81665"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R3"
FT                   /protein_id="ABU81665.1"
FT                   /translation="MTCRTLVTHVEPDVGGTSVYALVGAKGQCSEVRAPKILRDVVSRA
FT                   KTYKIQVIKKIKNAPKKVTYEDGYLKFLCEKECSFVVKAWALTGVPVTPFVTDVDIVTN
FT                   MKNVFTFNIKATKVRERGGVLGLQNLGSAVAIDVRTFDPLSNFKALLVEPLSAPRRSFY
FT                   AYFPDGSLYLVGPDVKERIAVVRDLMDVVSFPYGYLTSIIRKDKVDVISKRKGTWTILK
FT                   RVEGAAKSAEWCLVDSTPALAIYYEDHISLVTLREEIINIAVEGWRAASLSPNAELLLL
FT                   STGEGVKLIDLNSGEKLKEFKLKGVELISWSPYSDFAALCSKEACWIYSNLSKEIATVR
FT                   KVSNATSVWWSPSTYNLYVARGNKLEITFFDPPGVKATLLVARRPILRETSRERT"
FT   gene            complement(432244..433002)
FT                   /locus_tag="Igni_0483"
FT   CDS_pept        complement(432244..433002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0483"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; PFAM: TrkA-N domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81666"
FT                   /db_xref="GOA:A8A9R4"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R4"
FT                   /protein_id="ABU81666.1"
FT                   /translation="MRARPEAIDERMRVPLYVEASKLTVVVFGGGKVGTRRAQKFANAG
FT                   ARVRVVAKEFSEDLYYLNVELVKSDLEREDEIRKLIEDADIVVIATNNKEVNDKIFRIA
FT                   KEMGKLVNDATEASRSDVHVPFEAEVDGIRIAVTSEGASGVAAHVALALIERCLKSNEF
FT                   FKRINEFARRFKRELKELIDDPKRRFGLYWYVMLQRDIIEMVREGKIDEALEKALAIAK
FT                   SYEGEGMTDVKYALGKFLEEWGDELLRAWP"
FT   gene            433214..433750
FT                   /locus_tag="Igni_0484"
FT   CDS_pept        433214..433750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0484"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81667"
FT                   /db_xref="GOA:A8A9R5"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R5"
FT                   /protein_id="ABU81667.1"
FT                   /translation="MLDDKTRVKLSKKMTYLLRHKEGFVDPEGWASLDSLVRELRKFFP
FT                   WVSKEHVLEVISKDDKGRYELRGDKVRARYGHTVKYVRPTLEESYETLLYHGTSCEAAR
FT                   AILKEGIKPMKRNFVHLTTSLEEAIENARRKGKCIKVLIVDGECLRKRGIKIYKAGKHV
FT                   RVCSYVPPECVVGEA"
FT   gene            433797..434285
FT                   /locus_tag="Igni_0485"
FT   CDS_pept        433797..434285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81668"
FT                   /db_xref="GOA:A8A9R6"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR024956"
FT                   /db_xref="InterPro:IPR038469"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R6"
FT                   /protein_id="ABU81668.1"
FT                   /translation="MRVEGPVIVRMDGVSFGKYSKLLGKHRDERLHNALVSSAKELVEY
FT                   YSCDSAYVSSDEVSVYCKLPPFGGRVEKLVSVFSSFLGSHFSVKVSPLPPGWFDGRVVL
FT                   AGDWKAYVMWRLKVTVCNYASSVARKPCSQALKEVRLPPEAFGTLLERVEVLKKGYTR"
FT   gene            complement(434361..434834)
FT                   /locus_tag="Igni_0486"
FT   CDS_pept        complement(434361..434834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0486"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81669"
FT                   /db_xref="GOA:A8A9R7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R7"
FT                   /protein_id="ABU81669.1"
FT                   /translation="MKGNVLYCEMCGRPIYGKAYRVYIEGAEMVLCESCFRSVKAKVAP
FT                   LPKKERKAAPKPKTKKVVEYVVVEDYAERVRKARERLGLSRRELGMKVGEHETVIKRIE
FT                   LGRLEPDLELARKLERVLGVELVKKVEYEESEAPKFQGPAELTLGDVAVLRKE"
FT   gene            complement(434882..436429)
FT                   /locus_tag="Igni_0487"
FT   CDS_pept        complement(434882..436429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0487"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81670"
FT                   /db_xref="GOA:A8A9R8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R8"
FT                   /protein_id="ABU81670.1"
FT                   /translation="MSAVSLENLIPLTYLEFLDLESGGSMTSGMGAFLAGLRATFNNPL
FT                   TRTLLRKASKRVTCEIGGRTVTERVSFFAMAEYAGEKVSCPSAILTKSFIKFTISTIAK
FT                   LFKVKEEEVKAALSDPAVRRGLALVLEGLALYGVSVPQKFPAPFLVVWNFTNMCNLRCK
FT                   HCYQRADKPLPNELTLEEKLNVVEQLDRAGVAAVALSGGEPTIHPHFWRVVKELSDRFI
FT                   YVAVATNGWLLADKRMAEKAKRAGVRYVEVSVDSADPKKHDEFRGIPGSWKRAVKALKN
FT                   AAELGMNAAMATTVTRLNVDEVDDILDLAEEIGIKRVVFFNFVPTGRGKEIIDLDLSPE
FT                   EREEFLKKIALEMKRRNLEIVSTAPQFGRVCLQAGLGIVAPTHMYVGKPEELDMDKVIS
FT                   ALAEFVGGCGAGRIYAALEPEGTVTPCVFLPVPMGNVREKDFREIWETSELFQKLRDRN
FT                   NLWGFCRTCPYREICGGCRARAYGYFNDPLAPDPGCIYNKKYYEQLKSKALVATSGR"
FT   gene            436476..437579
FT                   /locus_tag="Igni_0488"
FT   CDS_pept        436476..437579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0488"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81671"
FT                   /db_xref="GOA:A8A9R9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9R9"
FT                   /protein_id="ABU81671.1"
FT                   /translation="MSWLLLRPDSVAVWKDPAVNERLSWYKDVMLNRAQAKFLIAKSIA
FT                   AEARPEELSERELWELHSTLREEFERRWEEAKRGKWFKEVKNNFLDVKVELAKRLLGPP
FT                   CRLCERRCPVDRRKARGACLVDHKAYVHSAFLHLGEEAPLVPSGTIFYGGCPFKCVFCQ
FT                   NWDISQERPTEAPALGPEELARVQERLRREGARNVNHVGGDPIPSAHIIIESLKYLKVN
FT                   VPQLWNSNMYMTEELLELLLDIIDIWLPDFKYWDDRCAWRLSGVRRYREVVTRNIYKAA
FT                   QKGDMIIRHLVMPNHLECDTFPILEWIAENVKDKVLVNIMEQYRPEYLVLKFPQRWPDI
FT                   ARPVSAEEVEAARKRADELGIVWRPVS"
FT   gene            complement(437572..438114)
FT                   /locus_tag="Igni_0489"
FT   CDS_pept        complement(437572..438114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0489"
FT                   /product="Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81672"
FT                   /db_xref="GOA:A8A9S0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S0"
FT                   /protein_id="ABU81672.1"
FT                   /translation="MFHGYGSSPTRIKWLVKAFKEVADEVIVPTLPSVLAKAWEATKEL
FT                   EADVYGGHSMGGALALLHSASKGRPAVAVAPPTNLRKQLAHLKEKFPKIYEDITSQVDE
FT                   EVMIELSPINMEFKAPILVIHGTEDKVVPLEQSLEFCEKVKECHLVVVDGMGHKPVTEA
FT                   EKELVRRHVVEFLRSLS"
FT   gene            438199..439212
FT                   /locus_tag="Igni_0490"
FT   CDS_pept        438199..439212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0490"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81673"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S1"
FT                   /protein_id="ABU81673.1"
FT                   /translation="MSVTLAVGGGGRETEEFIKNFILPLFKIRSLGSVGLDDLEDGAAV
FT                   PIGDNKYLVVSVDSYTVSPPFFPGGDIGKLAATGSLNDVAVMGAEPKALMDAIIVEEGF
FT                   KLSDLKTILKSMSEVTNSLNVALLGGDTKVMPKGSVDKIVISTVGIGIAEGPLLTLDRG
FT                   EPGDKVLVTGPVGDHGATILALQFGLQVKTLKSDVRPVWPAVKALREALGEDLKAAKDP
FT                   TRGGLAMALNELAERSKTTVYVEEARVPIREAVKEYAEMLGVEPLALASEGQAVFVVKG
FT                   DRAEEALEVLRKAGFEEAAIIGELRKGKPGYVISRTPVGGLRLLEKPSGELVPRIC"
FT   gene            complement(439214..439801)
FT                   /locus_tag="Igni_0491"
FT   CDS_pept        complement(439214..439801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81674"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S2"
FT                   /protein_id="ABU81674.1"
FT                   /translation="MGALCSLILVVHNVTLNGLALQYLGYWNDTLELPLTLPNFCYRAR
FT                   ADGALVEVWREGEACAQSLRSVRLFIKIKNETTLVLRYDNSSITFGKTYLFCSNNTARL
FT                   VELVKDPEEFSNKTLKLKLLCLGHSRPVNLPGPPGGPLSKCDSVVTDGTAWVYAAGLWC
FT                   PEPEEVVAIAKAVARGSAPYLEVKEVLRKEPR"
FT   gene            complement(439846..441450)
FT                   /locus_tag="Igni_0492"
FT   CDS_pept        complement(439846..441450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0492"
FT                   /product="ATPase of the ABC class-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81675"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S3"
FT                   /protein_id="ABU81675.1"
FT                   /translation="MRARLGSAVDVEKILAKIDGRGYKAYKELKGVRFSVGRLAFEVAR
FT                   VQGDPFAPPSVVRAEAPARCDLPLPAEDYFLRKLYASLRAYSSKMGEGKSGLLAVPKPS
FT                   NAILRRSSVKCFGNKIAFRIWVGLPSRGRRVLADRASELLLRKLPKAVEEALSRDEDLE
FT                   RWNKVWKVQQEIRKKMAEKGLIAFVADGSVLPRRCGDCEEPLEGAVPFESPPSLRVEIE
FT                   TNEGPISGMGVRKGITSVTGPAFHGKTTLIEALAKGVWDHIPGDGREFVLSDKNMFYVR
FT                   SEDGRRVAGVDVSTFIKLEGSERFSTDDASGATSAAASFQEAVEAGSRALIIDEDYTAT
FT                   NFLHFDERLNEIYDIKTVETLSEKLESLKEFGLSLVLVSGGSAPVVARSDTVIYMKNYK
FT                   PHDVTERAKRIEVRAPPSEYSPPRARELRRPGAEKVKVRGPWLESKSWKSPVKTEANVH
FT                   LEEEGQLNFLAKLLERPFSGKLRDLRVPDPWDACAGPECSEVRALDLAFVINRAPDLEA
FT                   VSWEAMTTLGRQRAPRE"
FT   gene            441490..441777
FT                   /locus_tag="Igni_0493"
FT   CDS_pept        441490..441777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81676"
FT                   /db_xref="GOA:A8A9S4"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S4"
FT                   /protein_id="ABU81676.1"
FT                   /translation="MNDDLYLLALMTAATLAGVLTALAATFILNKKKEEEKKYVTVVKC
FT                   PNCGYEEKREWREGDFVGMVEGPCPKCGGMRVVWNIYLEDREEERPKGEP"
FT   sig_peptide     441490..441564
FT                   /locus_tag="Igni_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(441761..442219)
FT                   /locus_tag="Igni_0494"
FT   CDS_pept        complement(441761..442219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0494"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family;
FT                   regulatory protein, ArsR; helix-turn-helix, Fis-type;
FT                   Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81677"
FT                   /db_xref="GOA:A8A9S5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S5"
FT                   /protein_id="ABU81677.1"
FT                   /translation="MRGHKDLDELDYKILSLLMENARKGVREIARELNVSPATVHNRLK
FT                   KMLSKGIIKGFVPLMDFSVLGYQVTAIIMLSVEGSKLKELEEELKNIKNVIAIYDITGD
FT                   YDVLLIAKFKDVKALDFFVKDLLERKEIKKSVTHIAFNVVKEDFRVPL"
FT   gene            442365..442931
FT                   /locus_tag="Igni_0495"
FT   CDS_pept        442365..442931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0495"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81678"
FT                   /db_xref="GOA:A8A9S6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S6"
FT                   /protein_id="ABU81678.1"
FT                   /translation="MAVLNFGRCYIKSYLARRIQECGLVKRGTFILSSGKRSDVYVDMR
FT                   KLWSFPKLARLAALLMSALIRSKVEYATIVGVATGGIPLAAHLSVTLGWPMGYARPKRK
FT                   EHGQMRLVEGVEPGQKVVVVDDVTTTGGSLAKTIDALRDFGAEPVLAAALLDREEGSVE
FT                   EIEKRGVEFIRLLTLNQVLRGLRCE"
FT   gene            442922..443911
FT                   /locus_tag="Igni_0496"
FT   CDS_pept        442922..443911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0496"
FT                   /product="methylenetetrahydrofolate reductase"
FT                   /note="PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81679"
FT                   /db_xref="GOA:A8A9S7"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR022026"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S7"
FT                   /protein_id="ABU81679.1"
FT                   /translation="MRVICPKKMLNGPCGGVRGELCEVDDFKCPFVEAFRNLRSSEYLK
FT                   PLLDPGFKVGCEVVEVEPSPYVKKLEDFAVSAEVEPWGPEELERASKWRVDALNVTDNP
FT                   LGLPHLDSVWASAALASKGKEVIAQLTCRGRTREALASSLLALDASGVNNVLALTGDWA
FT                   PNAAFDLDAVRLVCLVQALRKGVDWEGRKTRRVRLSVGVASNPYFSYEEKRLLRKAHAG
FT                   AQFAQTQPVFKKELLYKIKKYPLPTVPSLLLTTSRKVVRALMERGVDAKEFYEELVKAK
FT                   REGKADELVLKKSLEMYEEAYSSELPGVHLMAPGRPDLLERFLELLRL"
FT   gene            443937..444722
FT                   /locus_tag="Igni_0497"
FT   CDS_pept        443937..444722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0497"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81680"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S8"
FT                   /protein_id="ABU81680.1"
FT                   /translation="MEWRPRHYIKVTDYASKSVIKVLPADSLLDAANLMIRFKIRHLPV
FT                   TDTEGRVIGLIGIRDVADALLKKGRERLEEEKVVDWMNDQPVKVSEDVSLHKAVELMLE
FT                   TGVGSIVITDDMDVIKGILSEKDVVKFLSVVPSIEAVANVASPISTYVLAGSSVREVLE
FT                   LMMELWSKHLVMSREGKVVGVISMLDLVKKALEDGLSAPADDAVKRTEVLPPEAPISLA
FT                   AAIMVSKNKEALLVGRKEPDSIVTEKNMVRGALEVLSKL"
FT   gene            444719..445285
FT                   /locus_tag="Igni_0498"
FT   CDS_pept        444719..445285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9S9"
FT                   /protein_id="ABU81681.1"
FT                   /translation="MIVALGRGLEAYIIFKGEVLAFEPEGGEGLFTGSPPRFLKPSGAG
FT                   SRGPFSWRPLEFEGLRGRVTGYEVLVGGTRVVYAGGAKEPFSVEADVILAPAGGGWYMD
FT                   AKGFCKTLRMSKFKVAVPIAVWNPGTNLPLEGIEEVRNECRGFNRVRAMGSWKVHFKGG
FT                   KATVALIEPGRPQLIIKKLLKSGRL"
FT   gene            445302..445745
FT                   /locus_tag="Igni_0499"
FT   CDS_pept        445302..445745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81682"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T0"
FT                   /protein_id="ABU81682.1"
FT                   /translation="MNAADQRARLAKERRAVLEYLALKALANKKNVLQALYEYLVLNTS
FT                   PSEAAKKYGINKTQLKSTAYQLMSKGRPALVVKLMKLAWPYIMEIEPLVENNYCKACNS
FT                   VIHTNHAEPHIAVRHQDIIQKTALEVERKLKEAIKAKKQVVRA"
FT   gene            445840..446418
FT                   /locus_tag="Igni_0500"
FT   CDS_pept        445840..446418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81683"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T1"
FT                   /protein_id="ABU81683.1"
FT                   /translation="MTYTVVARKGAELASLTVSPSPGVGRRAVWWGPKGVVVVQGYSSR
FT                   ELAKAAYERIDDPEEALEVVLNDPLAGYRQAIVVPREGEVQSFTGVGTLPAKGFVKRRL
FT                   GELELYCIGNGLANAKVLTSSCSTSSNDVLKAVFEVARVAEAYGGNRPGSKSAALVYLG
FT                   NFSFFEEVLKSESPVHRLWAELVAPTPLY"
FT   gene            446457..446681
FT                   /locus_tag="Igni_0501"
FT   CDS_pept        446457..446681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81684"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T2"
FT                   /protein_id="ABU81684.1"
FT                   /translation="MRRGMTDLAIIAFAVATATFMLSMIMIGAMNAHMNQMEKQVEVLS
FT                   KNLDAMKVQVQALRAQLEQLIKYSPLYNG"
FT   sig_peptide     446457..446552
FT                   /locus_tag="Igni_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.661 at
FT                   residue 32"
FT   gene            446724..446936
FT                   /locus_tag="Igni_0502"
FT   CDS_pept        446724..446936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81685"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T3"
FT                   /protein_id="ABU81685.1"
FT                   /translation="MSFFFSFIKKEIEATIKEAVLPLGELEKIYSFKDAQDLDSKALAI
FT                   AKALGVDDEEDLINAIKRALSGKGR"
FT   gene            446933..447364
FT                   /locus_tag="Igni_0503"
FT   CDS_pept        446933..447364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81686"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T4"
FT                   /protein_id="ABU81686.1"
FT                   /translation="MKRLLGYVSSTACEDSLKLHIIFEGPLKEKLAKKGVEVVDASIDA
FT                   MAFADVLRSKEPEEVLLVGVKKRGRAPGFYLWRPEELKVEDTYALSKLAQATLTGWLDV
FT                   DALIDGLRVFAPEYVSRIRVLECEPPCGDWERALEEVLE"
FT   gene            447361..447903
FT                   /locus_tag="Igni_0504"
FT   CDS_pept        447361..447903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0504"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81687"
FT                   /db_xref="GOA:A8A9T5"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T5"
FT                   /protein_id="ABU81687.1"
FT                   /translation="MRRALVLGLGNRNLGDDAVGSCLAEALAARAPEGVEVKDGDDMGL
FT                   GLLGFLEGYDLVIFVDASPDVEDVEAFLIEAEKAELEEAREMVQDSHKAGPVALAVLAK
FT                   KSGLFQGKAYFVAFKPESLCFMCKPSEASLERALKAAELVNKLLQKEGFPQFDLEGLRL
FT                   DLIRTCEKSSVEASWAV"
FT   gene            447891..448148
FT                   /locus_tag="Igni_0505"
FT   CDS_pept        447891..448148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0505"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81688"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T6"
FT                   /protein_id="ABU81688.1"
FT                   /translation="MGRLTKVVLDAVKPIKGPSIVDVSKELADAGGVGKVIIRVDEVDV
FT                   GSITMTITIEGNDIDFDKVVDVLERLGVVIHSIDEAEAEP"
FT   gene            448145..449059
FT                   /locus_tag="Igni_0506"
FT   CDS_pept        448145..449059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0506"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81689"
FT                   /db_xref="GOA:A8A9T7"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T7"
FT                   /protein_id="ABU81689.1"
FT                   /translation="MRCAVCGKRVVAKDYSGRPLCEEHFLQSVVERAEKELEGVNSKIL
FT                   LAVSGGKDSLVLMDVVAQLRDPKDLVAATVVEGAPGGYRVKEAQVAKRFAEKLGIKHIT
FT                   ITFKELFGKSLEEMVAKGKLSPCTYCGVFRRRALEVLARRLGAVVATGHTLDDEAHTAL
FT                   LNLLRGSWDDLLRLNAKSRIKPLRKVYEREVSIYAYIKKFPFQSEECPYIVRRPSLRGR
FT                   LREELFEYERERPGTLFKWRERFEGLGEPKRRFKLCERCGFPTSPNRRVCKVCELAEEV
FT                   GASVPRLEEHLQVGLLDDLGVRE"
FT   gene            complement(448994..449515)
FT                   /locus_tag="Igni_0507"
FT   CDS_pept        complement(448994..449515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0507"
FT                   /product="adenylate cyclase"
FT                   /note="TIGRFAM: putative adenylyl cyclase CyaB; PFAM:
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81690"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T8"
FT                   /protein_id="ABU81690.1"
FT                   /translation="MELEVKLRVRDPERAREVIKGLAQFAGEAEEEDVYFNFDCVGGCC
FT                   RNFAETDEAVRLRRRGDRCFLTYKGPKKVVEGVKGREEIETEVGSCEKLKAFLEKLCLK
FT                   PVAVVRKKREYWKAKGATITLDYVEGLGYFVEIESEGAGPEELKELASLFPDAEVVEKT
FT                   YLEMLLESGH"
FT   gene            449583..449777
FT                   /locus_tag="Igni_0508"
FT   CDS_pept        449583..449777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0508"
FT                   /product="Protein of unknown function DUF1610"
FT                   /note="PFAM: Protein of unknown function DUF1610"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81691"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9T9"
FT                   /protein_id="ABU81691.1"
FT                   /translation="MASESSVARPPVCSSCGRLVVPLEKEVGVHFRCPNCGEVIIWRCP
FT                   KCRKQSKPYRCPRCGFEGP"
FT   gene            449781..450065
FT                   /locus_tag="Igni_0509"
FT   CDS_pept        449781..450065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0509"
FT                   /product="translation elongation factor 1B (aEF-1B)"
FT                   /note="TIGRFAM: translation elongation factor aEF-1 beta;
FT                   PFAM: Translation elongation factor EF1B, beta and delta
FT                   chains, guanine nucleotide exchange"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81692"
FT                   /db_xref="GOA:A8A9U0"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9U0"
FT                   /protein_id="ABU81692.1"
FT                   /translation="MVAMVKVLVVAKVYPDSVERNLEEMVENIKKSLPEGYELLQYQKV
FT                   PVAFGLNLLKVYVAMPEETEGGTEKLEEVLKGVEGVSEVEIETVHRMSY"
FT   gene            450140..450763
FT                   /locus_tag="Igni_0510"
FT   CDS_pept        450140..450763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81693"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U1"
FT                   /protein_id="ABU81693.1"
FT                   /translation="MSLALARVREFLEEYGERAALVLKAALQVTDKYRAEGKNALGDFD
FT                   YKGLTQTLKLMGVEYKPSLLLSKLEKEYGIIETTYKSGNQHWWRFVEEDAVREALEEED
FT                   EVEDPKLVMLKVQAAALGLEEIKGKLKLLLSKKRLSASDKKWFRNFAFETLPLVAKLAQ
FT                   EVVEEGYEDPELLEALRVLKLSLKVASKLKSKVPLDLPSLEVEE"
FT   gene            450760..451611
FT                   /locus_tag="Igni_0511"
FT   CDS_pept        450760..451611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0511"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81694"
FT                   /db_xref="GOA:A8A9U2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U2"
FT                   /protein_id="ABU81694.1"
FT                   /translation="MSWEPLASETLGVRSMALAVGRVVIDPSASLAPKRFGLPPHPLEW
FT                   GALKEAAERIVRAVERSEAVVITHYHRDHYNPGWLYDYSVYDGKTLFIKDPKNNINVSQ
FT                   KIRAHKFLKALEKMKVNVRVVVADGREFEEFDLSFSPPLVHGEPKLGYVIAVKVGKVLF
FT                   TSDIEGGDEAAREWAKSQGAEVLIADGPPLYLKKEFDVEGFKEFLRSFPFAVVDHHPAR
FT                   VASWREALGPVRAYSDVLGVEERLLEAKRRELYELHPVEEGWFKFRFRDMRSIYFTENP
FT                   IN"
FT   gene            451641..452966
FT                   /locus_tag="Igni_0512"
FT   CDS_pept        451641..452966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0512"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81695"
FT                   /db_xref="GOA:A8A9U3"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9U3"
FT                   /protein_id="ABU81695.1"
FT                   /translation="MPAAARVPLFVDDLVMVGVNYKTSGKELVEKAQFPDPLAAYSAIS
FT                   RIPAVREVVLLQTCNRVEVYAITTNKKATVESIKSLLEARAGEPIPEEKFVIYYGTDAV
FT                   RHLFRVAAGLESMVLGEPDILRQVREAAEFAAKEGYIGKALKLTFENAVRVGKRVRTET
FT                   ALGKGSIGIPSASVKLLEELIGLEGKKLLVVGAGMAGRVVAVNAAKRGAKVIIVNRTLS
FT                   KAKELAEEVGGEAYPLEELPRLLREADAVVVAVGGGSKVITRDAVAEVNKKLVIVDISE
FT                   PPAVDPGVSLNPYVIYKDMLAVAEVANRGLEKRKSEIKRAEDIIEAELNKFVNFAQRVL
FT                   ADKILRELMEKVEQIRINELSKAMAKVPQEYAEVLDKMTSSLVKKVLKDVILKVREAAG
FT                   KGDLTTLRIVAEVFDLKESLNNIEIIYDYNGVEQELKRKLEL"
FT   gene            452999..455006
FT                   /pseudo
FT                   /locus_tag="Igni_0513"
FT                   /note="5-oxoprolinase (ATP-hydrolyzing); EC number 3.5.2.9"
FT   gene            complement(454999..455856)
FT                   /locus_tag="Igni_0514"
FT   CDS_pept        complement(454999..455856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81696"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U4"
FT                   /protein_id="ABU81696.1"
FT                   /translation="MVYGAFFLIGLISSLAANGNLVAASQGPLLYLLNATSGLTVAQFD
FT                   LGENVTCVTSIPGGFLVSTSAENLTHLVLVTNNTYYPIEDIVLGNESYPSVTGTSLDCA
FT                   YYNGTAVVTVRDEEGLKAYFFKLNGTTATLVKEVNAPAPEVEGGEALLFFGDEGLYLYE
FT                   GNAVRMITNVTVRDADYTGGIVFYVHNGTLNAFSVTGNVTVFVWTPEKGRACAVLALSP
FT                   DKAIVGLRGTNMGLVLVENGATKVAVGVPEVYDVARGEGYVAAATAGGLGEGVATVPLE
FT                   WFLK"
FT   sig_peptide     complement(455785..455856)
FT                   /locus_tag="Igni_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.883 at
FT                   residue 24"
FT   gene            complement(455923..456969)
FT                   /locus_tag="Igni_0515"
FT   CDS_pept        complement(455923..456969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81697"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U5"
FT                   /protein_id="ABU81697.1"
FT                   /translation="MLVIPLSPELWTPKRFKEVIAAAQGKLSNIRGFLEFYRDLLVNAD
FT                   EPYGKGVRLSDMLGGMTHVDKLGDKYPSLKNFGMTDLLYYLRVLEAFNVLEVVSYDEVP
FT                   SRLTSLAVRRTPVSQFVYDVLKDDPSAALMFSFYVNLMVTTPARHTMFGVTQVSSLSQL
FT                   ALLEKFKQASPYNLLLARQVLNRTPAIEGVEGRPWYEPVSDLSLIMTFLGILQVIKIRP
FT                   SPNKLAGIRNLSKIKRQIINMLEGFGDYIIPRGTLLLEFEYLITGRTKDEYWNYDFSDQ
FT                   VGNAKDITWFKSKLSSRAYTALEKLYYAIKDKLDELDNETKMFFKELGYPPRELMEKEL
FT                   QPAEASAE"
FT   gene            457134..460913
FT                   /locus_tag="Igni_0516"
FT   CDS_pept        457134..460913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0516"
FT                   /product="Reverse gyrase"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: reverse gyrase; PFAM: TOPRIM domain
FT                   protein; DEAD/DEAH box helicase domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; SMART: DNA
FT                   topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein; DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81698"
FT                   /db_xref="GOA:A8A9U6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005736"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034142"
FT                   /db_xref="InterPro:IPR040569"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U6"
FT                   /protein_id="ABU81698.1"
FT                   /translation="MYASYRRSCPSCGGEIEDVNLSLGLPCDKCLRVVGLESLKLDPSK
FT                   KDSPSVRRRLIELGGPLGESLKLEEELESLEKVFQEVLGAPMWSAQRAWALRALRGESF
FT                   SIVAPTGMGKSTLGALLSVYLSHKKKKKSYIIVPTTPLVDMMFRKVSAFAEAFGVRAVY
FT                   FHSKMSPSQRKEMKERLLSGDFDVLITTSRFLINNLDLLKNYEFGFVFVDDVDSVLKSP
FT                   KNVDRILMVLGLQESDVKRLEEVDKELSRKAQVLTKLQDLQKRYQLLKEMRELEEELED
FT                   LKRKVKGNLIVSSATGRAKGNRVRLFTRLLGFTPGGVGEGVRNVVDSYSRSSDVVEVVK
FT                   KLGKGGLVFVPADLGAKGAEEVAEALRAAGVAAEVATSERIGVIKDFEEGRVEVLVGVA
FT                   THYGVLVRGIDLPHVVRYAVFVGVPRFKFKLKLEEPSPMTIYRLCSLAARFFEECASLY
FT                   AKLRKWVQRLGPAGLQSVEEALKEGSASTPASKDFMEAYTKLKEIIEKTDFIEKLKESG
FT                   EVDVVAEDSLYVLIPDAATYLQASGRTSRLYAGGVTKGLSVVLVDSEPLFRGLKKRLAW
FT                   VVEEWKEFESLNLSELLKEIDEDRKKVLKVIRGELKVEEVRDLMKTVLMIVESPNKART
FT                   ITSFFGRPSVRQVKGVKVYEVTLGDKLLYVAASGGHVYDLVEEADPCNEEPCMLFGIRV
FT                   KDVPEEVLSSIKRCAVCGHQFSGDVKECPRCGSPFIKDAKDVVDGLRELAQEVDEVLIG
FT                   TDPDTEGEKIGWDLKNLISPFAKKIRRAEFHEITKKAILKALENPRDFDMGYVWSQMVR
FT                   RAEDRLTGFTLSPKLWFELWPQLCEVSKEMKKKLLGCPLTRNLSAGRVQTPVLGWVIQR
FT                   YEEYAKSKKKFYIIRFDGRELEFSEDELRGFSKKLAIDGKVKILKVEEEVEELKPLPPY
FT                   TTDTMLEDASKLGLDPSRAMRVAQDLFEMGFITYHRTDSTRVSDAGIAVAREWITSKFE
FT                   GLFAPRRWGEGGAHEAIRPTRPLSAEDLKRLIEEGMITPPRELSKQHFMLYDMIFRRFM
FT                   ASQMKEAKVKKAVYEITVEEGGAVVGKKVLEKYVERVFDGFLLVYPIVKIESLPEGEYE
FT                   VKEVRAVSRHTVPLYTQADLIRLMKERGLGRPSTYAKIVSTLLERRYVTLSKVGKKLVP
FT                   TVRGYAVYSYLTGKVVGAGWVRKALEVIINPEGKSKYFQKLVEEEATRRLEKVMDEIAE
FT                   KKDEKMYINVLKDIIEETKVIPFLSDKGAQPSLR"
FT   gene            complement(460895..463714)
FT                   /locus_tag="Igni_0517"
FT   CDS_pept        complement(460895..463714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0517"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81699"
FT                   /db_xref="GOA:A8A9U7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U7"
FT                   /protein_id="ABU81699.1"
FT                   /translation="MLKPCDSGELLRSMGYDFESYREPPSEPELSGVRFDELVPGLKRL
FT                   EGVYAYKHQVETVEALEKGKNVILVAGTGSGKTEAWALAAVRGGMRALAVYPTLALSSD
FT                   QLRRLKEYFEDLGVPEAVVKVDSTTVKRLGDLSSAKIVATNPAFLMQDLKRIAEGRGYL
FT                   REFLFKVDLLVFDELDFYGSHGTSAILGMIEVISSYAEKPPQVVLLTATLGNAEQVAKL
FT                   LEDVTGRESVVVTGKPFKVENRGYLVISKDLKKLWERIKARREEVISKVPQLAEALTDY
FT                   DVFKENVFTIVEVLRSKGVRVPSPSMDFAEIISSYVTCEGEGLTLVFVPSIRQAEKLAS
FT                   EVKHRLPPNLQDKVATHHYMVSKERRSKIEEMAREGKLKVIISPKTLAQGIDIGHVVRV
FT                   VHVGLPDTVREFKQREGRKGRRGDIAFTETVILPFRQWDKKMLKYGTSTLLEWAKMDLE
FT                   KLYVDTTNEWVKMFTGLWKAVAGQIMREDEERVLKSLGLYEGGRLTPEGKRVWRNLGFY
FT                   EYGPPYGVPRRVLRGGSEERLEPVGRRDLVERFQPGSFDYSSDAVVVEVDEKGILEMPL
FT                   GDAVKRYRWAFEAVQQYHTIKSKWGETWTTPEKDYKFGKLTSKVELLVRPPEGGFGKLT
FT                   EEPLHVKWIIESVKADLKKVGKGYVPVYEREEVALDVRVYGEYEDYTYGYAYPISDNWE
FT                   EVEVYAALAYALAVLRVRESIDITEIAYSLKKGRFKEVVVWEREASGLLKSLDWNAVSE
FT                   EVRSHKHDKLTEVVALMVDPYSVSEFLKKEGWNELKELASFLTSEMGGKAFEGLEAIKE
FT                   MEAKPKEANYFLIFDDVIMVKKGNNVVKKKFTNPKDLLVLVDVFTSGRAVTYMPERKLE
FT                   ATLKDHPLVYKSYLAAATRGLVTNLYTLVRRKLNSESSLKLMADKLGIKLEEDEDYLKV
FT                   LEEVYRRLG"
FT   gene            463755..463988
FT                   /locus_tag="Igni_0518"
FT   CDS_pept        463755..463988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81700"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U8"
FT                   /protein_id="ABU81700.1"
FT                   /translation="MGALELLKELCEDPCYRELEECEYLEELEAEPHPHLARKAVVELL
FT                   HSAAERGCDPSRALGLLIKLFEGGVGEGPWRS"
FT   gene            463976..465031
FT                   /locus_tag="Igni_0519"
FT   CDS_pept        463976..465031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0519"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /EC_number="5.3.1.23"
FT                   /note="TIGRFAM: putative translation initiation factor,
FT                   aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81701"
FT                   /db_xref="GOA:A8A9U9"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9U9"
FT                   /protein_id="ABU81701.1"
FT                   /translation="MEVLKPVDLVGDKVVWLDTRYIPWKEVWKETTDYKEVARAIKDME
FT                   VRGAPAIGVAAAFGMALAALHYEGEDVEGLLRRLREAKEVLANTRPTAVNLFWALERVM
FT                   KRAEEATRSGSAEAVREAVVEEARKIQQEDIESNVKMGKIGAKLIEDGDVVLTHCNTGS
FT                   LATAGYGTALGVIRAAWEEGKRIEVIATETRPLDQGARLTVWELKRDGIPVKLIADTMV
FT                   GYLMSKGKVDKVFLGADRILLSGHFANKIGTYQIAVLAKHHGVPFYVVAPTSTVDPKIT
FT                   LDELVIEERDPDEVRRCPYPFEKVYVTVRDVEVYNPAFDVTPPELVTAIITERGIAYPP
FT                   FYVSLKKLLEG"
FT   gene            complement(465028..465483)
FT                   /locus_tag="Igni_0520"
FT   CDS_pept        complement(465028..465483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81702"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V0"
FT                   /protein_id="ABU81702.1"
FT                   /translation="MVSRKGQAELLGLAGIALLALAVLAYFMFFGAPSVAPKLNVELEG
FT                   NTTLKACVNSVAKLKLRAFNPATNPPATVTIDVKVSNATVAAVVDGKPATLPLVTTLAP
FT                   GQSLEVNLYFSPSAPGAHQAVVRVAYTLNGMVHEKTFELTVVGERCG"
FT   sig_peptide     complement(465376..465483)
FT                   /locus_tag="Igni_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.647 at
FT                   residue 36"
FT   gene            complement(465543..466700)
FT                   /locus_tag="Igni_0521"
FT   CDS_pept        complement(465543..466700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0521"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81703"
FT                   /db_xref="GOA:A8A9V1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V1"
FT                   /protein_id="ABU81703.1"
FT                   /translation="MSPQEVLDLLSQLISFDTVSPEGKQYEDLVHFLKGWLEERGVSAK
FT                   VEYVDDEYRSSHCPQGPKPLLFAWVGEGEPLLEFNGHYDVVPPGDGWEGNPFEPKVVGE
FT                   YLVGRGATDMKGGVAAVAASLAELSNWKGNKVQAVFVPDEEVGGRCGTGYRVSKLKEKY
FT                   PIGRHVVIAEPSSKSVWIGHKGAVWLEVKVKGSQAHASTPWMGENAFLKASNVATALYY
FT                   ALVERFSKRYSKYEYTSEHPLAKFNTVSVGGVAYSTSNKVNVIPGSFVFSVDIRVIPEE
FT                   SAERVAEEVYSLLPEYAEAKALEMMEPFINEGSEVAEVIREAWGHPPKVCEGGLDLRYY
FT                   KGYDAVAWGPGEISEAHKPNEKVRISDVLEFARMYSQLPLLLKRR"
FT   gene            complement(466735..466998)
FT                   /locus_tag="Igni_0522"
FT   CDS_pept        complement(466735..466998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81704"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V2"
FT                   /protein_id="ABU81704.1"
FT                   /translation="MRRTGDKMIASGRVILRRRDGVVVEANGKKFLMGYGAYLVWQSFL
FT                   EGSTPEEVIAQAVALSGMRREEVESLILPLIDEMLSKGLLRH"
FT   gene            complement(467040..467537)
FT                   /locus_tag="Igni_0523"
FT   CDS_pept        complement(467040..467537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0523"
FT                   /product="Protein of unknown function DUF429"
FT                   /note="PFAM: Protein of unknown function DUF429"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81705"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V3"
FT                   /protein_id="ABU81705.1"
FT                   /translation="MVLAAGVDLAVKRPSALAIFDGSNFWTKFLDNEALAPTLGALRPE
FT                   LVAVDAPLEVPEGTWREVDLVARKAGLKVLPPGWRGMRALAEEGKRLREELVGRGIKVI
FT                   ETFPAPLRKLVGLPFEGDLLDAALCALTAYKCLRKECYYVRASDGEMALPVEAALGKSV
FT                   IF"
FT   gene            467575..468054
FT                   /locus_tag="Igni_0524"
FT   CDS_pept        467575..468054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81706"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V4"
FT                   /protein_id="ABU81706.1"
FT                   /translation="MSVRSEALKLVADACEDFILNVLPERVDEDKAFELAKAFSSEALA
FT                   DKVLEVVGNVPPEKLVKAYFNLFEIIGKAYTYEIKSTKPLVVEIRNCPQRRKVRGRGSC
FT                   AACLGLVAGVLERAYGSAAVEAFGKRWGPPDAAVVIKKEGEPGNCVWRIEERNQR"
FT   gene            complement(468180..468256)
FT                   /locus_tag="Igni_R0015"
FT                   /note="tRNA-Lys3"
FT   tRNA            complement(468180..468256)
FT                   /locus_tag="Igni_R0015"
FT                   /product="tRNA-Lys"
FT   gene            468315..469103
FT                   /locus_tag="Igni_0525"
FT   CDS_pept        468315..469103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0525"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81707"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V5"
FT                   /protein_id="ABU81707.1"
FT                   /translation="MRILHVSDLHGSVKAFELTKELYFKLGADLLVVSGDLTGKCVSNG
FT                   KVTKCVWGRFKDPQRMGRELFLASGGYFVEASDTEVERNAPGLLARAAARRVKEWLEGL
FT                   KDSGVKYFVIAGNVDHPYMDEVLEGDEATFFGLKFCGLSYVPYTPFGTYRETSEERIRE
FT                   MLPKERCDVLVSHSPPKGFLDYSNYREGGHVGSEAVREWIEKYQPTLSLHGHVHESRGT
FT                   ARLGKTLAVNPGSEAEHGALLYAVIDLDGEPVASLGEVRY"
FT   gene            469134..470135
FT                   /locus_tag="Igni_0526"
FT   CDS_pept        469134..470135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81708"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V6"
FT                   /protein_id="ABU81708.1"
FT                   /translation="MANALLLALRSLWLGEEPPYEEVLGREGDEREVRELLSGLWVKCY
FT                   PQGDKRLCVYSYKRPPKDPVPLLLDARGTVIEWSKDGPELVAYPFHKFFNLGEAEFPER
FT                   PLLAYEKLDGTMVSLFLYDGEVRAATRKKLDVDSPFAKKALELFEGELGDETRVFELLG
FT                   PGSGSPWVGGTQELLRAGEWSLVPLAYRDMKTLKLYPLEGPTRVEVEDLEDAKRKAEGF
FT                   GEGLVLWFEVGSQRPLMAKVKSVKYKRLVDLLKLGWEGLAKIILMNALDDAARMLDNEV
FT                   YSKAKAVEGMLDEIERAVLRGEFPHERVREWLPIDPSRALEEAVRVCLEEGC"
FT   gene            470132..470512
FT                   /locus_tag="Igni_0527"
FT   CDS_pept        470132..470512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81709"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V7"
FT                   /protein_id="ABU81709.1"
FT                   /translation="MKTLFVVTCKPGKELRAAEEVMDLLLYCDEGALAVPTAKGLALGT
FT                   TSLGPEEAAKCLEGKVSAYINWIYFGDELCEKCKALKKQCLEEVEEGFEAFCTGRAIVK
FT                   IKKALRAKRGVLVSVPLRRNER"
FT   gene            complement(470481..471911)
FT                   /locus_tag="Igni_0528"
FT   CDS_pept        complement(470481..471911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0528"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81710"
FT                   /db_xref="GOA:A8A9V8"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V8"
FT                   /protein_id="ABU81710.1"
FT                   /translation="MSNPVVEFLVTIWYIIKHMFKGDWRGWTWIFAMAGLTAFGLGLWA
FT                   GVQAGPAIYTQLVYHLGMDPKLLEQLGISEHRGGMVYTALDDWVAWGLYISFFVFWVGV
FT                   AAAGVLFGVAAYVFRDKGFMRLAPLAEVQAVAALIVALLLVLVDVGRPIRTIQLLALPI
FT                   VAQLQFPNPQSIFDYDFTVLNGYLVVNLIGILIAVHWYRRGPKYAPPKWLMYLFMLIAA
FT                   PLAIGIHTVTGFISQPLTARPIWNAPLLAPRYVATALAAGPAMLLIVSVIAEKFYKKFK
FT                   VPNYVYEKTLIAATAAMIVGLYFTLSEAQELFWYTTEPHKRAQAIGIFNFAVMPFCALM
FT                   KPILKDFAVFFSGTNFNGCSWGYPGMEYLALMNFFWIVVGSLAVILTIFVPRLRKTRKG
FT                   VVFLSALIILAVVGEKTLPIVIPGYTPDVLGKLAIYYPTPMEWALTVAAHAAGMMVYML
FT                   LARPVIRAVIAHYGEEEH"
FT   gene            complement(471937..472998)
FT                   /locus_tag="Igni_0529"
FT   CDS_pept        complement(471937..472998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0529"
FT                   /product="sulfide reductase, subunit B"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81711"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9V9"
FT                   /protein_id="ABU81711.1"
FT                   /translation="MTVSRDEVGKVLHKLSDEELLGYVYEEGEYVISEYSPYKTPEEIK
FT                   ELAKKKEEMAKKKCMESANSICQRLGENSPECRLARKHCEEIKVKWTLAKKGVRWAMAL
FT                   DLNKCIGCRRCAYACVQENNVDRTQGIEWIKVVNVNREELELLGVDLDYKEAPYKDRVY
FT                   IPVACNQCEYPPCTMVCPVRATWQEADGIVVVDSYRCIGCRYCITACPYGARHMNWKPV
FT                   TVDALTLNPNMHVFGNVPREVHTVEKCTWCIQRTRDGGTTACVEICPVGSRAFGNLHDE
FT                   EGPIQRIIKEYGVFVLKPYAGTKPRFFYYFGPARTPPLDSENPKSGNWLGTPKHGEGTH
FT                   HGSREKAEERGHD"
FT   gene            complement(473085..473735)
FT                   /locus_tag="Igni_0530"
FT   CDS_pept        complement(473085..473735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0530"
FT                   /product="hypothetical cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81712"
FT                   /db_xref="GOA:A8A9W0"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W0"
FT                   /protein_id="ABU81712.1"
FT                   /translation="MAPQRLGSEVMKRLAAFLPLLAAVALAYTPAYPCTYCHTPWLKLD
FT                   GNVKAVEFHKINLLHGAHSGLYCSNCHDPQDPIKLVNGATVVPKELASPEQMHQYDTLC
FT                   AQCHPRVYADYLVGAHANSTFVCEGGSSHFVYGYKGSPYWYHECPKYTNLKTVPGKSCV
FT                   FCHDPHDPIKPPSNIMPPPSDRPEPYPQDAVLNSLFFLMGVAAFLSIIAYVKK"
FT   sig_peptide     complement(473652..473735)
FT                   /locus_tag="Igni_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.981 at
FT                   residue 28"
FT   gene            473818..474960
FT                   /locus_tag="Igni_0531"
FT   CDS_pept        473818..474960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0531"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81713"
FT                   /db_xref="GOA:A8A9W1"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9W1"
FT                   /protein_id="ABU81713.1"
FT                   /translation="MGGNTIGKMFSVTTWGESHGKAIGAVIDGCPAGLPLSEEDLLVEL
FT                   SLRRPGRRFTTPRREPDVPEILSGVFNGKTTGMPISIIIRNRDVISSYYEKIKETPRPG
FT                   HADLAYIKKYGYEHWDYRGGGRASGRETAARVAAGAVAKKLLGCLGVVVSGYVVELGGV
FT                   EFPSAEDAEESLRSRLSPFRVLCCEEKAEEVLKEALERRDSVGGVVEAVAWNAPAGLGE
FT                   PVFDKLKADLAKAMMSIPASVGFEVGWGFKLARLRGSEARDKIVSSAGEATVEGDKAGG
FT                   MLGGISVGAPIRIRVAFKPTSSIMIPEKTVNIHTLEETEVEVPGRHDPAIVLRAVSVVE
FT                   SMFAIVLVDHAIRAGLLNPVRVEWGPHCQRVWELYADRVP"
FT   gene            complement(474957..476018)
FT                   /locus_tag="Igni_0532"
FT   CDS_pept        complement(474957..476018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0532"
FT                   /product="RNA-3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="PFAM: RNA 3'-terminal phosphate cyclase; RNA
FT                   3'-terminal phosphate cyclase, insert region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81714"
FT                   /db_xref="GOA:A8A9W2"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9W2"
FT                   /protein_id="ABU81714.1"
FT                   /translation="MIEIDGSFGEGGGQILRTSVALSAVTLKPVRIFNIRAKRKNPGLR
FT                   RQHMVAVKALAEMTDAEVRGLELGSTEIVFIPKTLKAGTFRFDIGTAGSVSLVLQAVTP
FT                   AALFAPGEVRVQLRGGTDVPMSPPVDYLRFVFYPLLERFGAKTELVLKRRGHYPKGGGE
FT                   VEFASRPVDSLTQWGEVERGEVLKVRGLSHCVKLPKHVAERQAKAAEEVLKKSGLKNVD
FT                   IDLEWYPPERDPHLGPGSGIVLWAITERSLLGADSLGARGKRAERVGEEAARKLLEDLS
FT                   TGKALDRHMSDMIVPYVSLACGRTEVGGAALTMHAWTHVHVVKKFLPELEVEISGELNK
FT                   PFVMRVKGVCWQR"
FT   gene            complement(476048..476911)
FT                   /locus_tag="Igni_0533"
FT   CDS_pept        complement(476048..476911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0533"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81715"
FT                   /db_xref="GOA:A8A9W3"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W3"
FT                   /protein_id="ABU81715.1"
FT                   /translation="MDIIGLLFWLLLLTMITEPVLEYQRIKNARMNVLRRIEEKYGYRI
FT                   ITLIHRQERVGFFGIPFYRFIDVEDSEAVIRAIHNTPKDVPIMMILHTPGGMVLAASQI
FT                   AKALHDHPAKKVAVVPHYAMSGGTLIALAADEIWMGPAAALGPLDPQVPVATPAGPMHV
FT                   PSPSVVKVAEEKGKEANEYFLVHADVAKKALNEMLEFVTYILKDKVGEEKAREIAEELV
FT                   TGKYTHDHPLFYEDLVKLGLPVKKEVPEEVWALMELYPQAQPQRPGVEYLPVPAVPQKR
FT                   GLGDKA"
FT   gene            477153..478562
FT                   /locus_tag="Igni_0534"
FT   CDS_pept        477153..478562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0534"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81716"
FT                   /db_xref="GOA:A8A9W4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W4"
FT                   /protein_id="ABU81716.1"
FT                   /translation="MRALIILLLVVSSMLADSGDCAFGWWKDLLRAPDAHSEGVTGKGV
FT                   VALVIDTGVDAEVIKSVFNRTVDRYFNAAYEAHKDECFKYVDYKNVTMCVYGLTEVGGR
FT                   SAYLAAPVNETTDLAGHGTAVAAALLSVAPDVDLHVAKVACYVLLLDENGSVTYAIPFI
FT                   DPEALKLALERAVNGTDVVNLSLGSVTPVTGPLPDVPTALALRGLWDVIYSKSSETAFV
FT                   AAAGNEGLKVPSFPALSEHVIGVSALAYKDGEFEVASFSDGGPGVDFSSVGVGLYLPVP
FT                   KYSYIAEAVKDPCAEEVGRALFLRLDGTSFAAPLVSGTAALWIQRTGVKGTSEVREVLK
FT                   QNSLHPFGPGWSPEAGWGVPVAVPVEGQGLSLPGIPFAGLPALLLAKRKRGATLLTIMM
FT                   ISSSAFAVEPEKLGEAFAISSLATWTAYYVANGLGPVASLWMATFNTLIVTALLAISWK
FT                   VVELVCATIKC"
FT   sig_peptide     477153..477209
FT                   /locus_tag="Igni_0534"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.708 at
FT                   residue 19"
FT   gene            478593..480665
FT                   /locus_tag="Igni_0535"
FT   CDS_pept        478593..480665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81717"
FT                   /db_xref="GOA:A8A9W5"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W5"
FT                   /protein_id="ABU81717.1"
FT                   /translation="MKALKKLAEKLEDPRSVAKATFAIAIALASVSSLLIMLTTSIKPI
FT                   RVEWSGAVLVSGCSYGIMATPSPYNRPTVVFFTPHKTSSAWLMSFNDVVSYFNGTPISH
FT                   LGYPKIRVANDSKIIIDYTKFKKVTYVYKDTVYVELLNFTEGVLGLSVPALEGVAEGNG
FT                   SVRLLGVKGPFMMKFDVVMKFTGCKPEVLRSTPFKDIMGSKYLVQVSLRCNESSKLEVI
FT                   AENVEDPLVGKLILLMINYWTYSLPLIVVLIGVVLWYKWLSKNLEDFKGVLVFISILIL
FT                   LSGLSGHHWDLLMALKFGEMVVSGKDLYQWTYNNTLLMRDRLPNPQIFYPGYAYLPQLA
FT                   PFFVPIYLAYESIFDKPYYYQLVPGTVDLAEVRALLFGALTFIYYVLVHGYFMLFYLIG
FT                   AFLIYKFYGKDRFLLSVYSFLPIVIIVEWGMFEAFLIPFLVASLILLREEGNVHQLLSG
FT                   LAWGMVSSKIYAALAAPALILNSRRKVLWLLGFIIAISPSLYFLLTEPKTFLSCTLLFH
FT                   TNRNMGDVNYYPSFMGNPVDLLWWGKVGSAAEVVLTLLTYYLVWKLRPSPEVAAATVLV
FT                   PYLLFNRLVSPQHYLTFATLVLLSGDKRTYGLLSLLILLHVNLVRPTAFYLAYHWLSAE
FT                   VALSYFSYDPTGVLNLIVTSVTPSVIWPFLFPTLAGVLTLYYYKSLSLRGSKWRS"
FT   gene            480653..481420
FT                   /locus_tag="Igni_0536"
FT   CDS_pept        480653..481420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0536"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81718"
FT                   /db_xref="GOA:A8A9W6"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W6"
FT                   /protein_id="ABU81718.1"
FT                   /translation="MEVVVSFKPDERARELAERVARGLEGAGVKVRWFPEADPCAADGL
FT                   VVVGGDGTLLYTLSKAPCETPPVMTVRAGRRAFLLDVEPREVEEAVRKFVRGEYQLEEH
FT                   KRLEVDGHFALNEFAVLSKWRRVTKLNVEVSGYSVYEGLEGDGIIVSTTLGSSAYALSA
FT                   GGPIVDPRAEVLLLVPVNPIQLDARAVVLPKDSEIKVKIVYNTKEVVTLLDGIVELTGE
FT                   EFVISLTGPKVRFARFRRENFYRRLIELRSFKA"
FT   gene            481431..481778
FT                   /locus_tag="Igni_0537"
FT   CDS_pept        481431..481778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0537"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81719"
FT                   /db_xref="GOA:A8A9W7"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W7"
FT                   /protein_id="ABU81719.1"
FT                   /translation="MEASIVLIAHGSKNKNFYRMVNNVARMLEEKVGKKVYVGYLMGEP
FT                   SVEEAVKEAPGDLVVVVPFFISESSHVVRDVRERVMKVSNGKKVVFAKPLGDHPLVVEV
FT                   LYSRYLEALGE"
FT   gene            481775..482167
FT                   /locus_tag="Igni_0538"
FT   CDS_pept        481775..482167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0538"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81720"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W8"
FT                   /protein_id="ABU81720.1"
FT                   /translation="MIYSFTAKFHANVQALHKGTIEVTCEERLTPRGDCVVLTSSTHDP
FT                   SELARSCPEGRRAAFVVLTRFGGFWVEGTCAPAQVGCSFVIRKSETKAPRTLMVRADKG
FT                   ARDLPRDVIKRASLWGARALALLVVY"
FT   gene            complement(482150..483844)
FT                   /locus_tag="Igni_0539"
FT   CDS_pept        complement(482150..483844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0539"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Arsenical pump membrane protein; Citrate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81721"
FT                   /db_xref="GOA:A8A9W9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9W9"
FT                   /protein_id="ABU81721.1"
FT                   /translation="MNRNLLILIVAVTATFVISFVAFSTLKVEPEGPLKDVVEKILVNF
FT                   KMKHCEWINVIREHGFDYHKALEECEVDLNSTVVAFSEALATASFVAAILGTLMFWNKR
FT                   LSFVMIGVALLLFLGTAPFEMILEHMELGLILFLISMMIIVEYLNESGVLGWITVKLVK
FT                   ASKFQPLRFVAILGFLSWIMAALVDEVTSIVFVTRVVISIASMLELNPIPLVIYSVMAT
FT                   NIGSSATMIGNPIGIYIALQSGKSFEDFLEWATPGSLLALLTLLPIALVWLSKTGLFKK
FT                   LREKGSMISLDEWSALGISSELYEAYKSGKLTGKEAEEVEAALKRFKRGWAFFIAVLLL
FT                   IAFHTPLSGALNQFLAYLYAAMSVGSEVSIHAEVPPDALLVFSPVVVAAILMFTHEEPR
FT                   RLVEKGVEWWTLLFFMFLFAIASALSYTGVTDKMAYSLVQMVGGLTFESTVTLAITIAV
FT                   VSAVVSAFLDNMPVVVALSPVVKTLIEVGLPGGEVLWWALLYGSTMGGNMTLIGSTANI
FT                   VALGILERHGRTVKFWDWFKVGVVVVALTLGVALASLLFHASLVYHQ"
FT   sig_peptide     complement(483770..483844)
FT                   /locus_tag="Igni_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.815 at
FT                   residue 25"
FT   gene            complement(483958..484776)
FT                   /locus_tag="Igni_0540"
FT   CDS_pept        complement(483958..484776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0540"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="TIGRFAM: shikimate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase, C terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81722"
FT                   /db_xref="GOA:A8A9X0"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X0"
FT                   /protein_id="ABU81722.1"
FT                   /translation="MLESELPFAYAGGSALNAVASWKGAAFAISLKVEVKVVEGKRIDN
FT                   KLLRSVYEVFKEQVCDPGEVTFVVKSEVPPAGGLKSSSAVANAATLALFERCGMRPSPY
FT                   YALKLSVEAAKRAGVTVTGAFDDAAASMLGGLVITDNKEMVVEERRPLEGLRAIVLPRG
FT                   GRGLSYGEVAERLRLLKREFLKVYEMLKAGDLYGAMTLNGFLVAGALGYPQGPVLDALR
FT                   AGALAASVSGNGPSYVALADRDKVEDVYEALSKHGRPVVAEVVNSPAYLP"
FT   gene            484832..486262
FT                   /locus_tag="Igni_0541"
FT   CDS_pept        484832..486262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81723"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X1"
FT                   /protein_id="ABU81723.1"
FT                   /translation="MSLSLNELWNVDLRKRVNSLSVSEDGKVLAACDDGCAYLIENGRV
FT                   LKKECERGSSAATHYKDGLFAVAYKNGVLKILTPDGSIKAEIKVGRYNEAIAIINDKSV
FT                   VACSDACVKFNFDGERGWHYDIGGVGKNVDVENNTIYVPDHIWRKVHEVDAISGKGEEF
FT                   CSCKEKVYSVDREGDLTAVGTTKSLIVFRGREKVWEREVGTHVTLVRVVGDIIFASNMG
FT                   SQSLRAYDINGAEALNIELEGRPTALDARGKYLAVGFFDGKVKVYQLPTETEEERAEEA
FT                   EVKEVEEAKEEVKETLPGLGEIKSVAEGSYMGTPLAKEILEEIENITETMEGAKNAGDL
FT                   IASVIARVEKLTSVASSDWKQVYANYEEAERLLEDTLNVINEVKERIGEVESCPPPEKL
FT                   IEILKMKSPKEFTAALAELAEGGEVAERVKKGVQLLKRCLERYYLLPSSEEVQKLEAKL
FT                   KEVKEEKEAIKALIESGL"
FT   gene            complement(486259..487881)
FT                   /locus_tag="Igni_0542"
FT   CDS_pept        complement(486259..487881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0542"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81724"
FT                   /db_xref="GOA:A8A9X2"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X2"
FT                   /protein_id="ABU81724.1"
FT                   /translation="MNFVGEVERKEWSNALYVEVEPQYWYENAARLKDQGYLFPSMLTA
FT                   VDWPAEKKVQVFFLVHRIRDASSVVLSTKVDRENRELPSLSSLYPGVEWHENETYEMFG
FT                   INFTGHPDYERWGRIRKLLLSEDPRLFPKDRFPLLKDSGGYKDLPKVNWAEIEGTDQER
FT                   EGLREDLTYVYVGPQHPATHGPVGFLLGLKGEIVEDVIPRLGYVHRGVEWIYEQKEYLK
FT                   VIPLLDRQCYIDGIGWEWPYVMALEEIMDVKVDRRAQLLRILAAELSRIQSHLLYIGSF
FT                   AENVNHLTAFAWTVRDREVFINLLEMLTGQRMTFNYLRPGGVAFDLPQGFKDVYEKVVA
FT                   RFHKHFEKLIETTLDNPTVAMRAEGVAQVSAEDAIKYGWSGPNLRASGVAWDLRINKPY
FT                   GGYDDGIDFEGAVGSVGDNLDRMLVRFEEIRQSLKIIRQVLRELTERGQNELGTHLKRV
FT                   PPFPRKPGIAYGYHDSPRGENGILLVANPSDPKWRTRPWRVHMRSPVFVHTMSLKYLGK
FT                   GLLLQDFLAFYISLDTCVAEMDR"
FT   gene            complement(487878..488501)
FT                   /locus_tag="Igni_0543"
FT   CDS_pept        complement(487878..488501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0543"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81725"
FT                   /db_xref="GOA:A8A9X3"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X3"
FT                   /protein_id="ABU81725.1"
FT                   /translation="MDAMRFKKVSRELIKKSAPVKEALKWSRRNSLWLLHLGIMCCAIE
FT                   MMQAAFAFHDFERLGVLARATPRQVDVILINGPVNRKLAERLRRLFMQTPGPRFVIVMG
FT                   ECAINGGPWWQSDYVLDGIHEVIESLPEEYRKDVHVVNLAGCPPRPEGLLRAILKMEEL
FT                   INEGDLARAPLTRYRLHDEEGSDKKVVDPMLRYAYNNRKAGEKR"
FT   gene            complement(488489..488857)
FT                   /locus_tag="Igni_0544"
FT   CDS_pept        complement(488489..488857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0544"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81726"
FT                   /db_xref="GOA:A8A9X4"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X4"
FT                   /protein_id="ABU81726.1"
FT                   /translation="MIEPGAVAFTVVAVAMVVGGLVEGASLLINKLLEDKTPPHPDKFE
FT                   SYECGELTIGDPQSVNYTVNFYPYLVAFFVAEVASILALAASGSPKPNTLIGIGLLYFS
FT                   LVVGLVWLRKIGIMRWTR"
FT   gene            complement(488854..490344)
FT                   /locus_tag="Igni_0545"
FT   CDS_pept        complement(488854..490344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0545"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81727"
FT                   /db_xref="GOA:A8A9X5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X5"
FT                   /protein_id="ABU81727.1"
FT                   /translation="MCEVLVSIIIAALASVGVLLIGERKAKAFAAVITVIIALLLAKPI
FT                   VVGASGGIYSESYVIPGLHAIGADLTFRVDALSSLFLAITALIFIAVAWAASWEIEERP
FT                   RLYLALMLASEAALIGVFATWNLFWFYLFWEFTLLPMFIHILYWGGERKVYAAYKFFVY
FT                   TQVGGLMLLVAIALGWLYGANTFDFTEFAASLAVAPDWVKVAFAWLTLLSFFIKMPVPP
FT                   FHTWLPAAHVEAPSPSSVILASLMLKMGGYAFIRITLGMAPYVLMGALPFIAVWAALAA
FT                   VYASTVAIAQEDFKRVVAYTSITHMSMSTIGAAVWALGLKEASLLGFIGSVFEMISHSF
FT                   VVGALFLLSGVIKHYCHTRKIPAIRGLAFVAPILSTVIMVAIFAGFGLPGTSGYPAELS
FT                   LVASAAGMAKYNPAGSLVLALLLIAIATVTGYLIWDAQRMLFTRPPLEVKDVRFYHIGP
FT                   ILYLLAISVIIGVVPALVMDPLIKAVHQMPVLLAGVIG"
FT   gene            complement(490348..492426)
FT                   /locus_tag="Igni_0546"
FT   CDS_pept        complement(490348..492426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0546"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; PFAM: NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5/L domain protein;
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81728"
FT                   /db_xref="GOA:A8A9X6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X6"
FT                   /protein_id="ABU81728.1"
FT                   /translation="MEGASHQVPPSLALVAPVPIALPLVISIIVLLSPLYKKKIKFKPL
FT                   WAGDREDWWEWSLAVATAGVVVLATAYLLAEGYGKSYEIKYYSWYPLPSHPNDFSLLID
FT                   TISGIMAIVVATITFLDLVYSWEYMAGARGPNRYYSEMMLFLASMEGIVLSGNLVLIML
FT                   FWELVGAASFLLISYYWYDPIIGPNAVRAGRKAILVTRVADLFFLAGLGALIALAGTGN
FT                   VLELQHYETLAFQKWLGAAALTAILVGITIGAFGKSAQVPFWPWLSDAMEGPTTVSAVL
FT                   HSATMVAAGAYLIARLFPLYEEFIAFNLALMDFIAIVGAVTALVAGLFGAAARDIKKVI
FT                   AFSTMSQLGYMFAALGLGSLVAGAAHLYIHAFFKALLFLGAGAVIHSLEHVLHHPYKAR
FT                   DMFNMGGLWRYMKVTFVVTLIALLSLIGLPPFSGWWSKELIIESALHSPVPHALAVGVT
FT                   LTLAAGLTGFYSGRLLYLTFFGKPRWKAHGEHLHDAGPAMKFALVTLALIVLVSGPTIT
FT                   FALKKALRAHEGLPRYELPLGNAALTLAIIGFLTPITYYVLMGVAERGGIIRKVWYPLY
FT                   KEFWFHEFFHSVANFWAYALSKAVDAVERAYTAFLVGMAFFIGRAYAWGWAVSVRLADE
FT                   DYWDVKVIDGLARSVVKLGKKALELQNGDINLYVALSAAGLTLLMFVTLILLFGVGW"
FT   gene            complement(492495..493034)
FT                   /locus_tag="Igni_0547"
FT   CDS_pept        complement(492495..493034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0547"
FT                   /product="protein of unknown function DUF120"
FT                   /note="PFAM: protein of unknown function DUF120"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81729"
FT                   /db_xref="GOA:A8A9X7"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023470"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR039063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9X7"
FT                   /protein_id="ABU81729.1"
FT                   /translation="MLAALYYVLKGDPYKALKEDLESLKKAKLLTEDLRITEKGMELIQ
FT                   QLISKPISLKGKVVSGDGEGRYYLSLEGYRRQVREKLGFDPFPGTLNVLLDPTSTEKKS
FT                   TLMFKRPIILKGFTENGKRYGEVLAFPARVSGVEAALVIPLKTHHPPEIIELISPVELR
FT                   KALKLKDGDEVEVLVY"
FT   gene            complement(492529..494343)
FT                   /locus_tag="Igni_0548"
FT   CDS_pept        complement(492529..494343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0548"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81730"
FT                   /db_xref="GOA:A8A9X8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR033686"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X8"
FT                   /protein_id="ABU81730.1"
FT                   /translation="MKEPPLKPSPDEPLSSAIEEYLEFMEVSGANKKTLKSYRSALKDF
FT                   LSVVGDKRVGEVKYEDYVKWVRKRMKEGFPRSVKKDKRAQQTTLHYYSLFVRNFLKWLG
FT                   LEGLPAVPKPRKDSVEALKPEEVAALLQAAYEDPIDFLIVSLLLETGLRASEALNVTLD
FT                   KVDFRRRQIAVRGKYGKERVVFYGPLTEEALRRAWSYIAPSGRLVPLSYQALYKRLKRL
FT                   AKKAGLPEHKLHPHALRHTFATEALRRGMSLPAVQRLLGHSDIKTTQIYLHLLVDDVRN
FT                   QYFQAFSGGQHGVDLGGHYHADYRGYQVDGGVYYELAGGLQGGVGHDPSGYEYYNSQYQ
FT                   FQIHHDHPLSERARVSKLPPGPPTSIPSTRGQTSARQPTYLSQGATAGARQRSPTSPAG
FT                   RPPALPALPPRSPSPASRSPPPPMPYKNEGVGAVGTAVAGGPILRPQGRPLQGLEGGLG
FT                   IPEEGEVAYRGFEDYGEGNGAYSTTDFQAHIFERQGGERGRGGEVLPIPRGLPEASEGE
FT                   AGLRPLPRYPQRAVGPNIHGEEVYPYVQKTDNIEGIYGEREEVWGGLGVPGEGQWGGGG
FT                   FGYTPEDPPPAGDNRVNFARGVEEGVET"
FT   gene            494397..494711
FT                   /locus_tag="Igni_0549"
FT   CDS_pept        494397..494711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81731"
FT                   /db_xref="GOA:A8A9X9"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9X9"
FT                   /protein_id="ABU81731.1"
FT                   /translation="METFPLFLALLTVYLFLGLADYFTTLAVVESGEGREVNPIMAPLV
FT                   AAGEPALWAQLASGALSAAFYLVDPGEALVGLLIVTVLKALVVVNNSINAYLVVLKLRK
FT                   "
FT   gene            494708..495295
FT                   /locus_tag="Igni_0550"
FT   CDS_pept        494708..495295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0550"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81732"
FT                   /db_xref="GOA:A8A9Y0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y0"
FT                   /protein_id="ABU81732.1"
FT                   /translation="MRFGKRVVVEEQEVLIERGVSCLVGPSGLGKSTFLKQLLKELSWP
FT                   YVPQELKFPPGRVAELAAHLASLNHCASPRTYLKNFVELMGELNLGPEYLHKGVWELSS
FT                   GERQRVAVALQLARGCCSLLADEPTSQLDPQNSAKLMDTIKKRTKVSFVVTHDPVALGF
FT                   CDRVFTLREGVLVEEVISKDCLEGCVRCFLPS"
FT   gene            complement(495273..496511)
FT                   /locus_tag="Igni_0551"
FT   CDS_pept        complement(495273..496511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0551"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81733"
FT                   /db_xref="GOA:A8A9Y1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y1"
FT                   /protein_id="ABU81733.1"
FT                   /translation="MRLSELAEALGAERIGEVPRERVKEVLEKYERLGKPVIYKVEGWE
FT                   PEVVSALYSSREAVWKALNAGSDEEAYEKLLHYKKGTMEIVPFSYRKVDSLDYLPWVKF
FT                   YPEDGGAYHTASVYVACLDDVCNASYHRTMYLGPRKAALRMVPRHLYKMYKEALERGEE
FT                   LKVAVVIGAPSEVEFAAALSLPFGEFELEVAASLAGSLEVSKTPLYSLPVPARAGAVIE
FT                   GRITAERVDEGPFVDLLHTYDSVRKEPVLEVDAVYVGEEPLHIILPGGVEHQFLMGYPK
FT                   EASIWDSVRKVVPKVHKVRLTRGGGMWLHAVVSVEKNVDGDAKNAIMAAFAGHPSLKHV
FT                   VVVDPDVDPDDPYQVEWAIATRFQAHEDLIVIKNARGSSLDPSSQDGLTSKMGLDATAP
FT                   LKSKDKFKRVGNI"
FT   gene            complement(496508..497077)
FT                   /locus_tag="Igni_0552"
FT   CDS_pept        complement(496508..497077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y2"
FT                   /protein_id="ABU81734.1"
FT                   /translation="MLNLRPDVGLTTSEERCKLYGFAKCMYDEGRGPAHAVRALGEGTW
FT                   AVAPGDHPWLKRGTLEALNAFREAFDAEVAVPLHSEGVEATVLSVVNPGSFTVFSGKMT
FT                   DFLRQAERAVLVGSALLTRDPLEFAHVNTEESLKLREPKGRPSYDLIVIDKVYEKDSVE
FT                   FYESLGLGTLARHAKVPLPRGVRGRR"
FT   gene            complement(497164..497682)
FT                   /locus_tag="Igni_0553"
FT   CDS_pept        complement(497164..497682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0553"
FT                   /product="SSU ribosomal protein S18P alanine
FT                   acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81735"
FT                   /db_xref="GOA:A8A9Y3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y3"
FT                   /protein_id="ABU81735.1"
FT                   /translation="MTAIKAREVEVREAKYEDLPTVVMINRAVLPENYPFSFFEFIHKI
FT                   SPRYFLVALVDGKVVGYLMSIIERRGSLMIPDVSLAQRVKAGERASHLLSLGVLKEYWG
FT                   MGVGSALMREYLRRLEEDGVDFSFLEVRVSNQRAIRLYSKFGYTVYKVIRAYYLDGEDA
FT                   YLMVKELRG"
FT   gene            497710..498912
FT                   /locus_tag="Igni_0554"
FT   CDS_pept        497710..498912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0554"
FT                   /product="Phosphopantothenoylcysteine decarboxylase"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81736"
FT                   /db_xref="GOA:A8A9Y4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y4"
FT                   /protein_id="ABU81736.1"
FT                   /translation="MHPAEEIRGLKWRSLSGKIIALGVSYSVALYKSIDVARELLKRDG
FT                   RVKVIMTREASRVISPEVFHWATGEEPVVELTGETEHVSLAKEVSSMAIAPATLNVMSK
FT                   LAYGVTDDPVVLTALNVKEYGKPVLIFPSMHLSMLKSPQYERAKATLEEMGYVVVEPTV
FT                   EGGRVRFPEPEWVANLVESVTLRGRDYRGIKALVTSGPTREYIDRIRLISNPSTGKMGS
FT                   SLAWELFARGAEVTVVHGPSQAVYPPWVKRVPVETTEEMAEAVSEEEYDVAFLAAAPAD
FT                   YKPERRFEGKLDSAEGVELKLVPTPKVAKRVRARVKVGFTAIVGEDVLGQAENKLEKYG
FT                   FDMIVANRVDRKDIGFASDMNEVFILHKDGRVKHVAKVPKLLVARAILDEVKELLRSDQ
FT                   P"
FT   gene            498947..499024
FT                   /locus_tag="Igni_R0016"
FT                   /note="tRNA-Arg2"
FT   tRNA            498947..499024
FT                   /locus_tag="Igni_R0016"
FT                   /product="tRNA-Arg"
FT   gene            complement(499003..500097)
FT                   /locus_tag="Igni_0555"
FT   CDS_pept        complement(499003..500097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0555"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81737"
FT                   /db_xref="GOA:A8A9Y5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y5"
FT                   /protein_id="ABU81737.1"
FT                   /translation="MKGLLVATFLGVLSGVTLRTGSAFKELDEGLSFMAGLAVAFSLGR
FT                   ALVSFLSSEAVNKYGGKVTASGFAALSAIGLGYYLAPPSAYPALRLLHGLASGLTWPSM
FT                   QALVMMSTKDHERARVSSLYFFVGNAGASLAYLIGALAPSEALLTSSLTLLTLSIYLFK
FT                   ESDKIKFVRRTKRGLFAPPPLPLLMMAISIGMLNVLVNSEIIMYLMGSAFGRWLSGALL
FT                   SAASAAGSAASYFAGRALLDVRQSPASLFLPAAGSLVSSSFLLHGDPKTGAASVLFAQG
FT                   FLAWWRSALTAAARAGDVGKRIGLINLGRDLGNVIGGITVSFFGTFGILMNIAICYVLT
FT                   ATSAPLTLSEGARKGDGGGGPAGI"
FT   sig_peptide     complement(500020..500097)
FT                   /locus_tag="Igni_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.604) with cleavage site probability 0.389 at
FT                   residue 26"
FT   gene            500197..500850
FT                   /locus_tag="Igni_0556"
FT   CDS_pept        500197..500850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81738"
FT                   /db_xref="GOA:A8A9Y6"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y6"
FT                   /protein_id="ABU81738.1"
FT                   /translation="MVVRALAVLALFAAAAYAISCEDIMVGIKVSNETGYYYYYFSPHS
FT                   WQKVYKLVQIEGGKKIERARLYITLINESEPTPVGRLVMKPADLRTVVGAWNVTEAVVE
FT                   GEFRYPSGTLVVCLQQGEQAYVLIQKKGAVGWWVGAGKTVPIMATKGFSEYEIELQGGG
FT                   KVFFMPDGAVGESGVKLVPVERGGGPGLLGVPSLIQMAVTALLLAAVVFFLMPK"
FT   sig_peptide     500197..500259
FT                   /locus_tag="Igni_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.781 at
FT                   residue 21"
FT   gene            complement(500910..500985)
FT                   /locus_tag="Igni_R0017"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(500910..500985)
FT                   /locus_tag="Igni_R0017"
FT                   /product="tRNA-Gln"
FT   gene            complement(501020..501985)
FT                   /locus_tag="Igni_0557"
FT   CDS_pept        complement(501020..501985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81739"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y7"
FT                   /protein_id="ABU81739.1"
FT                   /translation="MRSGNVKVLTHWDADGIVSAAKALRKLGEVEVYVPRIGRWSFEAV
FT                   PPEALGGKLYVMDYSMPYEDWQRLCEGVEGLVVLDHHAAPKPPCGEVYNPALEGNYVPS
FT                   ASLVVSDYFGLPYDWRDAVAIAGDLHDPWGNEVWEAILRKEKVRGEDVVEAAALLNSCY
FT                   KLLDYDCIYYSIKKVSKANSLSEILEDRRLRAKREEALKLVEELERRAECWDEGYRRVC
FT                   VVRDERAALVASSLWKRLNRGKETIIVIAWDAGARVYCRGGKKDYTVLIEALRSAGIKE
FT                   VGGKDVVCSANLRSHELEKVLKILDLHLELPSSVGGEKGP"
FT   gene            complement(501972..502241)
FT                   /locus_tag="Igni_0558"
FT   CDS_pept        complement(501972..502241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81740"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y8"
FT                   /protein_id="ABU81740.1"
FT                   /translation="MRELVPRRLAEELRARGFYVSRHANWLIVMKDERIAALVYVYPLY
FT                   SEAEVVDLGSGEEVERALLKVAPEFKVRRRRALHLKEGEEGALR"
FT   gene            complement(502238..503002)
FT                   /locus_tag="Igni_0559"
FT   CDS_pept        complement(502238..503002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0559"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="PFAM: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81741"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Y9"
FT                   /protein_id="ABU81741.1"
FT                   /translation="MTELWRSSILIIGNEVLIGRVVDTNSAKVARTLTMLGYEIIEIRK
FT                   VRDNITEIAENAKDLLHISNVLITTGGLGPTYDDVTAEALSLALVLPLGLNERAKEMVE
FT                   EKIKKMGLDMTKERLKMAIMPLTAKPIPNPVGVAPGIYIKVGQKRVFALPGVPAEVEAM
FT                   LDYVVEELEDLSLFRKGEACEVLEGVREADIAPLIEEMAKTYPDIYIKTHPGMKDGTPY
FT                   VKVCALATADDEETAKRKASKVVKAIKGRLGA"
FT   gene            complement(502999..503796)
FT                   /locus_tag="Igni_0560"
FT   CDS_pept        complement(502999..503796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0560"
FT                   /product="thiazole biosynthesis enzyme"
FT                   /note="TIGRFAM: thiazole biosynthesis enzyme; PFAM:
FT                   thiamine biosynthesis Thi4 protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81742"
FT                   /db_xref="GOA:A8A9Z0"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z0"
FT                   /protein_id="ABU81742.1"
FT                   /translation="MLDEGIITTTILKKSTEELMSYAQSSDVIVVGAGPAGLTAAYYLA
FT                   KEGFKTLVLERRISYGGGINGGGTLFHKVVVEDLEVDGYSTSDVVRELGLTLEETEYDG
FT                   VKLVDAVALTATLAFKAVEAGAKVLLGWHVEDLIYREVDGKVKVTGVVALWSPIEIAGL
FT                   HVDPIFFKSKAVVDATGHGAEVLKVAERKLNLPLGVATEKGAWAERAEELVVKETGKVV
FT                   DGLYAAGMSVASWKRLPRMGPAISGMLLSGKKVADQIKGDLRS"
FT   gene            503906..505030
FT                   /locus_tag="Igni_0561"
FT   CDS_pept        503906..505030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0561"
FT                   /product="WD-40 repeat protein"
FT                   /note="SMART: WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81743"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z1"
FT                   /protein_id="ABU81743.1"
FT                   /translation="MQKLSLNLEKDFTFFTEGGSLSIDTKDNLLAIAVSKASPRGERND
FT                   EEGGHAYVVTKKGKVIMSWRFDSQKGFNCAAFKPDSDVVIFGNDDGSLYVFKTDGEMIK
FT                   KVDLDAAIYSCAFSPSGSFVALGTEGGKVSVRDSSFEPLWEYLAEDNVWGLSWSPDERY
FT                   VAVASHDGHLYVLTKPKEVWKDDLGAPVNKAKWCGNYLAASTWEGLVVTYDASDPQSPS
FT                   KLWEGRLGSNVWGLDFDDACSYLAAGSRGSDLVIFDTEGNMTLSVKPGPVDDLSWRGPS
FT                   LAVASKNKVEVFKTMSCVPYILPTLKRFKAASFSKPENIDFIEMSKLFYALLGRPKKVK
FT                   VNGETYWVKVIDGDFLYIFSQHDGEVEVEIVDEG"
FT   gene            505017..505406
FT                   /locus_tag="Igni_0562"
FT   CDS_pept        505017..505406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0562"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81744"
FT                   /db_xref="GOA:A8A9Z2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8A9Z2"
FT                   /protein_id="ABU81744.1"
FT                   /translation="MMRVSEEEAKRIAERLNYRWPDRTVVAVAQEYKSGKVLMVASMNK
FT                   EAVIKTLTTGIVHYWSKSRKELWVKGATSGHVQVLEKFYYDCDADSVLLVVRQASLIAC
FT                   HEGYRSCFHYKVEEGGVKVEEPSYE"
FT   gene            complement(505540..506631)
FT                   /locus_tag="Igni_0563"
FT   CDS_pept        complement(505540..506631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0563"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81745"
FT                   /db_xref="GOA:A8A9Z3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z3"
FT                   /protein_id="ABU81745.1"
FT                   /translation="MEDLAKKWLGKPWVREADPDLTKDLGNGWVECDLCWRRCKLPPNT
FT                   YGVCGVRANINGKLYTLVYGYVTAANLDPIEKKPLMHFHPGAKVFSISTAGCNFFCKFC
FT                   QNWEISQSRREQIYGKYLEPERVVQLALDLGADGISYTYNEPTIFFEFMYDVAKIAKKH
FT                   GLFNTMVTNGYITPEAIRKLGNYMDAVTVDFKGNANKEFYRRFMGVPDPEPIFESLKVM
FT                   KEVGWFIEITDLVVPKYGDKLEDAERLIKRVKELLGPETPMHFLRFHPDYLMRDVPPTP
FT                   VETLEKHVELAKKLGMHYAYIGNVPGHPYEHTYCPKCGELVVERYGFYIVAWKLTDDFR
FT                   CPKCGFKLNFKGKFHGLTAEWYP"
FT   gene            complement(506636..507079)
FT                   /locus_tag="Igni_0564"
FT   CDS_pept        complement(506636..507079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0564"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81746"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z4"
FT                   /protein_id="ABU81746.1"
FT                   /translation="MKKALVAVDGSEYSKYAVEYVSDLLNKDSWEVVVLHVIPSMEEFG
FT                   IESVAPPSLVAQLLEELKENAKKIVEESAKVFQDKGFKVSTLIKEGHVGKTIVETAKEL
FT                   DADLIALGTRGLSGIKAIILGSVARYVANHAHCPVLVVRKKGA"
FT   gene            complement(507379..508251)
FT                   /locus_tag="Igni_0565"
FT   CDS_pept        complement(507379..508251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81747"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z5"
FT                   /protein_id="ABU81747.1"
FT                   /translation="MVNLLKLLRLIFMRKKVSTNIDLEAVKKERVTVPNAIGNSSPKGG
FT                   IGKTTIQLESGVQLVLRGREVVFIDWDIMSPRLSLRLLKELKEGPSLVKVLIGMMDITE
FT                   AVRDTVISGRRGSVTVHLVPAVTEDDVPDNINRLLEEMNETSKVIKIVNKMKGSVEKLA
FT                   KEYDVVFNDYPVPSWATYYTYQHLLSTTSSWINLLSDSNPNMVQLIAQLHQRYTKNIPV
FT                   LGTIINMVRPTPEEFNKAKEYALELCKEVNGRVAMAIPFDGKLYDVFAESLASPASLNY
FT                   PQSPAPRSP"
FT   gene            complement(508317..509027)
FT                   /locus_tag="Igni_0566"
FT   CDS_pept        complement(508317..509027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0566"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81748"
FT                   /db_xref="GOA:A8A9Z6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR024192"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z6"
FT                   /protein_id="ABU81748.1"
FT                   /translation="MIVIKLGGSVISNKKVPYSLNKELIGKIGNSLREYAGELVVVHGG
FT                   GSFGHPKVKEIIESGHTLADKGFEVIRVMNLMTNLVVEALGQPFAPYSTPSLWDGRLNV
FT                   RPLALAAKAGWVPVVQGNVVPPGRVLSGDEIVVELVKELGAERAGVATDVDGVYETWPP
FT                   KGGPLKEASPCDVEAKGSEGIDVTGGMRKKLEVLEEAARYAEVCIFNGLKVVNFEKFLK
FT                   GECPGTRVVPCRQG"
FT   gene            complement(509130..509460)
FT                   /gene="rnpB"
FT                   /locus_tag="Igni_R0018"
FT   misc_RNA        complement(509130..509460)
FT                   /gene="rnpB"
FT                   /locus_tag="Igni_R0018"
FT                   /product="RNA component of RNaseP"
FT   gene            complement(509501..510814)
FT                   /locus_tag="Igni_0567"
FT   CDS_pept        complement(509501..510814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81749"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z7"
FT                   /protein_id="ABU81749.1"
FT                   /translation="MKVAVLLVAGRPNLEAAFSSVRVLEELGAEEVTIVYTSSEGARMN
FT                   AKTFKEFLEKAGFKVEMKEVPSDSDSDLEERVKKLKEVKADVVAVSPGGASLAAAASKA
FT                   FNTIAHVSFPFSLWRGLYFPYVPRTFQKVYFLPSSDFNTKFTNYADKIKVELNHLGPIR
FT                   KRVAELTKRINEATDRKCPEIEVKVDAMMGGFNIMSVKFKLCGNEEEETKKVFSTSLRA
FT                   MKEFIKASRSSRSWMGFDSSLYLSGLLPIKVGGEGASTEYILDTSSILIGALNLHNAGL
FT                   LRARVPRCALYELLHKYEESLKRSNPNYYGLLAKYVMEEAKALVFPSPTDLCDKAFFQI
FT                   DPLLLDGKVILTEDNGIKEMWKETPLSKLARVESPRRVDKWEEAKKLGYYNLPYVTFAL
FT                   LQFYVIMKLLAEEVEKNKISGEPVTGSLKVDNKTVDEF"
FT   gene            complement(510811..512553)
FT                   /locus_tag="Igni_0568"
FT   CDS_pept        complement(510811..512553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0568"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81750"
FT                   /db_xref="GOA:A8A9Z8"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z8"
FT                   /protein_id="ABU81750.1"
FT                   /translation="MQDKASKVADLAQRRGFYWPSWEIYGGVAGFYDLGPLGKELKNKI
FT                   VELWKEKLVRPLQRMVVEMETPIITPYKVLEASGHVENFTDPVVECKSCGRKFRADHLI
FT                   EEKLGIKVEGLSPEDLTKLIRENNIRCPVCGGELGEVRPFLLLFQTQIGPYEGDKGFIR
FT                   PETAQGAFVNFKRVYQYMRERLPFGIAQIGRVGRNEISPRQGLLRLREFTIAEIEFFID
FT                   PLDPGEPPLDYDAKLRLLPWELAKEGRKEPVEVTVREALEKGWIINKWMAYWMLKAKEL
FT                   LNELGVPDENQYFEEKGPEERAHYSSQTYDQLVKTERYGWMEVSGHAYRGDYDLSRHIK
FT                   FSGKDLYAFRKYKEPKVVKVKVVKWNAKEIGIRLKAKAKQVIEELKRMNPEEVEKSLEE
FT                   KGYVEVAGERLERGLVWVEEAEEKVTGERFVPHVVEPSFGVERLLYVTLEYALKEREGR
FT                   LVLSLPRRLAPIEAVVLPLLEEKPLVEKAKEVWKLLADAGFRVEYDEKGSIGRRYARYD
FT                   EVGVPAAITVDFQTLEDNTVTLRDRDTWKQVRVRVEELPGKLRAFLNGFPIEELGEPVS
FT                   AGPQ"
FT   gene            complement(512760..514052)
FT                   /locus_tag="Igni_0569"
FT   CDS_pept        complement(512760..514052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81751"
FT                   /db_xref="UniProtKB/TrEMBL:A8A9Z9"
FT                   /protein_id="ABU81751.1"
FT                   /translation="MVKVSVVYGHPEVRVAGGSYSHVVNLATSIAQVLKEKGVDYEVDL
FT                   VFAGRVFVEKPKFDSSLNIKVIEADMYNPLYYNLKNLNATIQRLTRGLFSYFPPLVLSR
FT                   DGVRRLREALKLSSLIISRPPATTSLSLAYWLALRLSSPRDAILVDENFNENLWGLIEL
FT                   GVDAFPSKIKAIAAQASQVWLTRILSCLLHDFVFTISEGGAEVILEEVPWPLKKLCKGK
FT                   MIALYPPLYSKTKYPSSKEGGPFTFCTSGSFYPHQGWKELAKLIYAMNEAFDMHDKIKF
FT                   KIFGAPINLYRFFKNLVGAFSNVEFDYITVKEELYKAYARECDAFLALYDPFRAYKFYG
FT                   APAKLADYVLFNKPIIIWNNEEYLKTLEALTKKCDCAIVVNNFEELLEVALKLVKAGPG
FT                   ECECELRERTRSEEAIEEIIESVLSRRRKLG"
FT   gene            complement(514046..515878)
FT                   /locus_tag="Igni_0570"
FT   CDS_pept        complement(514046..515878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0570"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81752"
FT                   /db_xref="GOA:A8AA00"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA00"
FT                   /protein_id="ABU81752.1"
FT                   /translation="MCGIVAVSCARPCVEERRLVSALDAIEHRGPDGRGYWISEDRKTA
FT                   LGNVRLAIIDPKDEGLQPMFNEDGSVGVVLNGEIYNYKEIRQNLKDEHEFLSNTDTEVL
FT                   LHAYEEMGVDVVHSLRGMFAFAIYDERKGTIFVARDHVGKKPLFYYQGEDFVVLASEPS
FT                   AIKAFVKNLSKNPLGAFYLFAHFSPLPEQHFFENVKLLRNGEYMIIKDGKVIEKKKYYT
FT                   LKFDKRVSDITSYVKELHRELIRAVEYRLIADVPVSLALSSGVDSTLLASIITKELNRN
FT                   DVSTFTVTVKGAGEFDEVELASKVAEELNLDHAVVEFDFEDYIKLTYELTKKVGLPITD
FT                   PSLVMGYGMAKAARERGYKVIIVGEGGDELFFGYPVYKQIYELTLTLSSLPLLELPFWV
FT                   VKEVRSYYNKALCYATLHKLVTARGLSLRSQCCEAFPPELCDLLVLSYRVLESLSAPRN
FT                   LAERLLSYEYNQRIPNHLNLKVDFYSMAASVEARAPLLDYKLIEKAMSLDPAWKRYIMM
FT                   KEPKLIGKLILKKYLSEETWRKVTSRKVGFGQQAKDVLMRIAEEEAPSRLKSSEILKKV
FT                   IDPNIFERYDTKRLSFVAWQVFSYSVWEEVIATW"
FT   gene            complement(515938..517407)
FT                   /locus_tag="Igni_0571"
FT   CDS_pept        complement(515938..517407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0571"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81753"
FT                   /db_xref="GOA:A8AA01"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA01"
FT                   /protein_id="ABU81753.1"
FT                   /translation="MVLLAGATGASLLEDLRDYLNLLDEKGLLHKVNVEVDPVEEVPEV
FT                   LRRLMWRRFDKAVLFEKLKGYPDWKVAGNLFGSTNLIKLALGTEELEELGERFLAPFKA
FT                   SGARSFGEKVKTLMEFINMGKYLPKKVRKGPVLENEKEPDFLSLPAFKTWPKDASRYLT
FT                   YALTVTKDPESGTYNFGIYRIMIYSPKRAVIHWQVHKRGASHYAKYKELGFEKMPVAIV
FT                   IGGDPATLLTGALPVPEGIDKYAFAGVLRGSPVKVVEVGDLLVPAYAEAVITGYVKVGE
FT                   LAWEGPFGDHTGYYTPRDLYPVFHAEKFFVRTDPIYYGTVVGRPPMEDAYIGKATERIF
FT                   LPLIKWLVPEVIDMNLPPEGLFHGIAIVSIRKKYPGHARKVAHALLGLGQMSFTKIVIV
FT                   VDQDVNVHDWGEVAYAIASTVDPERDVEIIRNDVTDVLDHTSPSPPAGSKMIIDATRKF
FT                   KEECGYEWPERSAPDPKVSELVERRWREYGF"
FT   gene            517448..517702
FT                   /locus_tag="Igni_0572"
FT   CDS_pept        517448..517702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0572"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81754"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA02"
FT                   /protein_id="ABU81754.1"
FT                   /translation="MCLGIPATVKEVYEDGTAAVDVFGNEAIVDLTLVPDVKPGDKVIV
FT                   HAGAAIAKVDEERWREAYELWKQVLETLDKLYEEQAQSQ"
FT   gene            517736..519064
FT                   /locus_tag="Igni_0573"
FT   CDS_pept        517736..519064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0573"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: Spore germination protein; amino acid
FT                   permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81755"
FT                   /db_xref="GOA:A8AA03"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA03"
FT                   /protein_id="ABU81755.1"
FT                   /translation="MRELGLAEAVALGVGIIIGASIFSLAGVGVKLAGPNLPEAFALSA
FT                   AYAFLIAYSYAKLSRKFISNAGPVEYVVRAFGDNLLVGTLALIYWLNFVFSISLFTYTI
FT                   AGYALGALGLADDAFLFSISQALIISIFVALNFKGSKAVADTELILVIFKLAVLLTLIV
FT                   LGLRVINPELLKPDASPQGILNALTASSLFLLSYAGFGVITNASENIRDPEKNVPRAIY
FT                   LSLALSAVVYLGVSIVTVGTTERAKVLEAEEYALAVVAKSAIGSWGPALLTLGAIVSAS
FT                   TALNSALYGGANVAYSLAKKGELPESFDRRVWFGEPEGLYVTAALALAFSLSLNLEGVA
FT                   EVTTISLILTYISVVLSHWKLRRVVGGNAAVVLTALVVLVFNAIIILSHEFLTNPLAFQ
FT                   ASVGTAVGALIFEAFYRSWRKRAIKARTLQGAEGLKRQPVETS"
FT   gene            complement(519017..519274)
FT                   /locus_tag="Igni_0574"
FT   CDS_pept        complement(519017..519274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81756"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA04"
FT                   /protein_id="ABU81756.1"
FT                   /translation="MKRGSSVAVCCGRDPLVVLSVKAGLVEHAFVVNDPRELKEDKRFW
FT                   EVMYQDAACPDLGLPKVEVRGSVRRLACLYWLSLKALSAL"
FT   gene            complement(519258..519554)
FT                   /locus_tag="Igni_0575"
FT   CDS_pept        complement(519258..519554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0575"
FT                   /product="DNA-directed RNA polymerase, subunit L"
FT                   /note="PFAM: RNA polymerase, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81757"
FT                   /db_xref="GOA:A8AA05"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA05"
FT                   /protein_id="ABU81757.1"
FT                   /translation="MRAVAQVIAEPEVVVRNDKEVRIRIPNESHTLGNLITKLASRKKG
FT                   VTALYMVEHPLRQVLWITIRTDGSVDPYEVLLETIDEAINYLNQFVRELEEGK"
FT   gene            complement(519551..520156)
FT                   /locus_tag="Igni_0576"
FT   CDS_pept        complement(519551..520156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0576"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81758"
FT                   /db_xref="InterPro:IPR019202"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA06"
FT                   /protein_id="ABU81758.1"
FT                   /translation="MKVRRFVIKCINEEVCYELLHKISEEVSARWIKGEVDGNKLLIEA
FT                   LGFPYELKELRYEIEELKKEIESAMLPYTRVSVDELPKLTKAAVPIDALVEALKLLGYS
FT                   AKVEGRTLVSDAPFEEVAALARKMKEIIDSEIVRFRLPHSMKKAVAVLSTVYGVNPEEV
FT                   VNVMLREGLLEEGDFKYEQREEWRKVIKRVSERLSEEW"
FT   gene            complement(520166..520744)
FT                   /locus_tag="Igni_0577"
FT   CDS_pept        complement(520166..520744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0577"
FT                   /product="RNA-binding protein (consists of S1 domain and a
FT                   Zn-ribbon domain)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81759"
FT                   /db_xref="GOA:A8AA07"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR030850"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA07"
FT                   /protein_id="ABU81759.1"
FT                   /translation="MPFVKNGDVVAPGDPLCVIEEYAPGPGTYEDDGIVRASIPGTVRI
FT                   DTVNYVIEVRGPSAEKKVLSPKEVVYGEVVSMRNELAQLKVARSFDEVFRARAFSAVLH
FT                   ISQAGKPVDSLYDVVRPGDVVKAKVLSSPPYQLSLKGPRLGVILAYCSNCGHPLYKVGN
FT                   QLQCPYCGRVEDRLISPDYILKAKHQPKK"
FT   gene            520798..521241
FT                   /locus_tag="Igni_0578"
FT   CDS_pept        520798..521241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0578"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81760"
FT                   /db_xref="GOA:A8AA08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA08"
FT                   /protein_id="ABU81760.1"
FT                   /translation="MKVRLRNPTPSDAKRIYEIEVSSFDHPFSFLVILSQVILHGDTSL
FT                   VAEVNGKVVGYAIAAKEVDKKLHLLNFAVDPQYRGLGIGSALLESLEKLAKKKGLKSIY
FT                   LEVEEDNYRAMRLYKKMGFVEVGRIRKYYPWGKDAIVMVKEVA"
FT   gene            complement(521225..521662)
FT                   /locus_tag="Igni_0579"
FT   CDS_pept        complement(521225..521662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81761"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA09"
FT                   /protein_id="ABU81761.1"
FT                   /translation="MYGADVLGCKASPEEVVNLMKKYLEFVDYLEGGGVKAIQSMDEEG
FT                   PIAEVRCTEKVTEIYLTTKAPEGLWSEFFGEGALQLRKCIGNGYLSVAKSHVSPKLFVT
FT                   AEGDAGSFEALVTPEGVKAKGTCPFPGVTEIALRSGLKLPL"
FT   gene            521730..522671
FT                   /locus_tag="Igni_0580"
FT   CDS_pept        521730..522671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0580"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81762"
FT                   /db_xref="GOA:A8AA10"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA10"
FT                   /protein_id="ABU81762.1"
FT                   /translation="MPIVWVGEAVGNTPAVLLRRLTSGKGNVMVKLEFMNPSGSIKDRP
FT                   ALYMIKEAEERGLLKPGSTIVEPSSGNTALSLAMLAAAKGYKMVAVVPETTSEQKVKMM
FT                   ELLGAKVIFSKAGVPLGHPEHHYTLAKRLAEENGWVMLDQYKNEANVRAHYETTGPEVL
FT                   KQARELMGGLDAFVAGVGTGGTVIGVGKFLKERVKGVKVVAVVPKGTKIAGFFGSEGER
FT                   LSHAIEGLTAMPVSELIKKYKHVIDEIIEVDDEEAVKTARELASKEGLLAGLSAGANVR
FT                   AALELEREGLRVATVAPDGAIRYLERLTSRRS"
FT   gene            complement(522652..523110)
FT                   /locus_tag="Igni_0581"
FT   CDS_pept        complement(522652..523110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0581"
FT                   /product="4-vinyl reductase, 4VR"
FT                   /note="PFAM: 4-vinyl reductase, 4VR"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81763"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA11"
FT                   /protein_id="ABU81763.1"
FT                   /translation="MESVICMMSTHLDRPVREAPSATSDMFALIYEEMKKVMNTSNAFL
FT                   YNLAKASAKRLASELRLDGEDPLRFATNYLVKSGLAREVEVDEERMVVRGKGLLFGSRI
FT                   RSSEPADAVVAGILAGLLESATGRRVDVKEVACEAKGDPHCEFKIFVR"
FT   gene            523148..524389
FT                   /locus_tag="Igni_0582"
FT   CDS_pept        523148..524389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0582"
FT                   /product="TGS domain protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; TGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81764"
FT                   /db_xref="GOA:A8AA12"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA12"
FT                   /protein_id="ABU81764.1"
FT                   /translation="MRVKVLKRTKKGPVFDLLSRRAEGRRKPMPANLTPEAQAKLAEYS
FT                   EAKTVEAKIRALEEFLKVAPKHKGAENLLYWARRRLAELKEQLETEKKKRKGGRNPFVV
FT                   EKEGAAQVVLFGIPNSGKSSIIAATTRAKVEVSPRPYTTLVPAVGMLPFEDVQFQLVEA
FT                   PGVAPGVGWVHRSIGLVRNADLVAIVLDLSLNPIKQYNYLKNLLEESGISLKKPEGRVE
FT                   IVKERAGGIKVAIMGELVDGDVEDVKRLLRAYGIHSATVKLVGKVSLDDVEKAILGTNQ
FT                   YKPSIIILNKADVPGAEEKVKEFLEAYDGEAPVLVVSAKEGKGLEELGSTIFKVLDIIR
FT                   VYTKKPNGPKAEKPLILKRGATVEDVARSIHSRMVEGFKFAKVWGPSAKYPGERVGLDH
FT                   QVEDGDVIEIHYKG"
FT   gene            complement(524377..525462)
FT                   /locus_tag="Igni_0583"
FT   CDS_pept        complement(524377..525462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0583"
FT                   /product="Dehydrogenase (flavoprotein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81765"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA13"
FT                   /protein_id="ABU81765.1"
FT                   /translation="MRVAVVGAGFSGLVSSIYLSRVANVTLFEEHGEVGVPEHCTGVVS
FT                   GAVWEALSSFVSSEVNEGALEEFFLGLPEGVGVTLKGPKGFAAKLDRRRLEEELLETAL
FT                   AEGVKFVKKLVIRVTPKGYVDNEKYDRAVIAEGWRAELSERLGVAAKPRRVYGLNLEVV
FT                   GRAAYPGRAEVWFDKSLAPGFFSWVVMLDGKAVVGTAATKGYDVRALARKALEVAERRG
FT                   LVEGEVKKEYGGVIQTGPPSLTPCASKVCATGDAAGLNKPVTGGGLYPSLYVASRYPSN
FT                   VDNLVKAYRVIVPRLLAETPVARALHGAPQRAYVKLFTALDGEVLRVTEYDNHLKTLAE
FT                   LVQSKKAFKLLKALLKAFYPL"
FT   gene            525510..526124
FT                   /locus_tag="Igni_0584"
FT   CDS_pept        525510..526124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81766"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA14"
FT                   /protein_id="ABU81766.1"
FT                   /translation="MLASLTDAYVRLKRPLVMGLVSPPTLDKVTSEGVIVNLEVFTRDE
FT                   RLAATYFPKFYVWKDGLAAAPMLVRKEDALALNELRERGNVIIISQLKTKGKVYVFDGI
FT                   MIAVRNKFVGNMAWYSAEGGYPPLAVGEEPLYRSPPLLATVESIISGEGAYVYSERVVE
FT                   VDVKKLLIPPPLALLGIAGWRMRRLAARKEVGEGRRNAEEG"
FT   gene            526108..526530
FT                   /locus_tag="Igni_0585"
FT   CDS_pept        526108..526530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0585"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81767"
FT                   /db_xref="GOA:A8AA15"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA15"
FT                   /protein_id="ABU81767.1"
FT                   /translation="MPKRANPWDAGLDLHALEEVVVEPGEVKVVRTGIAIAIPRGFVGL
FT                   IKDRSSRALKGLHALAGVIDPGYRGEVKVVVTNLGSDKITIRKGERFAQLVIVPVAYLE
FT                   PVEVEELPPNDGRSGGFGSTDEELVRVARGERRGPP"
FT   gene            complement(526541..527353)
FT                   /locus_tag="Igni_0586"
FT   CDS_pept        complement(526541..527353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0586"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81768"
FT                   /db_xref="GOA:A8AA16"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA16"
FT                   /protein_id="ABU81768.1"
FT                   /translation="MQTRAALANRGWRTISFLMKPIYEIYEKKLEAEISKDHLPKHVAI
FT                   IPDGNRRWARMRGLQEWLGHREGYKKMREVLMWLLELGIEVVTVFAMSTENCTRRSPEE
FT                   REKLYELIAGGLRELAKDEIVHRNEVKVMVIGRRNLWPKELLEAAKEVEEATKGYNKRV
FT                   INVAVCYGGRQEIVDAVRKIAWKVKRGELEPDQIDENVITQHLYTENLPDPDLIIRTSG
FT                   EERISNFLLWQSAYSELYFANIYWPEIRRIDILRALRDYQRRQRRFGR"
FT   gene            complement(527496..527572)
FT                   /locus_tag="Igni_R0019"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(527496..527572)
FT                   /locus_tag="Igni_R0019"
FT                   /product="tRNA-Met"
FT   gene            complement(527621..528823)
FT                   /locus_tag="Igni_0587"
FT   CDS_pept        complement(527621..528823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0587"
FT                   /product="26S proteasome subunit P45 family"
FT                   /EC_number="3.6.4.3"
FT                   /note="TIGRFAM: 26S proteasome subunit P45 family; PFAM:
FT                   AAA ATPase, central domain protein; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81769"
FT                   /db_xref="GOA:A8AA17"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA17"
FT                   /protein_id="ABU81769.1"
FT                   /translation="MVAFDIDRKFGGEESDDVEDVELLKRKINRLTKEVKRLKSELEYW
FT                   KGEVNKLTNPPLIEATLLDVLPDGRAVVKSSAGPVLVVEVSSRVPKELLKPGISVAVNQ
FT                   RGSTVVDVLKGLEDPYVKAMEVVERPKTRYSDVGGLKQQLEEVREVVELPLKNPEMFKE
FT                   IGIEPLKGVLLYGPPGCGKTLIARAVAGEVGATFIRVVGSELVNKFIGEGARIVREVFN
FT                   MARKKAPSIIFIDEIDAIAAKRIEMGTSGEREVQRTLMQLLAELDGFDPLSGVAVIAAT
FT                   NRLDILDPAILRPGRFDRIIYIPPPDKKGRLEILQIHTRNMRMADDVDLEKIAEMTEGA
FT                   TGADLKAIVTEAGYNALRNKRKYVTMEDFLAAVDKVMRKRAGASYRLSPREGAPIQIHT
FT                   M"
FT   gene            528976..529395
FT                   /locus_tag="Igni_0588"
FT   CDS_pept        528976..529395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0588"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81770"
FT                   /db_xref="GOA:A8AA18"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA18"
FT                   /protein_id="ABU81770.1"
FT                   /translation="MEVPAAWKKFRYRGKTLEELLEMPLDDFIELLPARQRRSLKRGFN
FT                   DAQRRLLEKVLKARKEMEKGKKVKIRTHVRDMVILPIMVGLTIEVYNGKEFVPVKIVPE
FT                   MIGHYLGEFSHTTAVVKHGEPGLKATRSSLFVAAK"
FT   gene            529406..529885
FT                   /locus_tag="Igni_0589"
FT   CDS_pept        529406..529885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0589"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81771"
FT                   /db_xref="GOA:A8AA19"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA19"
FT                   /protein_id="ABU81771.1"
FT                   /translation="MPTWHYSTDIAEKNPEKTAKAMMWDAPISPKEATELARVIRGMKL
FT                   TEAKAYLERVIKMEEPVPYRRYHGKVAHKRGLADKHGIPMGRYPVKAAKYFLKLLKNVE
FT                   ANAEFKGLEVEKLKIVHIASHKGMTIKRWMPRAFGRATPEFERRTHLEVIVEEVE"
FT   gene            529887..530612
FT                   /locus_tag="Igni_0590"
FT   CDS_pept        529887..530612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0590"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3-C-terminal domain protein; KH, type 2 domain
FT                   protein; KH, type 1, domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81772"
FT                   /db_xref="GOA:A8AA20"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027488"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA20"
FT                   /protein_id="ABU81772.1"
FT                   /translation="MSVAKKNIKKYFLEQALTQVKVDEYLAYKFHSVGYSKVELQKTPM
FT                   GTRVIIYAERSGAIIGRRGQTIKQITKVLEEWFGIPNPQVTVVKVEEPELDARVMAFRL
FT                   ANALQRGFHFRRAAYTTLRRIMGAGAIGAQVKVSGKLRGERARFEKYIAGKVYKSGNQV
FT                   VRLTDRAIAHVLLKVGVEGVEVIISKKSEEERPDDEVRIKSPEEVNEIVQKIREEMQQT
FT                   QPEAPTLEETVEQSGGETQ"
FT   gene            530609..530827
FT                   /locus_tag="Igni_0591"
FT   CDS_pept        530609..530827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0591"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81773"
FT                   /db_xref="GOA:A8AA21"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA21"
FT                   /protein_id="ABU81773.1"
FT                   /translation="MTNLKPDEIRKMSREEREQKLKELKSELITLRYQAKMGHIDNPAK
FT                   IRNIKRTIARILTINREEELGLRRGKQ"
FT   gene            530824..531102
FT                   /locus_tag="Igni_0592"
FT   CDS_pept        530824..531102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0592"
FT                   /product="Ribonuclease P subunit"
FT                   /note="PFAM: Ribonuclease P, Rpp29"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81774"
FT                   /db_xref="GOA:A8AA22"
FT                   /db_xref="InterPro:IPR002730"
FT                   /db_xref="InterPro:IPR023534"
FT                   /db_xref="InterPro:IPR023538"
FT                   /db_xref="InterPro:IPR036980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA22"
FT                   /protein_id="ABU81774.1"
FT                   /translation="MKHTPKNVIYHNLVGLRVEVLAHPDPSMKGLKGRIIDESKSFLTI
FT                   EKDNGELVKVQKLGTFVLVLPSGRKVEVRGELLRGRPEERLKKFLKA"
FT   gene            531155..531562
FT                   /locus_tag="Igni_0593"
FT   CDS_pept        531155..531562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81775"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA23"
FT                   /protein_id="ABU81775.1"
FT                   /translation="MATLKFPSEASTCEECIYYSKLLKYCLKYKVPVEDPRSPPCKPKG
FT                   YFMYTRPDENTLVGELCLPDVGVLSKVIPLKPKVRVGEILDALEKVGCKPKESKRVKDY
FT                   VTIYLTCPCAVRASIKCTEEACVYRIMGKGK"
FT   gene            531559..532119
FT                   /locus_tag="Igni_0594"
FT   CDS_pept        531559..532119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81776"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA24"
FT                   /protein_id="ABU81776.1"
FT                   /translation="MKGAPSALILPFNYFFELKEDFYSSVAGEEAYLVSSPFVVKAYCR
FT                   AERLLLSVPPGSLIAYEEGLLDLGACVALEYFWFEGWELGWEVEDWPEWVDEVARKAGF
FT                   RKGKGRRLNGIEGEEGEVEVVKPWHPAARALEGRCEGGEAEGELLAKCGGSKFLVDNGE
FT                   EIFVGKIDEPWRLLPVVAYASRR"
FT   gene            532213..533751
FT                   /locus_tag="Igni_0595"
FT   CDS_pept        532213..533751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0595"
FT                   /product="Vinylacetyl-CoA Delta-isomerase"
FT                   /EC_number="5.3.3.3"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81777"
FT                   /db_xref="GOA:A8AA25"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA25"
FT                   /protein_id="ABU81777.1"
FT                   /translation="MGLRKPEEYISALREKSKRAEIYVLGERVEDVTKHPFTLPAVKAF
FT                   EWTYKAPWDPYFYDKEMGVHLAKAYSPFINEEINRFNHIHQSPQDLAIKVKYFRKLSHK
FT                   AGSCFQRCVGWDAINTISIISYDIDKWYEQKGEKPEHFEHFGTYYERFLKFLKYVQKED
FT                   IALAGVMTDAKGVRSLRPHEQPNKDVYVHVKEVADEGIIVRGAKANITGVVASEEMIVM
FT                   PTRAMTEKDKDFAIAFAAPIDAEGVTLVVGRYTNDTRRFEEPNVDALPGVFPAEAIVIF
FT                   DDVFVPWERVFMFREYQFAAELVEIFSSYHRQAYGGCKPGLADVIIGGAYHLAKQMGIA
FT                   NKCHIREKLTEMIFLTEAMHAGGLAAAWEGKKAASGTYYVDQMKANVTKQMVTRFPYEI
FT                   ARLAHDIAGGLIGTLPSYKDLMHEKIGKYLQQYLQCLPDYPAEWRHRVLRLLENITLSV
FT                   EFLIESVHGAGSPEAQRIWMRRFYPLEEMEDVALSLAGINPEEKPERKKQKEQT"
FT   gene            complement(533760..534911)
FT                   /locus_tag="Igni_0596"
FT   CDS_pept        complement(533760..534911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0596"
FT                   /product="dihydroorotase"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81778"
FT                   /db_xref="GOA:A8AA26"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA26"
FT                   /protein_id="ABU81778.1"
FT                   /translation="MVEATLISEGERLAVRGPSAACDCETCLEMRGTIALPGMVDAHVH
FT                   TRGLMLSHKEDPLTASRAALKGGVVAIADMPNTLPKINNLEILKKRLEEFKRTCLVDCY
FT                   QYAGVPESPEELRAMSKHVVGVKVYPEDYPNLHVLRNYDGLIVVHPEHPAFVKESPDPG
FT                   ERGLSRSPFAEPAAMELFRGFSKVHFTHVSTPEGARKAEEMGFTFDVTPHHILLNNEVE
FT                   KLKGCVAKVNPPLRDEPRRGMMFDIFVNKDVMMVTDHAPHAVWEKELPFYDCPPGFPGL
FT                   ETALPLLLTLYKRGIISLNKVVRSYSELPAKLLGLWPDLGRLETGSLASFTVVDVNERR
FT                   RVEPWEFESKAKYSPFEGMNLWGEVVATVVRGKIRYFSGNFYY"
FT   gene            complement(534919..535401)
FT                   /locus_tag="Igni_0597"
FT   CDS_pept        complement(534919..535401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81779"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA27"
FT                   /protein_id="ABU81779.1"
FT                   /translation="MRTLIKLGKVRALLLPIDAPTLIYDKVSKRGDEILATLVLYEFGW
FT                   EVGSRVASSAFKKHFEPPEALEKVPELVKWIGLEAEKEGEEVVIRDAPGFSYGCPFERG
FT                   LVAGIMSGLCRAPWDASARVEGTDCIIKPRVRGVSAEEVKDVGEGVRSRLQGEDIL"
FT   gene            complement(535428..535844)
FT                   /locus_tag="Igni_0598"
FT   CDS_pept        complement(535428..535844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0598"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81780"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA28"
FT                   /protein_id="ABU81780.1"
FT                   /translation="MRRRRKIPLTVDDIMTTPPLVVSPDESVVDVAKKMLEHGYGSALV
FT                   IEDDKLIGIVTERDLLYALSEGEEGVKLKASDVMTEDPISVKAKTDIMEAIKIMKDANV
FT                   RHLPVVDDKGRPVGVVAFRDILESLLLLLHLFYC"
FT   gene            535945..536511
FT                   /locus_tag="Igni_0599"
FT   CDS_pept        535945..536511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81781"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA29"
FT                   /protein_id="ABU81781.1"
FT                   /translation="MIRALPALLALALLVTAEPWAVPGFTLVYSYHVKASGLLSLRGKE
FT                   VNGTITYVYLNTTGNTIYVNMTVNANVTLPNGKIKVFKSSTIMKFRDDASLIFLTNKTL
FT                   EGLRGQMRCEDGYCTLNVSTEQALNTGAKVVLNATSKFDLKYMVMVESHSVLKMASLHG
FT                   KRALGTMTTEMRLVKIVPPSTGNVR"
FT   sig_peptide     535945..535998
FT                   /locus_tag="Igni_0599"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.559 at
FT                   residue 18"
FT   gene            complement(536474..537748)
FT                   /locus_tag="Igni_0600"
FT   CDS_pept        complement(536474..537748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0600"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81782"
FT                   /db_xref="GOA:A8AA30"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA30"
FT                   /protein_id="ABU81782.1"
FT                   /translation="MAGIAGALAFDPVWNVARFVYYSLLSLQHRGQEEACLYVADGEKI
FT                   EWVCGKGFVDEVLPPATNLAGWAAIGGVWSEHPGYRAYSEEPAEAAVVLDGRLFNATPY
FT                   DVAKKLSELKASGYEGEDLLKELVKDLKGAFSMLALTASGELLAYRSPPGLRPLQLGGL
FT                   GFDMVTFASESCAFDVIGADLKKDLDPGTGFYASQLYFNEVSVKPSEKVVCAFEYIYNA
FT                   RPDSVIDGVEVYEVRERIGKRLAQLYPRDVDVVVGVPETAIPFAIGYSKEAKKDYRLGF
FT                   IATGRKARTAIKPDLSERLIGVQLKLNPIRSTFRKKRALIIDDSVVRGLTLKTVIQTLK
FT                   SKVGAVSVDVLIGSPKIISHCPYGVEVPPADQLIAAKMDNEKIAEYIGAKSIEWLPPEE
FT                   LEKLIPIKACMGCFTGRYPLREERS"
FT   gene            complement(537755..539272)
FT                   /locus_tag="Igni_0601"
FT   CDS_pept        complement(537755..539272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0601"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81783"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA31"
FT                   /protein_id="ABU81783.1"
FT                   /translation="MVEVIKLSDRPSAFDKYPVVKDDVRNALKRGGVVAVGDPEGLTEL
FT                   AKEAKDSFWYRLFLCHDGCPEEVVETLAKLADHWEVHYSVSFQYPRGKVDRRGAIQKLV
FT                   KEGLKARIVAVPENTFACASPSCRMCKSVCPSNAIRLKEGRVSIDPDKCTSCGLCVAAC
FT                   PLYSLDMPGLAPNELFAAVPPAKAGAAERVVWRTPDTLSPSDFKERTLVVLGIPLRVRI
FT                   IVEYFTKVLGWEYCDDEGCVRPSKAEPRRCDHSLPEDVSPLVSIKMAYSLEDFYEVVVN
FT                   PKLCDACTACSEACPTRSLVLRTPTPAMVILTHLPAACVGCHACVRACPVQKKLDALGL
FT                   NIKMIRVVEGEGECVWKNLVVKRIFRPKCAVCDKFLDVDVDEYINAVERFVERVSRGEF
FT                   ENVFDISSFLNKSEDLLKVLLCKECYSKYKQGVLPPQTVAKLVLLTVGCVYEQEGVRRG
FT                   WADPVKALWHVASQLEVGGISYCSELNAYKALFGGVEFNLRGGPRQR"
FT   gene            539523..540248
FT                   /locus_tag="Igni_0602"
FT   CDS_pept        539523..540248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0602"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81784"
FT                   /db_xref="GOA:A8AA32"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA32"
FT                   /protein_id="ABU81784.1"
FT                   /translation="MRPPKFVLDEIAKSIAGEIALSDDPGSTLKKWREIFEVGIRELAR
FT                   KMNVSPSVISDYEKNKRAPGSKYIKKFVRALMEIDAERDWKVINSLAQKMLGIKSKALD
FT                   IYEYKRSVRLEELVNASKGYIVNSRFDPNEVVYGFIILDSLRSIEELDSKDFLLLMSMS
FT                   YKKALVFTKVGTGRPPMVAVRISQIKPVVVILHKPVNLDRLAVRIAEKEGIALIVSLCS
FT                   EPGELMDRLRLLDVQQPSS"
FT   gene            complement(540230..540604)
FT                   /locus_tag="Igni_0603"
FT   CDS_pept        complement(540230..540604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0603"
FT                   /product="Nascent polypeptide associated complex NAC"
FT                   /note="PFAM: ubiquitin-associated- domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81785"
FT                   /db_xref="GOA:A8AA33"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA33"
FT                   /protein_id="ABU81785.1"
FT                   /translation="MLPFGFNMKALEKMLKKAGLKVYELEGVERVIIEGVDEKIILVEP
FT                   KVLELELPGQAKAYQILNPKEVVKEKGVEEGQEVQEVSEDDVKVVVEQTGCSPEKAKQA
FT                   LIETKGDIAEAIVKLQEEGC"
FT   gene            540675..541961
FT                   /locus_tag="Igni_0604"
FT   CDS_pept        540675..541961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0604"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81786"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA34"
FT                   /protein_id="ABU81786.1"
FT                   /translation="MGAEITFLGGAREVGRAAYWVKDGKASLLLDYGVSFDEEDRPVFP
FT                   EYVSPKDVGAVVLSHAHLDHSGALPMLYSAIRRPAYMTKLTKELTAILINDFLKLSGYY
FT                   ATYGETEVKEFLESVRTVDYRRTVEIPEAGGTLLTFYDAGHIPGSAMVKLELPSGLKLL
FT                   YTGDVRLSETQLLGGADVSGLEADVLIIEATYGKSDHPPRENVEALFVSDVREVLQGGG
FT                   TVLVPAFGVGRGQEILAVLADHEVEGDVYLDGMVRNVTELLIQGENKKFLKNPDMLEKA
FT                   YEEAKVVRGWQDRRRVWKRNGVIIASAGMLRGGPSLYYARKIQGIPKDAIFLVSFQAPG
FT                   TPGRRLVEEGVIEEGGPRVEARTQWFDFSSHAGASELLEIIKSVNKLKKVIIVHSEEST
FT                   ALHFAQRVREETGLDVIVPKPMETLKVEV"
FT   gene            complement(541962..542219)
FT                   /locus_tag="Igni_0605"
FT   CDS_pept        complement(541962..542219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81787"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA35"
FT                   /protein_id="ABU81787.1"
FT                   /translation="MPVLLKNFDELKSRVLVKAKDAVRKVKVTKAPDFSKVKVLTNRRM
FT                   YVIVVPSDRLDETLENVKKEVGKEDLEVEVHEVKKPLYKK"
FT   gene            complement(542257..542901)
FT                   /locus_tag="Igni_0606"
FT   CDS_pept        complement(542257..542901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0606"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81788"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA36"
FT                   /protein_id="ABU81788.1"
FT                   /translation="MIISLDELTHEDGEFLVRLARKTIESYLTAGELPRVEVPEKLKKL
FT                   GAAFVTILTYPERELRGCIGYVEPVKPLAQTVMEVAVAAATQDPRFPPMSPGELDHVVV
FT                   EVSVLGDHTPFRPARRALPYIRIGETGIIIRRGPFSGVLLPEVPVEYCWDPETFIAETC
FT                   VKAGMPPDCWLDEDTEAVLYRGRTWTEVEPRGEVVERDLKREYAERCGRSV"
FT   gene            complement(543007..543639)
FT                   /locus_tag="Igni_0607"
FT   CDS_pept        complement(543007..543639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0607"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81789"
FT                   /db_xref="GOA:A8AA37"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA37"
FT                   /protein_id="ABU81789.1"
FT                   /translation="MRLVEIGLKELDNQIMKMAELSKRAFELSTNAIEERRASELRDEV
FT                   KEMVGKLGQLREEVNELALEIIARYQPVAKDLRKVKASLELSYAFFRFARYAYDALSAF
FT                   ARLESLGVKCEPKHFASLAPIVKSMIEGSIDALKNMDVLKAMKIITKDDEVDETYHSML
FT                   MDIIKNYENVPCAVVEALSIKFLERAADHSVQVASQVVFVVEGRYPE"
FT   gene            543699..544730
FT                   /locus_tag="Igni_0608"
FT   CDS_pept        543699..544730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0608"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; PFAM:
FT                   acetohydroxy acid isomeroreductase; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81790"
FT                   /db_xref="GOA:A8AA38"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA38"
FT                   /protein_id="ABU81790.1"
FT                   /translation="MGLNAGALRRVGVTVAQIWKDSDVSLEPLKGRKVAIIGYGSQGRA
FT                   WALNIRDSGVDVVVGLRPGGKSWELATKDGFEPKPIPEAAKEGDVIAMLIPDMAQPEIY
FT                   EKYVEPNLHEGNALVFAHGFNIHYGLIKPPKNVDVIMVAPKSPGPKVREAFLSGRGVPA
FT                   LVAVHQDYTGKAWDLVLALAKALGCTRAGVIKTTFKEETESDLIGEQTVLVGGLMELLK
FT                   KGFENLVELGYQPEVAYFEAINEAKLIMDLIWQYGFYGMLLRVSDTAKYGGLTVGPKVI
FT                   DEHVKENMKKASERVISGEFAKEWVEEYKKGMPTLKELMEKVKEHQAEKVGKELRKLMG
FT                   LEE"
FT   gene            complement(544952..546916)
FT                   /locus_tag="Igni_0609"
FT   CDS_pept        complement(544952..546916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0609"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: V-type ATPase, 116 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81791"
FT                   /db_xref="GOA:A8AA39"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA39"
FT                   /protein_id="ABU81791.1"
FT                   /translation="MCLKAALFPDRMFKVRVVVPKDSADKLVEKIVNLGSYEPAEAKVE
FT                   FGAPIEWARRDLLVIMDHINKLEQYFEFFELSVEPEMGEPVKVKSWEEAAKVAAERAKK
FT                   IEDEFEKYTSRIKEIEAKMFDVSTLISKPAELPKDVVEKLKETFNLIISREIPAELRKD
FT                   LAVVDLAAKEALKISTEIVRKVALELLRLLEEEKKFLIEEAKAWASDYEIEISNTYALL
FT                   LSVKNALEVLSKGRESDYFVYLEGYVPESFFKNTLKALKDYVASVGFALVHMVDYDSEK
FT                   PPTYVKVESQSAKTAYDVENIYGPPDPREFVPAAIMAFTLPFIYMFMFPDWGHALVLVL
FT                   FGWGLVNRKGWALAVFRPFGLRRFTRGTEFLGRIMMLVGTASIITGWLSAEFFGPLIGE
FT                   SAVDPAMWLWGALGMAPPLSFGLEHLGDTVIKYVLLSITIGYFHLLIGFLIGILNELRF
FT                   GRPWKALHYVFPFMLMYATAGAPFAAGFIASGFGSDIEQMMYLTGLYFNEWMFNLKTGH
FT                   IGPLFVLFVIALLWRGYGIKLELEHEHGRAQASIVGMEMFDNFLLVISNIISYVRIMAL
FT                   ALAHWGLVFAFQVIGEIGGPVLLAILYVLANIMVIMLEGLVSFIHNLRLHFYEWFTKFY
FT                   IDRGKLFEPAVQYTKIIIE"
FT   gene            547026..547772
FT                   /locus_tag="Igni_0610"
FT   CDS_pept        547026..547772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0610"
FT                   /product="DNA polymerase sliding clamp subunit A"
FT                   /note="PFAM: Proliferating cell nuclear antigen, PCNA"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81792"
FT                   /db_xref="GOA:A8AA40"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA40"
FT                   /protein_id="ABU81792.1"
FT                   /translation="MKIVYPEAKIFQSLVDAIGKIVDEVALVAKPEGVEMKAIDPAQVV
FT                   MIRIYIPADAFSEYEVEEEESLGFNIGDILKFFKRAKKGYKLELGSEAEGSKIRIVLEG
FT                   ALIKKYVIPNLEVVSEELPDLSNLDFKVKALLLASVIKEAIKDIEAVSDVMIVEAPDAD
FT                   NLYLKGAGVAEAVTRVSRASSALLELEVEEPSKAAYDLTYLKHIVGITKVSDNVEVRFG
FT                   TDMPLYLKFNILAGGEAEYVVAPQAL"
FT   gene            complement(547791..548198)
FT                   /locus_tag="Igni_0611"
FT   CDS_pept        complement(547791..548198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0611"
FT                   /product="S-adenosylmethionine decarboxylase related"
FT                   /note="PFAM: S-adenosylmethionine decarboxylase related"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81793"
FT                   /db_xref="GOA:A8AA41"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA41"
FT                   /protein_id="ABU81793.1"
FT                   /translation="MMASREALNLTDKGAKVKVYGKHYYGNLYGCNVEKLKDEEYLRDL
FT                   VVEAAKVGNMTLLDVKSWKMGEGVSVVAIVLESHITIHTWPEFAFATVDVYSCGSHTDP
FT                   RKAFEFIVRNLEAKKVVGGNADRSLVEGDGV"
FT   gene            548278..548958
FT                   /locus_tag="Igni_0612"
FT   CDS_pept        548278..548958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81794"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA42"
FT                   /protein_id="ABU81794.1"
FT                   /translation="MSSDAQRRAANHAVLVVDPFLKDAIENIMREGQIGEVSETTFPDV
FT                   IFTKSWSNDVALLTFADSQYLAEAILELKVLGMRKIVFLDVATALKPGLKVSQAYPVYA
FT                   TSTPVKEEFYVPLVPSMQLLNAVVELLEPEREVIAFTSRLPPQDVAMTDLLKKKGFDVI
FT                   DKNSGLVYEVCKGSVECVTLDLIDSNLAKGIEKKTAWEEGGKYYSSILDTLTDLFKKLL
FT                   SAEL"
FT   gene            548967..549218
FT                   /locus_tag="Igni_0613"
FT   CDS_pept        548967..549218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81795"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA43"
FT                   /protein_id="ABU81795.1"
FT                   /translation="MKLDFSKIRTMLEQLATKEKKARRPKERAVPAYLRKCKYCKHLEL
FT                   TYCRFHAVTIHPESRACPAFVLREEFAVQPKKEEGTVA"
FT   gene            549272..550363
FT                   /locus_tag="Igni_0614"
FT   CDS_pept        549272..550363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0614"
FT                   /product="MgtE integral membrane region"
FT                   /note="PFAM: MgtE integral membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81796"
FT                   /db_xref="GOA:A8AA44"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA44"
FT                   /protein_id="ABU81796.1"
FT                   /translation="MRKFLAETASLVVQAILEAVVGHLWSLASPILKEHPGILIAMPGL
FT                   AEDRGAVYGSLAAKYSTMLYLGEASNAKELLKSKVTYSAIVVGVIGGLYVILLVSTVAE
FT                   PLAPLIYFLVSRGLILLTLVPLTAYLCYAAFLKGLDIDLTVVSLITVIADLLSAISLFI
FT                   VFSEVSLVFIAVTIAITYKSLATAGLRRALGYKKEYLASSLIASTISTLAGLTLAEGGA
FT                   TEVPLLLAVAPLIMALNGSASMNFASWLGTALALGEVEASRPFSKKVLATNLRVTAEVL
FT                   VALVSSSALFALGPHGIRALEVALVSTLLLRAVMPLITIVLASWSYLRGWDPDLITIPI
FT                   LSSLGDLLSTNVVLLTYRLLFNP"
FT   gene            complement(550360..551379)
FT                   /locus_tag="Igni_0615"
FT   CDS_pept        complement(550360..551379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0615"
FT                   /product="exonuclease of the beta-lactamase fold involved
FT                   in RNA processing-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81797"
FT                   /db_xref="GOA:A8AA45"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA45"
FT                   /protein_id="ABU81797.1"
FT                   /translation="MFSVATVTETKAILLGSQVTVDGFTPRRKVRVITHAHADHTKDIG
FT                   KSLSYQETILVTEETAVFLKHTYRSLRSTRKLVVLKPGQTYKVPVDSRRGGYEVIKFVK
FT                   ASHIPGSVQVVVEDEEGRTFGYTGDFKEPGTGTPVLQGLDALVVDATYGCPLCIRKYKE
FT                   TMDEELVRLVLELLGRGPVHVYAYNGKLQEVMELLRLHGVDAPYLLSRREFLIAKDLEK
FT                   LGYTFGEYFLEGSPEAKEIERDGWYVRFSKFHNFRQERVRGSKVLLDGWQFVPVQKVGP
FT                   NAWRVGFSDHADLEDLEYYVLESKAGEIIIDASRASAAQWFASRLELYGLRKVSYRPI"
FT   gene            complement(551424..552020)
FT                   /locus_tag="Igni_0616"
FT   CDS_pept        complement(551424..552020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0616"
FT                   /product="Proteasome endopeptidase complex"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81798"
FT                   /db_xref="GOA:A8AA46"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA46"
FT                   /protein_id="ABU81798.1"
FT                   /translation="MSGPGATAVGIKVKDGVVLAAERRMSYGGFIMSKAARKVFKVGDR
FT                   MGMACAGLYADMQAIARALENEIRYYEISNKRKMKVRSAARLLGLILYSNKLFPLMTET
FT                   VFGGYDDEPRIFVLDPVGSVIEEKYSAVGTGAPLAMALLDKEYREDMSLEEAQNLAIES
FT                   VKVASGRDSLSGDGIDVLVIPFGGKPSIRTVSLEA"
FT   gene            complement(552058..552975)
FT                   /locus_tag="Igni_0617"
FT   CDS_pept        complement(552058..552975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0617"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81799"
FT                   /db_xref="GOA:A8AA47"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA47"
FT                   /protein_id="ABU81799.1"
FT                   /translation="MRDALVVGAGPAGLTAAATLKQYGVEPLVIEAERVMATVYSYAWK
FT                   PVENYPGFDGKRAIEIARAFEEMQKFFGVEVVEKERVVKAWKEGDKIVLGTQSGNEYEG
FT                   KVLIIAIGILGKPRRLGIPNEDAPNVHYIVKDPTAFAGSKVVVVGGGDTAVDTATVLAE
FT                   SGAQVTIVHRRDQFRAPMRSIERMVRAGVKMVLNSVPKEIIAKDGKATALVVTHKEGGE
FT                   TVLPLDHLVISIGFEPPDLEWVKSLGVNMRGKEILVDDKMRTNVKGVFAAGDITPAPKR
FT                   ILVAAAQGYIAGFTAFRYIRTGVW"
FT   gene            complement(552972..553817)
FT                   /locus_tag="Igni_0618"
FT   CDS_pept        complement(552972..553817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81800"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA48"
FT                   /protein_id="ABU81800.1"
FT                   /translation="MRKAALLVFLLVSTALSACNLTAPLGFDEDTLLRYDNMIKGFIER
FT                   IKADIITLRPENGYQKALYKLALENLERASALYSEARSLTLRKEYDLAMAKYLATLYFA
FT                   LVTQDIIGLVKVKTFNELASYLDRLGAFASSSTFSLYKSSCMSTVCTNSTRVVYIKSYL
FT                   IMKNVTNRINSIKVNLPPAFTVSLARELADVVADSSKLVVLAYTHFALSYARHVQDSAL
FT                   EGSAPCGVRGLGSAWWLPKACYHFYHSMKPSPCSSFYGVVSEYIGLKDLAERLCGVKVG
FT                   "
FT   sig_peptide     complement(553761..553817)
FT                   /locus_tag="Igni_0618"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.901 at
FT                   residue 19"
FT   gene            complement(553839..554759)
FT                   /locus_tag="Igni_0619"
FT   CDS_pept        complement(553839..554759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0619"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; Methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81801"
FT                   /db_xref="GOA:A8AA49"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA49"
FT                   /protein_id="ABU81801.1"
FT                   /translation="MTSGAHRTIPLEEIEALHEVYSCPLEVLSVHYNLVLAKASFECSK
FT                   RIVERSAFVKEVGKVCAVCDEVACDWFEDCSFERLRFRKLGGLTPPRTRAFPTVPGAGE
FT                   AIATAVEGFLIISKERALRRLGRSPKGPFFSPGSMDPLLARAMVNLSRVRPGERFLDPF
FT                   CGTGVIAQEAWRVGALSFCADLDPSMVYGSRINAQHVGAEAEHVLQDSAQMPFRRSSFS
FT                   AIATDPPYGRSVLSLGHSAEELLLEFLQEARRVLKAGSWVVFAASTSINAEEMIKRAFL
FT                   KLNKCHTMRVHRSLARYVCTAYTGR"
FT   gene            complement(554756..555463)
FT                   /locus_tag="Igni_0620"
FT   CDS_pept        complement(554756..555463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0620"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81802"
FT                   /db_xref="GOA:A8AA50"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA50"
FT                   /protein_id="ABU81802.1"
FT                   /translation="MKVLGLLGSPRRYGNSFKGLMMALKAAERFGAETEWLHLYELDVK
FT                   PCLGCASEDVKACRYPCVIKDDMKIIYDKVLEADGIIFATPVYWYSPSAVMKNVIDRLT
FT                   ALENMIHIDGKSWMDGKVVGFVATGNDSGAMFAVAQMMSILNSMGAVIPPWSMAYINGP
FT                   GDALELKNFVLDALNVGRSVVMMIKAMRGEKVEKWYDPDLLEWYEREVKPWLIRVVKEE
FT                   EEKAEKPWKSSTS"
FT   gene            complement(555567..556361)
FT                   /locus_tag="Igni_0621"
FT   CDS_pept        complement(555567..556361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0621"
FT                   /product="N2-acetyl-L-aminoadipate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81803"
FT                   /db_xref="GOA:A8AA51"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA51"
FT                   /protein_id="ABU81803.1"
FT                   /translation="MIVVKAGGRTLLNNMDEIVKSISRLEKAVFVHGGGDLVDEWERKM
FT                   GMEPQFKVSASGIKFRYTDEKELEVFVAVLGGLLNKKIVASFASYGRGAVGLTGADGPS
FT                   VIAERKKKVIVQEKVGERLVKRAIAGGYTGKIKEVKTDLIKALVERGLVPVVAPIALSP
FT                   EGELLNVNGDQMAAELAKALSAEYLVLLTDVPGVLMDGKVVPEIKSSEAEEVAKKVGPG
FT                   MNIKIIMAGRVASGGTKVVICDGTVPDPLKCLEERSGTWVVP"
FT   gene            557836..557944
FT                   /locus_tag="Igni_R0020"
FT                   /note="tRNA-Lys1"
FT   tRNA            557836..557944
FT                   /locus_tag="Igni_R0020"
FT                   /product="tRNA-Lys"
FT   gene            558010..559266
FT                   /locus_tag="Igni_0622"
FT   CDS_pept        558010..559266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0622"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding;
FT                   UDP-glucose/GDP-mannose dehydrogenase, dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81804"
FT                   /db_xref="GOA:A8AA52"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA52"
FT                   /protein_id="ABU81804.1"
FT                   /translation="MRIAVVGLGYVGLPLATALASKGFEVVGIDIDEKKVEKVNKGVAP
FT                   IEEPKLPEMLKEVVSKGLLRATTNYDVIGETDAAIIAVPTPVKGGKADLSYLESALREI
FT                   GKRMKEGYLVVIESTIPPGTTQGLAKRVLEEASGLKHGEFYLAHAPERLAPGKAMEELF
FT                   KVPKLVGGLTEEDAKRAASIYSKLTEGGVIITSAINAEMSKLAENTFRDLNIAFANALA
FT                   LLAEKLGADVWEVIKLANTHPRVNIHLPGPGVGGPCLTKDPYMLAEPMEDTSKNLIITA
FT                   RKINERMPHHFAELVKNMVKRGEKVALLGLAYKGGVDDIRESPTLKIYDLLKDDYEVAV
FT                   HDPYVKEAPIPFTNDLLSAVRGASLIAVVTDHPDYKEIDWGEVAKVVKEKKVLDGRNVV
FT                   PKEEVLKFGFVYKALGVGT"
FT   gene            559263..560348
FT                   /locus_tag="Igni_0623"
FT   CDS_pept        559263..560348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0623"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81805"
FT                   /db_xref="GOA:A8AA53"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA53"
FT                   /protein_id="ABU81805.1"
FT                   /translation="MIAVVVGTRPEIIKMAPVVLELESRGIDYTFVHTGQHYDYEMSKI
FT                   FIEELGLPEPHFSFELKGSTPGEQIGEMIIHLDKISQERKPKVVAVQGDTNSMVAAAIA
FT                   ALKVGAEVAHVEAGLRSYDWRMPEEHNRRMIDHVSKYLFAPTEDAKRNLEEEMVYGEIY
FT                   VTGNTVIDALDRYMGLAEERSKEVLEKVPFDEFGVVTFHRAENVDNPQTLKDFVRILER
FT                   SPIPLVYPVHPRTRKRLLEFGLWDRVKRIPHLMITEPLGYLEFIGLLKNSKIVLSDSGG
FT                   LQEEVTHPKIRKRIIVLRTSTERPEAIKSGFAYVVGTNPVVVLATLERALNEGAPLPEA
FT                   SPFGDGKAGKRIVDVLERVGS"
FT   gene            560345..560605
FT                   /locus_tag="Igni_0624"
FT   CDS_pept        560345..560605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81806"
FT                   /db_xref="InterPro:IPR023811"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA54"
FT                   /protein_id="ABU81806.1"
FT                   /translation="MKVCMRVVKVEGECAAGYEVGDEICFEGFRLVSFTKPVCLHLLAS
FT                   ALHVVYAMLKGINPEEMGFEDGLLRCPDPKRGSVTVKLERR"
FT   gene            560850..561857
FT                   /locus_tag="Igni_0625"
FT   CDS_pept        560850..561857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81807"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA55"
FT                   /protein_id="ABU81807.1"
FT                   /translation="MEVTLVYNVPKPFGGAYVHLLNNVLGAARAGFAVKLFPRTGISKY
FT                   IKEDLKFLGFDIAVEEADGVEGLVYLRPSDIRSDLKYVRNINNIDVIEVNSMPLWLAAE
FT                   GAVGLKGPAKFLASVVRDVLVRIMLMRSKRVVTVSSMAAKLLKRDALVEARVVPNQPLP
FT                   GMGERVGAGRYLCFPSSYYYSYQGLDVFLKAVKMFDLKDYVLLIGKVNVGGLKSVVAKG
FT                   VRELVKAYSLCKAVISPHKDSTPVPFFGSPTKVVDALAANKALVVSDLPSIRETIEANL
FT                   KGGWDCIRFVKSGDPVSLGEAMVEVLREGPECNYELKEGPISRFWLELYNEEAK"
FT   gene            complement(561836..562786)
FT                   /locus_tag="Igni_0626"
FT   CDS_pept        complement(561836..562786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81808"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA56"
FT                   /protein_id="ABU81808.1"
FT                   /translation="MRVTLLYSASSRDSPPALRMRYLREALEERGFEVKEINLPKSRLT
FT                   YLRPKKVTDEVVLFSAPPAYVAFAARGTKLVGDLRDPWDVYAREGGLLKGLATAPIVAR
FT                   YLGKLRRSDLLVATTRSIAEHYERLTGKEVLVIENGTDPEALKCDEDRRERGALLIADF
FT                   SNPYLPVRPFLGVAREMELDLALVGPGSEKYGGVGRVPYERLKEVGCKYSIGVIPRPWR
FT                   GKTYEMTIPLKTYDYMALGLCVFAYGPPAGELKRLVEEEGIGVYASSPEELKAKLKECL
FT                   DVCPEAGARARRLAEEKYDRRALSRKYADYLASSL"
FT   gene            562836..564044
FT                   /locus_tag="Igni_0627"
FT   CDS_pept        562836..564044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81809"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA57"
FT                   /protein_id="ABU81809.1"
FT                   /translation="MRRALALLAFATLALAITNDTIKLGYRDLVDYFVGAQRPCGGFFD
FT                   CEPNYYRSDALIAYYLAPEDPLTLDAAEVFVKNVFLKEYDLWYLMDPNNKIYTWWPLFN
FT                   ALALLSSNISDDLVVAVENIISKNFGPRGLRTCLPLYYQNYFGWVPYDLMSTLLALAIA
FT                   KKSEIVDKNLDFQKLNSTLEPNFWNVLKKYLRGEINARLRKDYVVAWLSLLAMGQGAKL
FT                   RAEVCGILNQTYFKKVYYSYTNLTPVDFDAQATSLLIDASLTCSAFGHLNSTYARKVAE
FT                   WLLESYIIRNGGEWPRRFEALSALRTLMGFPSLNFELVSTEKWPQREIEEQLQNSTQSA
FT                   TVPTIIETKTVHETVTLSSSTTKTIEVGLPFGGLLGLLPFGVRRLSSRRKRGPSCSGRP
FT                   SPK"
FT   sig_peptide     562836..562886
FT                   /locus_tag="Igni_0627"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.771 at
FT                   residue 17"
FT   gene            complement(563989..566217)
FT                   /locus_tag="Igni_0628"
FT   CDS_pept        complement(563989..566217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0628"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: oxidoreductase domain protein; Alcohol
FT                   dehydrogenase, zinc-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81810"
FT                   /db_xref="GOA:A8AA58"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA58"
FT                   /protein_id="ABU81810.1"
FT                   /translation="MKAVVIKGSKVSVEEVPPPRVGDNMVLVATAYSAISAGTELASLR
FT                   AKKVKEGWLLDKLPLPKPVRMVLENPYYARLALQKIREGGLKELLKYYQKAKEVAVKGR
FT                   FSGYSASGYVIGKGSGVIDVNKGDAVAIAGVGFASHAELNATPRRLAVKIPEGLGLKEA
FT                   STVALGAIALQGIRRAELHQGDSVAIIGLGLIGNLAAQIAKSYNLKVVGFDINDKRVEL
FT                   ARSKGVLAFNSTSVNPVEKVMELTEGFGADAVIIAASSDKPGLIDLALDMLRHRGKVVV
FT                   LGAFPMQFDRTRMYLKDAEIRISVSYGPGRYDPVYELGGVDYPIGYVRWTEERNMKEYL
FT                   RLLAEGYVDLEGVVGAVYPVEEAPKAYQDLLEGKINGLTALISYDYEKYLKESSIVSLI
FT                   EISGGAPAQVVKKGSKPTASFIGFGSFASNVLYPIVKEVFELNGVAVTDPLKAKDLLKK
FT                   GFKFSTTNYKDVLEREENLIIIATRHSQHYPILKDALLNSKASVIYVEKPPVLTPEQLE
FT                   EINELVKESGKEVVVGFNRRCSPITQLIKEVVGDRAATLSYRVAAGKLPKDHWVYSPEE
FT                   GGRYLGEGCHFVDYALAIFEGREALKGSAVFVPPDNASLYDTDLWSSSIAFERALANIV
FT                   YTSLNPKDVEKELIEVFVEGKVGVKVYDYKRVEFYGDYAQWVKRCEELCSRYSPNAEGN
FT                   LVTLGEQAKGWREEVEQLKELLTSGRAGCLATWEKAYRSMKVLFSFYY"
FT   gene            complement(566198..566491)
FT                   /locus_tag="Igni_0629"
FT   CDS_pept        complement(566198..566491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81811"
FT                   /db_xref="GOA:A8AA59"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA59"
FT                   /protein_id="ABU81811.1"
FT                   /translation="MKKAHKLTIAMATTVVIYLLLLALTWLTPPEPFLTFLRVYLTLVN
FT                   SAIAALVLWALFTVSKRPRPVPLPELEKRYEEELKRLMKEWEKVEGSEGGSN"
FT   sig_peptide     complement(566420..566491)
FT                   /locus_tag="Igni_0629"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.578 at
FT                   residue 24"
FT   gene            complement(566519..567688)
FT                   /locus_tag="Igni_0630"
FT   CDS_pept        complement(566519..567688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0630"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81812"
FT                   /db_xref="GOA:A8AA60"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA60"
FT                   /protein_id="ABU81812.1"
FT                   /translation="MIPVTTMVVGRGTVSTKIKGEYHRKKPSRFTDYFRPLVFWNITYQ
FT                   CNLRCLHCYIRAKAQQDPSELTTEEAKRLSEEMVEMRIPLVILSGGEPLVRKDFWEIIE
FT                   PMAKAQFPKLSLSTNGTLITKDVARRLKDYGFSYVGISIDSIVPAYHDKFRGVPGAFKA
FT                   TLEGIKNSVEAGLDVGIRTTITRYNVKEVPDIVKWSAENGIKRVSFYLLDTIGRGEEIK
FT                   DWLPTKEQLKWMADVVIDLAREYADQLEILIVRGNFMGIYIARKLAKDEEEFKEYLKML
FT                   QAQGDCGRKSVSIYPNGDVKPCQFIDWVTLGNVREKSLKEILKRDNPQLEPFLNVGQYL
FT                   KGKCGRCPYKDICGGGSRGRAYAIFGDPWAEDPLCFIEPEALAKEFLAA"
FT   gene            complement(567730..568689)
FT                   /locus_tag="Igni_0631"
FT   CDS_pept        complement(567730..568689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0631"
FT                   /product="Deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /note="PFAM: deoxyhypusine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81813"
FT                   /db_xref="GOA:A8AA61"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR022899"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA61"
FT                   /protein_id="ABU81813.1"
FT                   /translation="MNREDFIKEPVEDIRVSERDTVADLIEKYCKVHGFTAADVCRAVE
FT                   VLSEGLRNSDLRFLSFTANLVATGLRGLLAQMVRSGYFDVVVTTCGTLDHDVARSLGHK
FT                   YYKGYFEADDVVLAKSDIHRLGNVFIPVENYGPPVERLVKDVLRELGKTMVAPYELIWE
FT                   VGKRLSDENSILRAAWERKVPVIVPGITDGAFGTAIFTYSEELKLQGKDFCLDVLADEK
FT                   LLSDMVFSSKRSAALVVGGGISKHHVIWWNQFKGGLDYAVYLTTAQEYDGSLSGARPRE
FT                   AITWGKLKPEGRSATVYGDATVLLPIIWAGVLAKVQKA"
FT   gene            568762..569322
FT                   /locus_tag="Igni_0632"
FT   CDS_pept        568762..569322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0632"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81814"
FT                   /db_xref="GOA:A8AA62"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA62"
FT                   /protein_id="ABU81814.1"
FT                   /translation="MEENVLEVAIKKFLEEMGEDPSRPGLSETPERYVRALRELFKGLE
FT                   TPKPELKTFKTEYLLGENDLIVVKNVSFSSLCEHHLLPILGRASIVYHPKRDEVIGLSK
FT                   IPRIVKWLAKRPMLQERFTAMIADEIMKAGARGVYVLVRAKHSCVAVRGVEDPDVEMIT
FT                   EAVRGTLEANPSLLERARKLVLD"
FT   gene            complement(569314..570240)
FT                   /locus_tag="Igni_0633"
FT   CDS_pept        complement(569314..570240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0633"
FT                   /product="spermine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81815"
FT                   /db_xref="GOA:A8AA63"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA63"
FT                   /protein_id="ABU81815.1"
FT                   /translation="MHRVPLKTFNWFLEVQTPCSMHAHGLLETLYVGKSKYQEIVVARL
FT                   CNVGKALILDGKIQSSEYDEWIYHESLVHPVMLAHPNPTEVLILGGGEGATLREVLKHK
FT                   SVKKVTMVDLDEEVIKVSKKYLPEWHRGSFDDPRAELVIEDGRKFLEEAPENSYDVVII
FT                   DLVDPTEGAPAAKLYTKEFYELVKKVLRDEGIMVTQATSTSYTLDVFTVVYRTVKEVFE
FT                   KAGGYHSFVQAFDATWGFVWGSTGPDPSSLSPDAVDRLIRERLEGELKYYDGITHVGMF
FT                   SLPKHVRKAMAAQTTVSTDERPYLALV"
FT   gene            570264..571226
FT                   /locus_tag="Igni_0634"
FT   CDS_pept        570264..571226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0634"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; SMART:
FT                   serine/threonine-specific protein phosphatase and
FT                   bis(5-nucleosyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81816"
FT                   /db_xref="GOA:A8AA64"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA64"
FT                   /protein_id="ABU81816.1"
FT                   /translation="MKAPEVIWALVIEMLEEVPVHDPEELKNFVSALTCEEIKELLEEA
FT                   ERYFGREVEIMDSVGGVLFHGDIHGDVDTLYKIWEQVGIEKVLDKFKLVFLGDYVDRGE
FT                   YQLEALTLVLALKAMRPEEVVVLRGNHEPPEWLPPSPHDFPDVLVSKCGPSKGSEIYKV
FT                   ALQLFDSMPALALIDDVVALHGGPPVSKVMEGCEGEDCLKELDRKSLEEVLWSDPDELM
FT                   GGKLCSWEDPPKLCVGSNPRGAGVVWGAGLTREFLERLGSKYIVRGHTAVDGFALSHNN
FT                   RVYTLFTRSGPPYYNANAAALLLKRNSFNVIVVPALPIL"
FT   gene            571309..572499
FT                   /locus_tag="Igni_0635"
FT   CDS_pept        571309..572499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0635"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; ExsB family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81817"
FT                   /db_xref="GOA:A8AA65"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AA65"
FT                   /protein_id="ABU81817.1"
FT                   /translation="MSKIVLAYSGGLDTSVAVAWLKEKFGAEVITVTVDVGQKEDFKEI
FT                   EERAYKAGASKHYLIDAKEEFVNKYIKPAIIANALYEEVYPLGTALARPLIGEKVIEVA
FT                   RKEGADAVAHGATSKGNDQVRFEAAFKALAPEIKIIAPIRMWGMNRKEEYEFAKKKGIP
FT                   ISAESKKYSIDENLWSRSIEGGELEDPWQEPPEEAFEWTVPPEKAPEEPAYLTITFEKG
FT                   VPVALNGKRMELIEIIDTLNKLAGQHGYGRVDHMENRVVGLKSREVYEAPAALTIINSK
FT                   KDLEKLVLNKREYRIKRMLDSYWADLVYDGLWFDPIRVALDNMLSELSENVNGDVKVKL
FT                   YKGSLRVVGRRSPNAIYDKAISSYESEWFPSDEMARGFIDAWLMDSVVSFRKRYLK"
FT   gene            complement(572471..573244)
FT                   /locus_tag="Igni_0636"
FT   CDS_pept        complement(572471..573244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81818"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA66"
FT                   /protein_id="ABU81818.1"
FT                   /translation="MITSVDVVLQITELKKIRVWKGVFAAKVVFDAFKSVDVDPDFPFH
FT                   VVPPEKLSTEVKPGTEVSFKVNFWGEVASAPAKLAEGLLNVEYVLPIKVDVKTVEVESP
FT                   PKGGDEPVAVFFRVTHGPTLYRFHGAWVPLPSAPRAVYSLFKRMSEVTGTDLKGYADSI
FT                   SSKVEVVGGRPRFSTFKIHKGDELPAFFGRVSYYGIMEEDLALKLLWALKYSHYFGLGS
FT                   NVSLGFGDVKEVKVEKPPFEVPVKKYLTSSTSSES"
FT   gene            573345..574457
FT                   /locus_tag="Igni_0637"
FT   CDS_pept        573345..574457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0637"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /note="PFAM: GMP synthase domain protein; PP-loop domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81819"
FT                   /db_xref="GOA:A8AA67"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA67"
FT                   /protein_id="ABU81819.1"
FT                   /translation="MFNANDFIKKKIEEIRELVGKEKVLAAVSGGVDSTTAAALAYKAL
FT                   GPEQIKVIFIDTGFMRKGEPEWVKNVLRDVMPVEIVDAKERFFNAVKGLSDAEEKRKAF
FT                   REVFYQVVSEEAKKWGASWLVQGTTAPDWIETTGGIKTQHNVLEQLGINVREKWGFKLL
FT                   EPLVELYKDEVRAVARALGLPEEIASRQPFPGPGLLVRIPGLVTEEKLELLKEVTEVVE
FT                   KELERFKPSQYFAAIWEDRLGPKVSESPEAYLFEGVRATGVKGDIRAYGPVALLKAFDW
FT                   ERVYDYWKEIIHKNNEVTHVVAEVGEREEGEYTISIRAVLTDNFMTADVLKLDRGTLEE
FT                   IAKKVMKVSPKIKRVVYDVTPKPPATIEYE"
FT   gene            574621..575463
FT                   /locus_tag="Igni_0638"
FT   CDS_pept        574621..575463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81820"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA68"
FT                   /protein_id="ABU81820.1"
FT                   /translation="MTEITLINCANAKTVHVRKGRIEEGEGGELFDCKGMPVKTLRCTV
FT                   ALKPFKRWEELLEDPVPEPEWVDSLLVKGVGAAIAPKGTRAALVEVVERPFVLDPLAPP
FT                   EEVPERGAVVARSLDADSSYGYKLKYGKWPVEDLGDKASNNIILNPFWVTTWEIKKIKI
FT                   ASFMPEMVALGTSSPIPPELRKAVLSPLTGRWGPDALEAVATLLMRSHYWSGELRAQHD
FT                   DASCWSFLGKEGPRLAKGSKAMLWVGHEEAELVVTGDQVLFREELLELKSVSAPSPLL"
FT   gene            complement(575449..576690)
FT                   /locus_tag="Igni_0639"
FT   CDS_pept        complement(575449..576690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81821"
FT                   /db_xref="GOA:A8AA69"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA69"
FT                   /protein_id="ABU81821.1"
FT                   /translation="MRKLAALLVLTAALVSAAKVDVRIVTSSPYPEGSEAYVALLSFVR
FT                   AWPEALNYLPNPSDWSVGTGLTSPPNPRAFSGILLVFDNDASTGNITRDKELANAYVNN
FT                   VILPAIKDRIRVALVVGPKSTLGQLVLYKLGLIIPTVPKNVSGRLVAAPSCAEGVRPLR
FT                   PASAHPIYSNVSALPSSCCMVPLVPDLIAPESVASGNRYCIVIRTSKVSDEMIILSWNG
FT                   IFRDIASNPNVQKLMFNVIKYLAKEEPAKYPYEPLTVTVTTTTTLTEFKTVTNNVTIIV
FT                   TSPITYTTTSTVTTTTTVTLKKTVVSNVTVVETATTTIYGTLTSFLTLTTTVLRNVTTT
FT                   YTTTTTVTSEIVSTITTTVSKTLTTTVTSVKKVIDTATLGGALVLGIIVGVVVMAVTLR
FT                   RGERRKGGGALEEW"
FT   sig_peptide     complement(576634..576690)
FT                   /locus_tag="Igni_0639"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.608 at
FT                   residue 19"
FT   gene            576872..577870
FT                   /locus_tag="Igni_0640"
FT   CDS_pept        576872..577870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0640"
FT                   /product="protein of unknown function DUF1152"
FT                   /note="PFAM: protein of unknown function DUF1152"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81822"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA70"
FT                   /protein_id="ABU81822.1"
FT                   /translation="MECPLRGKKVLVVGIGGGGDVAAAYCVSKWVESVGGKAILGSVVW
FT                   ERLVRDPLPGPLPLRELNNAEAVGDHLWVADGDEYAIRGGVRVVPQASILARVTGKRVY
FT                   LFDLNGGAEGIKRGLKEAIELAGADLLIAVDAGGDVLARPEDEEVWSPLADSICLAAVK
FT                   EIEIESWVAVFGPGCDGELPPQKVLERVSEAWRRGGNKGGFVLSKDDAEDCLKVVNEMH
FT                   TEASKMGILAALGEFGEKKIRRGSRTLFLSPLTATTFFLDSNSIDSVMAEAVRGSVDIE
FT                   EANQALRALGVYTELDLERDVVAKGGLDKVDLEKVREEGRKRLKTSPARGL"
FT   gene            complement(577842..578762)
FT                   /locus_tag="Igni_0641"
FT   CDS_pept        complement(577842..578762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0641"
FT                   /product="quinolinate synthetase A"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81823"
FT                   /db_xref="GOA:A8AA71"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA71"
FT                   /protein_id="ABU81823.1"
FT                   /translation="MIDELMRKVEELKRRRRAFIIAHNYQLPEVQEVADFVGDSLEMAM
FT                   KAEEVDADVIVVAGVRFMAEVAKLLNPDRVVLHPEPRAGCPLADHMTPEIIKRFRENYP
FT                   HAPLVTYVNSSVEAKALSDYVVTSASAVKVVSKLEDEVVLFGPDKNLAKFVAHRTNKDI
FT                   IAVPPWGHCPVHEFLVSPYYLRKAKERHPHCKLLVHPEAPWESQKMADFVGSTSQMLRA
FT                   IGELGAKCYILGTEEGLSYRAKKMYPHVEVYPPDARTICIDMKKITLDKIVRALETLKP
FT                   QVVLDEEVAKRAREAVVRGLELARS"
FT   gene            578837..579400
FT                   /locus_tag="Igni_0642"
FT   CDS_pept        578837..579400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81824"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA72"
FT                   /protein_id="ABU81824.1"
FT                   /translation="MSNDRLKAFVEKVGSFKDVSYVAVSSEGLPYMIKGTERENAEYVA
FT                   AVASSLYDRINELTMALNLGKEERSKIYYPEDYHMLLFKKDNFVVAIKYDFAIDKLIEA
FT                   LTNNLLKGIEVRCPYCKNDLSFDVVKCPKCGERLPFTEPKCWNCGADLTLKECPHCGNL
FT                   IYYNGQKPSFIKLLIYKLKRIFGG"
FT   gene            complement(579397..580368)
FT                   /locus_tag="Igni_0643"
FT   CDS_pept        complement(579397..580368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81825"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA73"
FT                   /protein_id="ABU81825.1"
FT                   /translation="MDLATTSRIFIDVASRLALLHHAKRVERVTLTVSELERLSAEKSK
FT                   EGLCLMFKPHTVGGYILACDGKVVAIAIREPPRVGNKALEAVDDNPLPGDLYVVSKEAF
FT                   VDALNKMFAGKRVVEKAAQVLSALNEIAQKVLEARLEKETSVEELAQGFDVKELEIFDL
FT                   IDTVTLTDEIAYYLDKMGYTVETSTPEELGGHYVVVIKVHDDVPLEKLIKDLMEVAEKC
FT                   DAKSLIKLIDSKGNEYYFDPTFFKSITKLLSRLPIELRYMYIKAVSPEEAEFNLVFSSD
FT                   VTTISMGKFIGLLEKLIKKRRLPWKKVKVVIYTPTNIYRSPD"
FT   gene            complement(580375..580782)
FT                   /locus_tag="Igni_0644"
FT   CDS_pept        complement(580375..580782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81826"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA74"
FT                   /protein_id="ABU81826.1"
FT                   /translation="MSVIICTSLSECLERLDKELNDAEREAELVAGLLESLDEKEATFE
FT                   EFVKRFGGGGGEAIYHTKVNSFEIYVQPHPSKMKEELSKKAKEISDLIEKLRALRELIE
FT                   KIIETLSGLEAEAVILLDKDVAKLFINIRWG"
FT   gene            580881..582524
FT                   /locus_tag="Igni_0645"
FT   CDS_pept        580881..582524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0645"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81827"
FT                   /db_xref="GOA:A8AA75"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA75"
FT                   /protein_id="ABU81827.1"
FT                   /translation="MVTKFFENKAPKEVEVLDTTLRDGAQARGINFDLQAKIRIALELD
FT                   RVGVHFIEAGWPGSNPKDELFFREIKKYELTNSEIVAFTSTRRKGFKASSDPLLQKALD
FT                   ADTKWITVFGKSWDLHVRDVLKTTLEENLDMIYDTIRFFKENGRMVIFDAEHFFDGFKE
FT                   NKEYALQVLKTAEEAGADRIVLADTNGGSLPHEVYAIVREVGEHVKKPLGVHMHNDSGC
FT                   AVANTLMGVLAGAQHVHVTVNGIGERTGNADLCVVVPDLELKMGVKALKNPEGLKMLRH
FT                   LSKMVYDLAGLTPNPYQPYVGDNAFAHKAGVHVDAVLKNPRAYEHVPPESVGNERKLAI
FT                   SELSGAANLIGWAKRELGIVISKNDVALRRALKRIKELENKGYSFDNAFASALLILLEE
FT                   MGLRGRPFKLEEWKVVSEGAEEGSRSWGVVKLSNAEVHMEAAEGVGPVETIDKALRKAL
FT                   DKLAPEASHVKLIDYRVHLPKASKHTESDVRVEITFTDGKEFWTTTAVSRNIIEASVRA
FT                   ILDGIEYYLIKKKLMLLKGSNEEAPTLLRG"
FT   gene            582620..583537
FT                   /locus_tag="Igni_0646"
FT   CDS_pept        582620..583537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81828"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA76"
FT                   /protein_id="ABU81828.1"
FT                   /translation="MLPLFKKKEWLEEPWDDYKIIGFGSTKGGAGRTTMTIEIASLIAF
FT                   IKEARVAVIDWDVINPRLTQRAFKSLPLRGQTLVKIITSKDFKKALKNISLHSVSLSPT
FT                   SKIDVLPALSYEDIDKGIVDEYFNLMYEKPEEYIKRCKELVATLKTEYEYIMNDYPAIT
FT                   WVALGPLSLSINHVRATAGNLVMVVDPSPWSAELLNSNLIHPKLKGLRVGALVVNMVRP
FT                   AMDAVNWAKSVFSPVCERIEADNFVVLPFDVPLYEAGIGELKSLVSVSVSPLKHKSRSA
FT                   RYLYTLADRFIHDYRDKKCFYIGP"
FT   gene            complement(583534..584682)
FT                   /locus_tag="Igni_0647"
FT   CDS_pept        complement(583534..584682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0647"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81829"
FT                   /db_xref="GOA:A8AA77"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA77"
FT                   /protein_id="ABU81829.1"
FT                   /translation="MNDLPMVVKYRPVPIKKLLRKMKDEVSIALDMAFYSLVYEDKDVA
FT                   QEVEKIDVDVDNDFNLLALQLMVAARDPEDAEKLLPALRLGMSMDLATEAASDMATTVL
FT                   KGYKVPKVVKAALEITEEIYVKLVVGEKLVGIKVKELKERYGLIDVIVLRRGGVMIVNP
FT                   PEEVELELGDVIVIRGDREDVKKLMKDIDMELVVPEEKFTEKEKEVAFRIALLKNMTEI
FT                   AFDLAVYSMLYQDPRAAEEVLEIESFMDEESAKLEMEIIKNTAESQEIYTSTVLVRSLE
FT                   KMTDAATSMAQMALVENEVHPILKEVAEEGEERILVLQVVKECNMTVGQLEEMADGTAL
FT                   AIYLDGIWIPLPNASTELKKGMKVLLKVFNEEPEFPECIQVL"
FT   gene            complement(584721..585548)
FT                   /locus_tag="Igni_0648"
FT   CDS_pept        complement(584721..585548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0648"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81830"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA78"
FT                   /protein_id="ABU81830.1"
FT                   /translation="MIDPNAPVKYFAKMGWIKVVKAEEPLRNAAKVMVENGIRHLPVVE
FT                   GENLVGFMSIKDVMEVIGSYNAKDLLKKEVYNFMSKKVIAAAAEDPLWEVLKAMAEADV
FT                   GAVPLLDNEGKVIGIFTERDVVLNVAPELEWEGEAMKYATKNPKVVERGTPLADALDIM
FT                   NELKVRHLPVVEDAKNKGPALGILTALNVVDYALRHENKLPEALEEVSADEVMSTLSYV
FT                   VENAEMREAVQALGMSPTDALLLLGDDKVVKGIITDRDVMMATARYVERLAMP"
FT   gene            585589..586329
FT                   /locus_tag="Igni_0649"
FT   CDS_pept        585589..586329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0649"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81831"
FT                   /db_xref="GOA:A8AA79"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA79"
FT                   /protein_id="ABU81831.1"
FT                   /translation="MGSALRWIIDLDGVVWKGKEIIWENVDAIKKLEGKKVFLTNKATS
FT                   RWEVSRRLKEIGLEGEVVTSAYIASQFLKKRGVESAFAVGPSGLAEELVMAGIHLTEDE
FT                   DLAQAVVAGLDAFLTYDKVARAASMIRKGALFVATNTDKTYPTERGLMPGAGSVVEAIR
FT                   VASGKEPVVVGKPSRHAFEVASGGERDVIVIGDKMETDMKMALENGARGILVLTGVTRE
FT                   PPKEVPQGVTVVKTLKEVLGDETG"
FT   gene            complement(586380..586670)
FT                   /locus_tag="Igni_0650"
FT   CDS_pept        complement(586380..586670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81832"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA80"
FT                   /protein_id="ABU81832.1"
FT                   /translation="MKKNLAFKLGLCPIVLAMEHVDHEAKRRYAKLYDPINDTLIDLEL
FT                   PYSIYLLSDVKGQHECWEDALKELGVEWSCPHAQECPIKRRQAYQRQEQSG"
FT   gene            complement(586673..590071)
FT                   /locus_tag="Igni_0651"
FT   CDS_pept        complement(586673..590071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0651"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /note="PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase
FT                   Rpb2, domain 7; RNA polymerase Rpb2, domain 2; RNA
FT                   polymerase beta subunit; RNA polymerase Rpb2, domain 3; RNA
FT                   polymerase Rpb2, domain 4; RNA polymerase Rpb2, domain 5"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81833"
FT                   /db_xref="GOA:A8AA81"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA81"
FT                   /protein_id="ABU81833.1"
FT                   /translation="MSSAKAFPTPEDRWAIMRAYFKEKGLVSQQLESYNKFVTETMQKL
FT                   IEELGEVEPFESGYKLEFIKIRYGEPIIKEKSGGTRPVTPTECRIRDLTYAAPIYVYMR
FT                   LRNPKGEIKDEGWVEIGMMPVMVRSILDPLSKKSPEELVEAGEDPRDPGGYFIVDGSEK
FT                   VIVTQEDLALNKVLVDKGGPQSTVTHTAKVLSTTLGYRVQVIVERQKDGTLHAIFPPLP
FT                   GKIPLVVLIRALGIESDKDITSLVSFDPEVQQELLPSIEQAASVPTVDDALDFIGARIA
FT                   IGMPRDKRIERAKQVLDNNLLPHLGKRPEDRIKKAIFLAHMARKLLEVYLEKREPDDKD
FT                   HYANRRLKLAGDMLAALFRTHLRGLLNDVGYQLERSVLKGEERLKLRILIRSNYLTDKV
FT                   RQALATGNWVGNRTGVSQLLDRTNWLSTLSHLRRVVSPLARNQPHYEARELHMTQWGRI
FT                   CPFETPEGPNIGLVKNLALSAHISVGVPEEEVEKVLDELGVIRVEEVLEKVKNDEPVPE
FT                   EAISGARVFLNGRPVGYYKDAHELAQKIRQLRRQGKLHYEVSVGVYENDDGTIKEVYIN
FT                   TDPGRVMRPVFVVENGELKLKPEHVEKVKKGEWTFKDLLMRGIVELLDADEEENALIAI
FT                   EPEDITPKHTHMEIWVPAVFGVVASTIPYLEHNQSPRNSYQSAMAKQALGLYAANFMLR
FT                   TDTRGYLLHYPEKPLAQTKHLEIIGYNKRPAGQNAVAAILSYTGYNIEDAIIMNQSSID
FT                   RGFMRATFMRLYQTEEQKYPGGAEDKIEKPKPDQRLVGMREPKAYEKLDEDGIVEPETY
FT                   VVGGDVLIGKSSPPRFTEEYKEMGILETRRRDASVAVRHGEEGVVDTVILTENIDGIKM
FT                   VKVRVRSLRIPEIGDKFASRHGQKGVIGMVLPHYDMPYSEFGLVPDIILNPHAFPSRMT
FT                   LGQLIESIAAKAAAFRGREVDATPFYKEPLDNLRKILVERGFPPDGTEVMFDGRTGEMI
FT                   ARPVFIGVVFYQRLYHMVSDKIHARARGPVQILTRQPTEGRTRKGGLRFGEMERDVLVA
FT                   HGASQLLVERLLKSSDATKVWVCAKCGHIGWWDANKGKPVCPIHGERGEMYQVELSYAF
FT                   KLLIQEILSMGIAARLRLGDKFSRV"
FT   gene            complement(590077..590298)
FT                   /locus_tag="Igni_0652"
FT   CDS_pept        complement(590077..590298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0652"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /note="PFAM: RNA polymerase subunit, RPB5"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81834"
FT                   /db_xref="GOA:A8AA82"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA82"
FT                   /protein_id="ABU81834.1"
FT                   /translation="MDHVLVPQHVKLSPEEAVEELRKWGLRVEQLPLLKASDPVARELD
FT                   LKPGDIVKIIRKSENAEEVVVFRYVVAG"
FT   gene            590362..591345
FT                   /locus_tag="Igni_0653"
FT   CDS_pept        590362..591345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81835"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA83"
FT                   /protein_id="ABU81835.1"
FT                   /translation="MEYEVRASCHAAEKWRRATLSAALGAASALLLSPWLEAVLLPSAA
FT                   LFAASFQILACNREKKITVRREVQVKEKRALVTVSAPPGTYIKDYPSAPPVSGSPEGFE
FT                   RVTYVIDLDLNPFVFWPGTYLKVKEGQCECTAFLSLNEVVSSWSLEGLGLGEPVEVEGG
FT                   DFAVPEVEGVREYAPGDDPRLVVWKTLYSPGGLRVKELKKVREVVGLKKGVATFTLDIG
FT                   PWEDNPCMKAFAENLAKYLEGVGMKRVSGRADVAVLAPGGKGEAELYLLLNPLACLPSV
FT                   EGFDALELVREEVLREYLATEKALKERGEVRGVPWSVPPRRTDWLR"
FT   gene            591366..591911
FT                   /locus_tag="Igni_0654"
FT   CDS_pept        591366..591911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81836"
FT                   /db_xref="GOA:A8AA84"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA84"
FT                   /protein_id="ABU81836.1"
FT                   /translation="MAGSIAIIISLLMAYCGKRFGAWFALPSTLLAFLGAHLDVPPLAL
FT                   GSFLAALYLDPAISFAPLPFALIAAARAPPVSPLLGGYPSSVVAKVPTELSLAFGYLPL
FT                   LQLGGVAPALGFLVGLATAPLLDFVSKLCPNGPMIKLSEPIFVGIGAGLMINVVRLRLR
FT                   LIQGIKFKLAALRRGRAY"
FT   sig_peptide     591366..591431
FT                   /locus_tag="Igni_0654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.695) with cleavage site probability 0.672 at
FT                   residue 22"
FT   gene            complement(591874..592269)
FT                   /locus_tag="Igni_0655"
FT   CDS_pept        complement(591874..592269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0655"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81837"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA85"
FT                   /protein_id="ABU81837.1"
FT                   /translation="MSSIEKYFGRERMIITIDEEATIGEAVELMHENGIGALLVTREEE
FT                   GGVAAAGLLTERDVIAALALGADPNRAKVKYYMTPWKDVITVTPETPIKEALRIMIENG
FT                   IRHLVVVSGEKVLGIISMRDLCAALLV"
FT   gene            592435..592536
FT                   /locus_tag="Igni_0656"
FT   CDS_pept        592435..592536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81838"
FT                   /db_xref="GOA:A8AA86"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA86"
FT                   /protein_id="ABU81838.1"
FT                   /translation="MFVAAMIGVAVAAVVGVGVGLYLCKRSLKVVKE"
FT   gene            592533..593255
FT                   /locus_tag="Igni_0657"
FT   CDS_pept        592533..593255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0657"
FT                   /product="Diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81839"
FT                   /db_xref="GOA:A8AA87"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA87"
FT                   /protein_id="ABU81839.1"
FT                   /translation="MKFVLAGAGLRCEHLNERVKRAILEAEEVWVDTYTSPFPGGLLNC
FT                   VKGVREDALEADRSVLEGPFRFSKSVTLVVPGDPMAATAHSALLLEARRRGYSVQIISN
FT                   VSALQAARSKSGLSQYRFGKVVTLMYPKEGISFTESVYNVIKDNDSMNLHTIVLLETGY
FT                   GRDMTVPEAARLLCEYEELCDRRAIAMARLCWDDETIKVAKLRELAESDLGGPPHLLVF
FT                   PSPKLHPIEEEFIEAVLK"
FT   gene            593323..593499
FT                   /locus_tag="Igni_0658"
FT   CDS_pept        593323..593499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0658"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81840"
FT                   /db_xref="GOA:A8AA88"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA88"
FT                   /protein_id="ABU81840.1"
FT                   /translation="MRLVTVKMPEAYVEAIDELVRKGRFTSRSEAIRVAIRELLRRELW
FT                   VRELEEEEEELID"
FT   gene            complement(593489..594226)
FT                   /locus_tag="Igni_0659"
FT   CDS_pept        complement(593489..594226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0659"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   Acetohydroxy acid isomeroreductase, catalytic domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81841"
FT                   /db_xref="GOA:A8AA89"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA89"
FT                   /protein_id="ABU81841.1"
FT                   /translation="MKVCLIGYGKLGSSIAKGLRNAGVEVTVSTLPPTDEWAREDGFSV
FT                   VPMRACAEGVDLIIVAVPPSAVPAVMKELRGVEVPITSTAALVKLGELKKYADKVYRVM
FT                   PSVTVEVNSSPVLVAERGGGADSVVEAVWGKLGKVYWVNERVLDAALPVVGSGPAVHAE
FT                   YFRSAVEALVASGVERSLAEELARESIIGTIKMLEKYDPYKLRSKVETPGGITVEMLLK
FT                   LEEEGVFGKIAKVLGEKGRELSR"
FT   gene            complement(594261..594428)
FT                   /locus_tag="Igni_0660"
FT   CDS_pept        complement(594261..594428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81842"
FT                   /db_xref="GOA:A8AA90"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA90"
FT                   /protein_id="ABU81842.1"
FT                   /translation="MRYFITTFSSVMGIGLMLSVIYQNPLILGTYLFAAVVAGSLAELL
FT                   GKLFEKAAGP"
FT   gene            complement(594439..594939)
FT                   /locus_tag="Igni_0661"
FT   CDS_pept        complement(594439..594939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0661"
FT                   /product="nucleic acid-binding protein consists of a PIN
FT                   domain and a Zn-ribbon module-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81843"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA91"
FT                   /protein_id="ABU81843.1"
FT                   /translation="MRPEGGVTKFVHDTGSLLAGMPSLMPGENYTTPLNLKEVKDKDSK
FT                   DALKRYEAKLKVMEPDKAYVIKVKKRCEELGERLSETDVAVVALALQLHATLLSDDYGV
FT                   LNVAKSFGLEARSVRTKGIGGVIKWVNYCPFCRKEYPPWVKVCPDCGSVLRRRPSKLAS
FT                   REG"
FT   gene            594989..595543
FT                   /locus_tag="Igni_0662"
FT   CDS_pept        594989..595543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81844"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA92"
FT                   /protein_id="ABU81844.1"
FT                   /translation="MKPYEAEARFFVHEGFKETLERMGFKVVYEYKFVDHFYCPPGGWR
FT                   EEGKTLRARDWGGRCEVLFTRVEKLKFGDLEFKRSLYPQGKVKLYEGSLEECVKLLEDM
FT                   EFVKCGEVRKEEGYIMSNGDVEVALEKINGKWVLEVEVEGADPNSAYLKMKEIMKLLGL
FT                   KSPTSKSTFELFSNTNTTGPS"
FT   gene            complement(595512..595937)
FT                   /locus_tag="Igni_0663"
FT   CDS_pept        complement(595512..595937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81845"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA93"
FT                   /protein_id="ABU81845.1"
FT                   /translation="MTYEEELRRVYSRKDLLSSYLLKLRVRKGDVERVLKKPAACYYLY
FT                   KGSLVDPYDTQIPLHRLSGLERAEGLCEAFDLGWAWAVVCDCGGGRAVRGPRGYDPVFA
FT                   LSGPPYPLVSKGEVIACLPEGRCSGGLVKRGLWYWYY"
FT   gene            complement(595927..596946)
FT                   /locus_tag="Igni_0664"
FT   CDS_pept        complement(595927..596946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0664"
FT                   /product="N2-acetyl-L-lysine deacetylase"
FT                   /note="TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine
FT                   deacetylase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81846"
FT                   /db_xref="GOA:A8AA94"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA94"
FT                   /protein_id="ABU81846.1"
FT                   /translation="MIAFEVLKRIVSVYSPSGEEDEAAETLAEALEELSGGTLEVWRDG
FT                   AGNVLAAPKRKSEYSLALISHIDTVPGFWEPKITENSISGRGAVDAKGPLSAMSEALIK
FT                   LAEEGKDVLLGAMVGEEDDSRGAKYLRDHGPKLKYVIIGEPSNTRDVVVGYRGYAWLEV
FT                   KCRAKGGHASSPEVGENAVEKLWGIYQKAKERLSPATVSLTSIKSWNAFNVLPTEVIAR
FT                   FDVRFPASVKLEDILDSFSECEVTLKDWLGPVEVKPTSPVPRALRRALLQHGVKGKFVR
FT                   KRGTSDMNVLGGSVESIAAYGPGASELSHTEKEVITKEELETAVKTYVAAGRELADDL"
FT   gene            complement(596991..597722)
FT                   /locus_tag="Igni_0665"
FT   CDS_pept        complement(596991..597722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0665"
FT                   /product="putative CRISPR-associated protein, APE2256
FT                   family"
FT                   /note="TIGRFAM: putative CRISPR-associated protein, APE2256
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81847"
FT                   /db_xref="InterPro:IPR013442"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA95"
FT                   /protein_id="ABU81847.1"
FT                   /translation="MECSAHVLSVGTSALRNFQRTCTDKNLASALLKLERGELELSDMK
FT                   KVLSASGLTLDDLIDKVAQFIKNDPVQASAELNALVKRAGSLQGLKAILLCSDTHAGQL
FT                   SCKALKTYLEGEGAEAAAYVINNLGKRGTFYEGLVNLMCAYGKILDKEVGDCKSCVCVN
FT                   PTGGFKPESAVTYLLALADARTADVYYIHEAFRDVVSLPIFPVVPLKALLSQTKWLDES
FT                   LKALKDCLKGKSLYPWRPLEI"
FT   gene            597914..598264
FT                   /locus_tag="Igni_0666"
FT   CDS_pept        597914..598264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81848"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA96"
FT                   /protein_id="ABU81848.1"
FT                   /translation="MGLEELVMSIYDRMESKLKDIEAKNLQKVDDPEKLRAAIAKALEE
FT                   VKKGREEMMELLESGSADLATIEQKINETLERAKQYLGKDYTGLRTAKATFSRCVNMYK
FT                   KKVWPEIEKAVA"
FT   gene            598515..599309
FT                   /locus_tag="Igni_0667"
FT   CDS_pept        598515..599309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81849"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA97"
FT                   /protein_id="ABU81849.1"
FT                   /translation="MIVVAVDESGDTNVALERKGRRTRYFVTLAVVLDEKCYSIVTKEL
FT                   TERLREAVAEEEPACSNLIPEMLKNEEELKYYSITKRVAECVARERSELKVVNEKIDNM
FT                   LAKFINKVRPCGTFLAVAAHVDKATIARKLKSFDYEIASSLASVIRKSLKPLVLKEFGA
FT                   QVCRALDGLGENAIVILDEKFVPSGSAPKGEYLKKHFPCERVIEAFEVKSHQSSALALA
FT                   DIMAAAYRNCLLHGNEALCEALSFVEGRDLTEHFLRRALGLG"
FT   gene            complement(599991..600719)
FT                   /locus_tag="Igni_0668"
FT   CDS_pept        complement(599991..600719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81850"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA98"
FT                   /protein_id="ABU81850.1"
FT                   /translation="MVNTTVGRVASLALPTQLPTPAGVYDLMPAYDSTNGKVLALVLRV
FT                   KNPVTLTGVRVYYGEELVCSFDHFVLSSSSPVADQYGCEALVPAGYYGQLEGQADDYDA
FT                   LCPGALYFKVGCDKPVKAISVLEVDNGWYSPEGAPPWATVGTFVPSFIPLGSVKCETRL
FT                   SNSTGTLEFQERLGAPERVLYNGTDWLYAVPFKSVRLYKGTYTLLLWCPSLNVPLEDLK
FT                   IVVSTDVTELTVRPPRGGLI"
FT   gene            complement(600712..602358)
FT                   /locus_tag="Igni_0669"
FT   CDS_pept        complement(600712..602358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81851"
FT                   /db_xref="GOA:A8AA99"
FT                   /db_xref="UniProtKB/TrEMBL:A8AA99"
FT                   /protein_id="ABU81851.1"
FT                   /translation="MLYISIIISAVMNIVAFAVPRLAALSLSSVLPAAFVLYEAFSCKP
FT                   TSLASWYWLNCGLPSFHNVITAMTTPFFTISAFAFVLALVGLKEGDRRFFALSAASLLS
FT                   LLFVWSNYLNLNYPMVSAPPKLPPLGFSVLRGYWFFSLYPLLAIASALLLAYFLTFNEL
FT                   YAKLSTFLAFLTAFSSIAHGHTTYGLPIPPNSFHLSLALLPASLALLFHTNDKASKVVA
FT                   FLNAYVAFALLRFYPVPAGGLPNPYFGIQTPVAATLTLVYLYSLSKAIKEGPLADKRFV
FT                   LHYASVIILTAVTVLDLIDNYTLANVLTSKALLWALLASQALSALNFSLVLYLKDKSKL
FT                   GLLGPASLLRPESTAVAPFALALADFWKNRKAVSSLMVLTSMTFAASLIYASWVHAYFF
FT                   QPPSEVKVMGAKTVATYTYRGNLTAFEQLLLLNASGSRYEVKSSINVFMGKYIPPNEPA
FT                   FFSWSVPRWEGLRSCAVSLRPSPLPALKCAPLAGFAYLYPALGALTLLATYIASKFVKP
FT                   GGRSEGTELNSGRAVTHSDIGGSDSGSGGSG"
FT   sig_peptide     complement(602287..602358)
FT                   /locus_tag="Igni_0669"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.849 at
FT                   residue 24"
FT   gene            complement(602454..603386)
FT                   /locus_tag="Igni_0670"
FT   CDS_pept        complement(602454..603386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81852"
FT                   /db_xref="GOA:A8AAA0"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="PDB:3J1R"
FT                   /db_xref="PDB:5KYH"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA0"
FT                   /protein_id="ABU81852.1"
FT                   /translation="MKIARKGVSPVIATLLLILIAVAAAVLLYTWVSGLSANVAGTQVT
FT                   GKSLTLIQATWARPATNVGTTISKDSFDRSKAVLILSFQPPAQVLQGGQAITIDAIDVL
FT                   YQGRVVCHYDSFPMTADDKYHIGQTIGGLTAFGLVFWGFVGSTLSDFDAHNETLVPGGI
FT                   IHGKSDLATQPAARGYLGGDKGVTGEVHPGEKYKPDILLSFDDQYPFATILAGTWEVNY
FT                   VSTNYVETNFRNTSAVIKFDRFVNTHYSPDTQNNNGVPIFDVASASQSNFAVVIWCPNV
FT                   NPNVMQSVDVKMVFSDGSTWEASVPLSIT"
FT   sig_peptide     complement(603315..603386)
FT                   /locus_tag="Igni_0670"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.359 at
FT                   residue 24"
FT   gene            complement(603471..604823)
FT                   /locus_tag="Igni_0671"
FT   CDS_pept        complement(603471..604823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0671"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81853"
FT                   /db_xref="GOA:A8AAA1"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA1"
FT                   /protein_id="ABU81853.1"
FT                   /translation="MGPVPHVEVVVVGGGAAGMSAASRVKRIHKDWTVRVFEASGYVSY
FT                   APCGLPYFIVGKVKEPDDLVYYPVEVFREKRGIDVHTHAKVVDADYHKRTVTVIENGEK
FT                   KEYKWDKLILATGARPKSLGVEGEDLRGVIKLHTVESGIAAREELKDAKEVVVVGAGFT
FT                   GVEVAAELRDSEREVHLVVRSRALRKSLDPEMSELVEEHLKNVGIRLHKGVTVTKILGK
FT                   DRVEGVELSDGEVIKAQAVVVAVGVEPNAELAKRLGVKLGKFGGIKVNEYMETNLPDVY
FT                   AAGDVAESWLVHTGTEAWCPFAPPANKMGLVAGLSASGKRVPFPGVACTGITVASGLEI
FT                   GRTGLTEEEAKALGFKVKSSFVKARTRAHYYPGSQFTHVKLVAAEDGTVLGVQVVGPEG
FT                   VKGRVDAVATLLTKRGTVRDLFFSDIGYVPPLAPVWDPLVTAARLLYSELR"
FT   gene            complement(604863..605318)
FT                   /locus_tag="Igni_0672"
FT   CDS_pept        complement(604863..605318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0672"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="PFAM: protein of unknown function DUF1641"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81854"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA2"
FT                   /protein_id="ABU81854.1"
FT                   /translation="MSEELSKVLEKLEAEKIEELAKAIERLADAIAKLQETGLLGIAVA
FT                   LAEKGEEVLELGANDRRMHHAMAAADAALNALEDVDPIVFKENVEAMSECTMKALNSPD
FT                   FLKHAKPVGLLGLLKVMKDPDITAGLGVMLYLAKVMGSCLRQKMEQS"
FT   gene            complement(605325..606482)
FT                   /locus_tag="Igni_0673"
FT   CDS_pept        complement(605325..606482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0673"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81855"
FT                   /db_xref="GOA:A8AAA3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA3"
FT                   /protein_id="ABU81855.1"
FT                   /translation="MPERVVFLGGGVSTLVALRRLREGPPELQDKLQITIINRDEWHYM
FT                   PPLFADFALGEVREDQLKAPVANIAKRYGAELIIDEVVDVDPAKQQLKTKGGKTIEYDY
FT                   LFIGSGVSYDHEAVPGLSRYGYHNYSLEGAKRMREALSKFKGGRVVMLVPGLPFRCGCY
FT                   PFEMAGKLKYFAMRKDPRSEVHLVTVFDEKQMGQMFKDVFRQFRRIHNKLGIIYHPGKE
FT                   AKEVREKEIVFTDGSTLKYDLLIYVPPVKVPEFAKNRPELVCPNNKKVLATTYPEFRNP
FT                   KYRNVFVPTDAAMPCVNFPIAGIFSHAAAVSAADALISDLTGVRGTVLFPDEIVAVADF
FT                   GPTGMMVTFDIDHNGPTQKMYVTAQSPMIKFMKLAFYLGWIDALR"
FT   gene            complement(606551..608761)
FT                   /locus_tag="Igni_0674"
FT   CDS_pept        complement(606551..608761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0674"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC, N-terminal domain;
FT                   zinc finger, HypF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81856"
FT                   /db_xref="GOA:A8AAA4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA4"
FT                   /protein_id="ABU81856.1"
FT                   /translation="MPAKRIVVRGLVQGVGFRPQVARLARGLKLKGYVKNVAGGAAEIY
FT                   VIGEDEKISKFINLLKKLPPPIRVEDLQAEDAEEMSFDDFIILKSDKSSYKHSQIPPDL
FT                   GICEDCLREMLNPFSRRYMYPLISCAKCGPRFSMIRSLPYDRENTSMAEFPFCAECERE
FT                   YRDPWDPRYHVQGFACAKCGPKVRLLDSEGRTVLVRDPIKEAAKLLDEGFIIAVKGMGG
FT                   YHLAAKATEDEVVAELRRRKGRPRKPFALMALNSEVANRIVVVDDEELFNSPEAPIVLF
FT                   RKREDGPLSELVAPGHALVGVMRAYTGLHYLLLNYTADKFSIMTSANPSGKPTCITKEC
FT                   ALGMADYVLEHDREIVHRVDDSVVRRSAGERLFLRRSRGYAPAWLEADEELLSGASVGA
FT                   ELQNAGGISFSNKVVLTQYIGDTDEYDNLRFMEEELRWLLKQYSVTPEFVAADLHPRYS
FT                   SKLLALSLAEEFGAELVEVQHHHAHAASVMAEARLEEAAAIVVDGTGYGLDGNSWGGEV
FT                   LRVNREDFERVAHLEYFPLPGGDRAVKYPARALMGLLYAAGEDLEKWKGKLARALPGGE
FT                   GEFEVARKVLGRSVLTSSLGRTLDAFAALLGVAYERSYEGEPAMLLEAASLGGKPLTKL
FT                   DLIDGNVIKVTELLRWAVEALDSGKKLRDVAFTIQYNLGYNMALKAAELGLPVVVSGGA
FT                   AVNEPFLLGVKEVVKPLLPHKVPPGDGGIALGQLIIASRKLK"
FT   gene            complement(608834..609736)
FT                   /locus_tag="Igni_0675"
FT   CDS_pept        complement(608834..609736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0675"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81857"
FT                   /db_xref="GOA:A8AAA5"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA5"
FT                   /protein_id="ABU81857.1"
FT                   /translation="MKKVEEEVKAPQKEEEVEEQLEEEEELEEGEELEEEVEEPIPKEV
FT                   VQRRKYLKRYKDKDLFETVEEVFDMATQMAVYELIRRGVIGELKGVISAGKEARVYCGK
FT                   SPQGDDIAVKIYLTTTAEFRKSIRKYIIGDPRFEQIANRGLRHLIYAWARKEFRNLKRL
FT                   EQAGVRVPSPIAVYRNVLVMEFIGENCKRAPLLVELAKPVNQLDVEEWKKIFETVYDYM
FT                   VKMYQKARLVHADLNEYNIMYWKGEPVIIDVSQAVPINHPYAHDFLMHDIQQIRRFFSS
FT                   VGVEVPSAAEMYARITGLE"
FT   gene            complement(609778..610176)
FT                   /locus_tag="Igni_0676"
FT   CDS_pept        complement(609778..610176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0676"
FT                   /product="translation initiation factor 1A (aeIF-1A)"
FT                   /note="PFAM: S1, IF1 family protein; SMART: Eukaryotic
FT                   initiation factor 1A (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81858"
FT                   /db_xref="GOA:A8AAA6"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA6"
FT                   /protein_id="ABU81858.1"
FT                   /translation="MAKRKGTRSEKSKEVVLPGEGEVLCVVERIVGADHALIRCLDNPE
FT                   LVRDGRIPGKLRRRVWIREGDIVIATVWDFQPKKADIVYRYSRDELKRLIVKGLLPKEI
FT                   AELAGITEEEIALTAQQMAQEEAEGEEA"
FT   gene            complement(610238..610948)
FT                   /locus_tag="Igni_0677"
FT   CDS_pept        complement(610238..610948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0677"
FT                   /product="SSU ribosomal protein S6E"
FT                   /note="PFAM: ribosomal protein S6e"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81859"
FT                   /db_xref="GOA:A8AAA7"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="InterPro:IPR020924"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA7"
FT                   /protein_id="ABU81859.1"
FT                   /translation="MPNVARPVRFEVAKLEFKVVVNDPEAEPRPLGVKVKVVGKEDIPF
FT                   DKEAELDRRTRLPVARVNARLLEAAKAEYKIITIRRKVKEGDEVKKKTVHVVAAVDENV
FT                   PEGEVWINKDLAVNVFGEESFEGEVFRTKAFQITIEGENARKFIGKRIGETVPASILGI
FT                   ETLKGLQLEIRGGSDESGFPMRPDIPGPVKKRALLSGPPGFWPREKGERRRKTVRGNTI
FT                   SEDIVQINTKIVKQ"
FT   gene            610990..612468
FT                   /locus_tag="Igni_0678"
FT   CDS_pept        610990..612468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0678"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; hydro-lyase, Fe-S type,
FT                   tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S type
FT                   hydro-lyase tartrate/fumarate alpha region; Fe-S type
FT                   hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81860"
FT                   /db_xref="GOA:A8AAA8"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A8AAA8"
FT                   /protein_id="ABU81860.1"
FT                   /translation="MLRDEVVNAVVEAIRLAETALPKWVYEKLLDAYERSEGLGKAQLA
FT                   AILNNIELAVKEKKPMCQDTGLMTFDVIVGDEFPIKPYEIEELLKEAVRRATREVPIRP
FT                   NSVDPLSGHNPGDNVGKGVPVTNIKVVPGNTLLIKVRPKGGGSEYPSNLCMIPPSKGLE
FT                   GVRECVLKAVFEAGGKPCPPGIVGVAFGGTVEETAKLAKEALYRPEAHEEERVARIEKE
FT                   LLDEVNSLGLGPMGLGGGPTALAVRADYAYRHPASFPVAVRFNCWAAREAVVEVNADGS
FT                   WKLVSDNVTPEDLKTPPLEAEDGVEIKLPVEEEEVRKLKAGDVVYLTGTVVTARDEAHK
FT                   KIIEEGAPLDLKGLAIYHCGPVVTKEEGRWKVVAAGPTTSARMNALQAQVLEKTGARLV
FT                   IGKGGMKEDLLDFFKRFGAAYLAFPGGAALLAAKAIKAVRGVYWLEELGIPEAMWVFEV
FT                   EKFGPLVVAMDSHGRSLYKEVSERAKTKLEELLK"
FT   gene            612535..613950
FT                   /locus_tag="Igni_0679"
FT   CDS_pept        612535..613950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Igni_0679"
FT                   /product="Sodium-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="PFAM: H+-transporting two-sector ATPase, alpha/beta
FT                   subunit, central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Igni_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABU81861"
FT                   /db_xref="GOA:A8AAA9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AAA9"
FT                   /protein_id="ABU81861.1"
FT                   /translation="MAVPSVKGKEYESVSEIRGQLLVVEGVSDAGYGELVDIEMPSGEK
FT                   RRGIVLETGKGLAVVQVFEGTTGISPAGTKVRFTGRILEMGVSEDMLGRIMNALGEPID
FT                   GGAPIKAVEKRNVWGEPINPYAREYPDEFIETGISAIDGMNSLVRGQKLPIFSGSGLPH
FT                   NKLAAQIARQATVRGEEESFAVVFAAVGIQYDELLFFKKAFEETGAISRTAMFVSLANE
FT                   PAMMKIVTPRAALTLAEYLAFQKDMHVLVIITDMTNYCEALREISASREEVPSRQGYPG
FT                   YMYTDLATIYERAGRVKGSKGSITQMPILTMPNDDITHPIPDLTGYITEGQIVLSRDLH
FT                   NKGIYPPINVLMSLSRLMRDGIGKGKTREDHPDVANQLFAAYSRAVELRGLAAIVGEES
FT                   LSEVDRKYLRFGEAFEQKFLKQDYYERRTIEQTLDLAWEVLSILPEEELTKIR