(data stored in ACNUC7421 zone)

EMBL: CP000817

ID   CP000817; SV 1; circular; genomic DNA; STD; PRO; 4639821 BP.
XX
AC   CP000817;
XX
PR   Project:PRJNA19619;
XX
DT   04-MAR-2008 (Rel. 95, Created)
DT   22-JAN-2015 (Rel. 123, Last updated, Version 8)
XX
DE   Lysinibacillus sphaericus C3-41, complete genome.
XX
KW   .
XX
OS   Lysinibacillus sphaericus C3-41
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Lysinibacillus.
XX
RN   [1]
RP   1-4639821
RX   DOI; 10.1128/JB.01652-07.
RX   PUBMED; 18296527.
RA   Hu X., Fan W., Han B., Liu H., Zheng D., Li Q., Dong W., Yan J., Gao M.,
RA   Berry C., Yuan Z.;
RT   "Complete genome sequence of the mosquitocidal bacterium Bacillus
RT   sphaericus C3-41 and comparison with those of closely related Bacillus
RT   species";
RL   J. Bacteriol. 190(8):2892-2902(2008).
XX
RN   [2]
RP   1-4639821
RA   Yuan Z., Hu X., Zheng D., Yan J., Cai Q.;
RT   ;
RL   Submitted (23-AUG-2007) to the INSDC.
RL   State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese
RL   Academy of Sciences, Wuchang Xiaohongshan Zhongqu 44, Wuhan, Hubei 430071,
RL   P.R.China
XX
DR   MD5; 3f21330c337c571b1f1eb24b268699ef.
DR   BioSample; SAMN02604328.
DR   EnsemblGenomes-Gn; Bsph_rRNA0116S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0123S.
DR   EnsemblGenomes-Gn; Bsph_rRNA015S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0216S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0223S.
DR   EnsemblGenomes-Gn; Bsph_rRNA025S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0316S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0323S.
DR   EnsemblGenomes-Gn; Bsph_rRNA035S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0416S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0423S.
DR   EnsemblGenomes-Gn; Bsph_rRNA045S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0516S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0523S.
DR   EnsemblGenomes-Gn; Bsph_rRNA055S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0616S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0623S.
DR   EnsemblGenomes-Gn; Bsph_rRNA065S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0716S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0723S.
DR   EnsemblGenomes-Gn; Bsph_rRNA075S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0816S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0823S.
DR   EnsemblGenomes-Gn; Bsph_rRNA085S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0916S.
DR   EnsemblGenomes-Gn; Bsph_rRNA0923S.
DR   EnsemblGenomes-Gn; Bsph_rRNA095S.
DR   EnsemblGenomes-Gn; Bsph_rRNA105S.
DR   EnsemblGenomes-Gn; Bsph_rRNA1116S.
DR   EnsemblGenomes-Gn; Bsph_rRNA1123S.
DR   EnsemblGenomes-Gn; Bsph_rRNA115S.
DR   EnsemblGenomes-Gn; Bsph_tRNA1.
DR   EnsemblGenomes-Gn; Bsph_tRNA10.
DR   EnsemblGenomes-Gn; Bsph_tRNA11.
DR   EnsemblGenomes-Gn; Bsph_tRNA12.
DR   EnsemblGenomes-Gn; Bsph_tRNA13.
DR   EnsemblGenomes-Gn; Bsph_tRNA14.
DR   EnsemblGenomes-Gn; Bsph_tRNA15.
DR   EnsemblGenomes-Gn; Bsph_tRNA16.
DR   EnsemblGenomes-Gn; Bsph_tRNA17.
DR   EnsemblGenomes-Gn; Bsph_tRNA18.
DR   EnsemblGenomes-Gn; Bsph_tRNA19.
DR   EnsemblGenomes-Gn; Bsph_tRNA2.
DR   EnsemblGenomes-Gn; Bsph_tRNA20.
DR   EnsemblGenomes-Gn; Bsph_tRNA21.
DR   EnsemblGenomes-Gn; Bsph_tRNA22.
DR   EnsemblGenomes-Gn; Bsph_tRNA23.
DR   EnsemblGenomes-Gn; Bsph_tRNA24.
DR   EnsemblGenomes-Gn; Bsph_tRNA25.
DR   EnsemblGenomes-Gn; Bsph_tRNA26.
DR   EnsemblGenomes-Gn; Bsph_tRNA27.
DR   EnsemblGenomes-Gn; Bsph_tRNA28.
DR   EnsemblGenomes-Gn; Bsph_tRNA29.
DR   EnsemblGenomes-Gn; Bsph_tRNA3.
DR   EnsemblGenomes-Gn; Bsph_tRNA30.
DR   EnsemblGenomes-Gn; Bsph_tRNA31.
DR   EnsemblGenomes-Gn; Bsph_tRNA32.
DR   EnsemblGenomes-Gn; Bsph_tRNA33.
DR   EnsemblGenomes-Gn; Bsph_tRNA34.
DR   EnsemblGenomes-Gn; Bsph_tRNA35.
DR   EnsemblGenomes-Gn; Bsph_tRNA36.
DR   EnsemblGenomes-Gn; Bsph_tRNA37.
DR   EnsemblGenomes-Gn; Bsph_tRNA38.
DR   EnsemblGenomes-Gn; Bsph_tRNA39.
DR   EnsemblGenomes-Gn; Bsph_tRNA4.
DR   EnsemblGenomes-Gn; Bsph_tRNA40.
DR   EnsemblGenomes-Gn; Bsph_tRNA41.
DR   EnsemblGenomes-Gn; Bsph_tRNA42.
DR   EnsemblGenomes-Gn; Bsph_tRNA43.
DR   EnsemblGenomes-Gn; Bsph_tRNA44.
DR   EnsemblGenomes-Gn; Bsph_tRNA45.
DR   EnsemblGenomes-Gn; Bsph_tRNA46.
DR   EnsemblGenomes-Gn; Bsph_tRNA47.
DR   EnsemblGenomes-Gn; Bsph_tRNA48.
DR   EnsemblGenomes-Gn; Bsph_tRNA49.
DR   EnsemblGenomes-Gn; Bsph_tRNA5.
DR   EnsemblGenomes-Gn; Bsph_tRNA50.
DR   EnsemblGenomes-Gn; Bsph_tRNA51.
DR   EnsemblGenomes-Gn; Bsph_tRNA52.
DR   EnsemblGenomes-Gn; Bsph_tRNA53.
DR   EnsemblGenomes-Gn; Bsph_tRNA54.
DR   EnsemblGenomes-Gn; Bsph_tRNA55.
DR   EnsemblGenomes-Gn; Bsph_tRNA56.
DR   EnsemblGenomes-Gn; Bsph_tRNA57.
DR   EnsemblGenomes-Gn; Bsph_tRNA58.
DR   EnsemblGenomes-Gn; Bsph_tRNA59.
DR   EnsemblGenomes-Gn; Bsph_tRNA6.
DR   EnsemblGenomes-Gn; Bsph_tRNA60.
DR   EnsemblGenomes-Gn; Bsph_tRNA61.
DR   EnsemblGenomes-Gn; Bsph_tRNA62.
DR   EnsemblGenomes-Gn; Bsph_tRNA63.
DR   EnsemblGenomes-Gn; Bsph_tRNA64.
DR   EnsemblGenomes-Gn; Bsph_tRNA65.
DR   EnsemblGenomes-Gn; Bsph_tRNA66.
DR   EnsemblGenomes-Gn; Bsph_tRNA67.
DR   EnsemblGenomes-Gn; Bsph_tRNA68.
DR   EnsemblGenomes-Gn; Bsph_tRNA69.
DR   EnsemblGenomes-Gn; Bsph_tRNA7.
DR   EnsemblGenomes-Gn; Bsph_tRNA70.
DR   EnsemblGenomes-Gn; Bsph_tRNA71.
DR   EnsemblGenomes-Gn; Bsph_tRNA72.
DR   EnsemblGenomes-Gn; Bsph_tRNA73.
DR   EnsemblGenomes-Gn; Bsph_tRNA74.
DR   EnsemblGenomes-Gn; Bsph_tRNA75.
DR   EnsemblGenomes-Gn; Bsph_tRNA76.
DR   EnsemblGenomes-Gn; Bsph_tRNA77.
DR   EnsemblGenomes-Gn; Bsph_tRNA78.
DR   EnsemblGenomes-Gn; Bsph_tRNA79.
DR   EnsemblGenomes-Gn; Bsph_tRNA8.
DR   EnsemblGenomes-Gn; Bsph_tRNA80.
DR   EnsemblGenomes-Gn; Bsph_tRNA81.
DR   EnsemblGenomes-Gn; Bsph_tRNA82.
DR   EnsemblGenomes-Gn; Bsph_tRNA83.
DR   EnsemblGenomes-Gn; Bsph_tRNA84.
DR   EnsemblGenomes-Gn; Bsph_tRNA85.
DR   EnsemblGenomes-Gn; Bsph_tRNA9.
DR   EnsemblGenomes-Gn; EBG00001177187.
DR   EnsemblGenomes-Gn; EBG00001177188.
DR   EnsemblGenomes-Gn; EBG00001177189.
DR   EnsemblGenomes-Gn; EBG00001177190.
DR   EnsemblGenomes-Gn; EBG00001177191.
DR   EnsemblGenomes-Gn; EBG00001177192.
DR   EnsemblGenomes-Gn; EBG00001177193.
DR   EnsemblGenomes-Gn; EBG00001177194.
DR   EnsemblGenomes-Gn; EBG00001177195.
DR   EnsemblGenomes-Gn; EBG00001177196.
DR   EnsemblGenomes-Gn; EBG00001177197.
DR   EnsemblGenomes-Gn; EBG00001177198.
DR   EnsemblGenomes-Gn; EBG00001177199.
DR   EnsemblGenomes-Gn; EBG00001177200.
DR   EnsemblGenomes-Gn; EBG00001177201.
DR   EnsemblGenomes-Gn; EBG00001177202.
DR   EnsemblGenomes-Gn; EBG00001177203.
DR   EnsemblGenomes-Gn; EBG00001177204.
DR   EnsemblGenomes-Gn; EBG00001177205.
DR   EnsemblGenomes-Gn; EBG00001177206.
DR   EnsemblGenomes-Gn; EBG00001177207.
DR   EnsemblGenomes-Gn; EBG00001177208.
DR   EnsemblGenomes-Gn; EBG00001177209.
DR   EnsemblGenomes-Gn; EBG00001177210.
DR   EnsemblGenomes-Gn; EBG00001177211.
DR   EnsemblGenomes-Gn; EBG00001177212.
DR   EnsemblGenomes-Gn; EBG00001177213.
DR   EnsemblGenomes-Gn; EBG00001177214.
DR   EnsemblGenomes-Gn; EBG00001177215.
DR   EnsemblGenomes-Gn; EBG00001177216.
DR   EnsemblGenomes-Gn; EBG00001177217.
DR   EnsemblGenomes-Gn; EBG00001177218.
DR   EnsemblGenomes-Gn; EBG00001177219.
DR   EnsemblGenomes-Gn; EBG00001177220.
DR   EnsemblGenomes-Gn; EBG00001177221.
DR   EnsemblGenomes-Gn; EBG00001177222.
DR   EnsemblGenomes-Gn; EBG00001177223.
DR   EnsemblGenomes-Gn; EBG00001177224.
DR   EnsemblGenomes-Gn; EBG00001177225.
DR   EnsemblGenomes-Gn; EBG00001177226.
DR   EnsemblGenomes-Gn; EBG00001177227.
DR   EnsemblGenomes-Gn; EBG00001177228.
DR   EnsemblGenomes-Gn; EBG00001177229.
DR   EnsemblGenomes-Gn; EBG00001177230.
DR   EnsemblGenomes-Gn; EBG00001177231.
DR   EnsemblGenomes-Gn; EBG00001177232.
DR   EnsemblGenomes-Gn; EBG00001177233.
DR   EnsemblGenomes-Gn; EBG00001177234.
DR   EnsemblGenomes-Gn; EBG00001177235.
DR   EnsemblGenomes-Gn; EBG00001177236.
DR   EnsemblGenomes-Gn; EBG00001177237.
DR   EnsemblGenomes-Gn; EBG00001177238.
DR   EnsemblGenomes-Gn; EBG00001177239.
DR   EnsemblGenomes-Gn; EBG00001177240.
DR   EnsemblGenomes-Gn; EBG00001177241.
DR   EnsemblGenomes-Gn; EBG00001177242.
DR   EnsemblGenomes-Gn; EBG00001177243.
DR   EnsemblGenomes-Gn; EBG00001177244.
DR   EnsemblGenomes-Gn; EBG00001177245.
DR   EnsemblGenomes-Gn; EBG00001177246.
DR   EnsemblGenomes-Gn; EBG00001177247.
DR   EnsemblGenomes-Gn; EBG00001177248.
DR   EnsemblGenomes-Gn; EBG00001177249.
DR   EnsemblGenomes-Gn; EBG00001177250.
DR   EnsemblGenomes-Gn; EBG00001177251.
DR   EnsemblGenomes-Gn; EBG00001177252.
DR   EnsemblGenomes-Gn; EBG00001177253.
DR   EnsemblGenomes-Gn; EBG00001177254.
DR   EnsemblGenomes-Gn; EBG00001177255.
DR   EnsemblGenomes-Gn; EBG00001177256.
DR   EnsemblGenomes-Gn; EBG00001177257.
DR   EnsemblGenomes-Gn; EBG00001177258.
DR   EnsemblGenomes-Gn; EBG00001177259.
DR   EnsemblGenomes-Gn; EBG00001177260.
DR   EnsemblGenomes-Gn; EBG00001177261.
DR   EnsemblGenomes-Gn; EBG00001177262.
DR   EnsemblGenomes-Gn; EBG00001177263.
DR   EnsemblGenomes-Gn; EBG00001177264.
DR   EnsemblGenomes-Gn; EBG00001177265.
DR   EnsemblGenomes-Gn; EBG00001177266.
DR   EnsemblGenomes-Gn; EBG00001177267.
DR   EnsemblGenomes-Gn; EBG00001177268.
DR   EnsemblGenomes-Gn; EBG00001177269.
DR   EnsemblGenomes-Gn; EBG00001177270.
DR   EnsemblGenomes-Gn; EBG00001177271.
DR   EnsemblGenomes-Gn; EBG00001177272.
DR   EnsemblGenomes-Gn; EBG00001177273.
DR   EnsemblGenomes-Gn; EBG00001177274.
DR   EnsemblGenomes-Gn; EBG00001177275.
DR   EnsemblGenomes-Gn; EBG00001177276.
DR   EnsemblGenomes-Gn; EBG00001177277.
DR   EnsemblGenomes-Gn; EBG00001177278.
DR   EnsemblGenomes-Gn; EBG00001177279.
DR   EnsemblGenomes-Gn; EBG00001177280.
DR   EnsemblGenomes-Gn; EBG00001177281.
DR   EnsemblGenomes-Gn; EBG00001177282.
DR   EnsemblGenomes-Gn; EBG00001177283.
DR   EnsemblGenomes-Gn; EBG00001177284.
DR   EnsemblGenomes-Gn; EBG00001177285.
DR   EnsemblGenomes-Gn; EBG00001177286.
DR   EnsemblGenomes-Gn; EBG00001177287.
DR   EnsemblGenomes-Gn; EBG00001177288.
DR   EnsemblGenomes-Gn; EBG00001177289.
DR   EnsemblGenomes-Gn; EBG00001177290.
DR   EnsemblGenomes-Gn; EBG00001177291.
DR   EnsemblGenomes-Gn; EBG00001177292.
DR   EnsemblGenomes-Gn; EBG00001177293.
DR   EnsemblGenomes-Gn; EBG00001177294.
DR   EnsemblGenomes-Gn; EBG00001177295.
DR   EnsemblGenomes-Gn; EBG00001177296.
DR   EnsemblGenomes-Gn; EBG00001177297.
DR   EnsemblGenomes-Gn; EBG00001177298.
DR   EnsemblGenomes-Gn; EBG00001177299.
DR   EnsemblGenomes-Gn; EBG00001177300.
DR   EnsemblGenomes-Gn; EBG00001177301.
DR   EnsemblGenomes-Gn; EBG00001177302.
DR   EnsemblGenomes-Gn; EBG00001177303.
DR   EnsemblGenomes-Gn; EBG00001177304.
DR   EnsemblGenomes-Gn; EBG00001177305.
DR   EnsemblGenomes-Gn; EBG00001177306.
DR   EnsemblGenomes-Gn; EBG00001177307.
DR   EnsemblGenomes-Gn; EBG00001177308.
DR   EnsemblGenomes-Gn; EBG00001177309.
DR   EnsemblGenomes-Gn; EBG00001177310.
DR   EnsemblGenomes-Gn; EBG00001177311.
DR   EnsemblGenomes-Gn; EBG00001177312.
DR   EnsemblGenomes-Gn; EBG00001177313.
DR   EnsemblGenomes-Gn; EBG00001177314.
DR   EnsemblGenomes-Gn; EBG00001177315.
DR   EnsemblGenomes-Gn; EBG00001177316.
DR   EnsemblGenomes-Gn; EBG00001177317.
DR   EnsemblGenomes-Gn; EBG00001177318.
DR   EnsemblGenomes-Gn; EBG00001177319.
DR   EnsemblGenomes-Gn; EBG00001177320.
DR   EnsemblGenomes-Gn; EBG00001177321.
DR   EnsemblGenomes-Gn; EBG00001177322.
DR   EnsemblGenomes-Gn; EBG00001177323.
DR   EnsemblGenomes-Gn; EBG00001177324.
DR   EnsemblGenomes-Tr; Bsph_rRNA0116S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0123S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA015S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0216S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0223S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA025S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0316S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0323S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA035S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0416S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0423S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA045S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0516S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0523S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA055S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0616S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0623S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA065S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0716S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0723S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA075S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0816S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0823S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA085S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0916S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA0923S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA095S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA105S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA1116S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA1123S-1.
DR   EnsemblGenomes-Tr; Bsph_rRNA115S-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA1-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA10-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA11-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA12-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA13-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA14-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA15-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA16-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA17-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA18-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA19-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA2-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA20-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA21-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA22-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA23-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA24-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA25-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA26-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA27-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA28-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA29-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA3-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA30-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA31-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA32-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA33-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA34-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA35-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA36-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA37-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA38-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA39-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA4-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA40-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA41-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA42-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA43-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA44-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA45-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA46-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA47-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA48-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA49-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA5-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA50-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA51-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA52-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA53-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA54-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA55-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA56-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA57-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA58-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA59-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA6-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA60-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA61-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA62-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA63-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA64-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA65-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA66-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA67-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA68-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA69-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA7-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA70-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA71-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA72-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA73-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA74-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA75-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA76-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA77-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA78-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA79-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA8-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA80-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA81-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA82-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA83-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA84-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA85-1.
DR   EnsemblGenomes-Tr; Bsph_tRNA9-1.
DR   EnsemblGenomes-Tr; EBT00001755908.
DR   EnsemblGenomes-Tr; EBT00001755909.
DR   EnsemblGenomes-Tr; EBT00001755910.
DR   EnsemblGenomes-Tr; EBT00001755911.
DR   EnsemblGenomes-Tr; EBT00001755912.
DR   EnsemblGenomes-Tr; EBT00001755913.
DR   EnsemblGenomes-Tr; EBT00001755914.
DR   EnsemblGenomes-Tr; EBT00001755915.
DR   EnsemblGenomes-Tr; EBT00001755916.
DR   EnsemblGenomes-Tr; EBT00001755917.
DR   EnsemblGenomes-Tr; EBT00001755918.
DR   EnsemblGenomes-Tr; EBT00001755919.
DR   EnsemblGenomes-Tr; EBT00001755920.
DR   EnsemblGenomes-Tr; EBT00001755921.
DR   EnsemblGenomes-Tr; EBT00001755922.
DR   EnsemblGenomes-Tr; EBT00001755923.
DR   EnsemblGenomes-Tr; EBT00001755924.
DR   EnsemblGenomes-Tr; EBT00001755925.
DR   EnsemblGenomes-Tr; EBT00001755926.
DR   EnsemblGenomes-Tr; EBT00001755927.
DR   EnsemblGenomes-Tr; EBT00001755928.
DR   EnsemblGenomes-Tr; EBT00001755929.
DR   EnsemblGenomes-Tr; EBT00001755930.
DR   EnsemblGenomes-Tr; EBT00001755931.
DR   EnsemblGenomes-Tr; EBT00001755932.
DR   EnsemblGenomes-Tr; EBT00001755933.
DR   EnsemblGenomes-Tr; EBT00001755934.
DR   EnsemblGenomes-Tr; EBT00001755935.
DR   EnsemblGenomes-Tr; EBT00001755936.
DR   EnsemblGenomes-Tr; EBT00001755937.
DR   EnsemblGenomes-Tr; EBT00001755938.
DR   EnsemblGenomes-Tr; EBT00001755939.
DR   EnsemblGenomes-Tr; EBT00001755940.
DR   EnsemblGenomes-Tr; EBT00001755941.
DR   EnsemblGenomes-Tr; EBT00001755942.
DR   EnsemblGenomes-Tr; EBT00001755943.
DR   EnsemblGenomes-Tr; EBT00001755944.
DR   EnsemblGenomes-Tr; EBT00001755945.
DR   EnsemblGenomes-Tr; EBT00001755946.
DR   EnsemblGenomes-Tr; EBT00001755947.
DR   EnsemblGenomes-Tr; EBT00001755948.
DR   EnsemblGenomes-Tr; EBT00001755949.
DR   EnsemblGenomes-Tr; EBT00001755950.
DR   EnsemblGenomes-Tr; EBT00001755951.
DR   EnsemblGenomes-Tr; EBT00001755952.
DR   EnsemblGenomes-Tr; EBT00001755953.
DR   EnsemblGenomes-Tr; EBT00001755954.
DR   EnsemblGenomes-Tr; EBT00001755955.
DR   EnsemblGenomes-Tr; EBT00001755956.
DR   EnsemblGenomes-Tr; EBT00001755957.
DR   EnsemblGenomes-Tr; EBT00001755958.
DR   EnsemblGenomes-Tr; EBT00001755959.
DR   EnsemblGenomes-Tr; EBT00001755960.
DR   EnsemblGenomes-Tr; EBT00001755961.
DR   EnsemblGenomes-Tr; EBT00001755962.
DR   EnsemblGenomes-Tr; EBT00001755963.
DR   EnsemblGenomes-Tr; EBT00001755964.
DR   EnsemblGenomes-Tr; EBT00001755965.
DR   EnsemblGenomes-Tr; EBT00001755966.
DR   EnsemblGenomes-Tr; EBT00001755967.
DR   EnsemblGenomes-Tr; EBT00001755968.
DR   EnsemblGenomes-Tr; EBT00001755969.
DR   EnsemblGenomes-Tr; EBT00001755970.
DR   EnsemblGenomes-Tr; EBT00001755971.
DR   EnsemblGenomes-Tr; EBT00001755972.
DR   EnsemblGenomes-Tr; EBT00001755973.
DR   EnsemblGenomes-Tr; EBT00001755974.
DR   EnsemblGenomes-Tr; EBT00001755975.
DR   EnsemblGenomes-Tr; EBT00001755976.
DR   EnsemblGenomes-Tr; EBT00001755977.
DR   EnsemblGenomes-Tr; EBT00001755978.
DR   EnsemblGenomes-Tr; EBT00001755979.
DR   EnsemblGenomes-Tr; EBT00001755980.
DR   EnsemblGenomes-Tr; EBT00001755981.
DR   EnsemblGenomes-Tr; EBT00001755982.
DR   EnsemblGenomes-Tr; EBT00001755983.
DR   EnsemblGenomes-Tr; EBT00001755984.
DR   EnsemblGenomes-Tr; EBT00001755985.
DR   EnsemblGenomes-Tr; EBT00001755986.
DR   EnsemblGenomes-Tr; EBT00001755987.
DR   EnsemblGenomes-Tr; EBT00001755988.
DR   EnsemblGenomes-Tr; EBT00001755989.
DR   EnsemblGenomes-Tr; EBT00001755990.
DR   EnsemblGenomes-Tr; EBT00001755991.
DR   EnsemblGenomes-Tr; EBT00001755992.
DR   EnsemblGenomes-Tr; EBT00001755993.
DR   EnsemblGenomes-Tr; EBT00001755994.
DR   EnsemblGenomes-Tr; EBT00001755995.
DR   EnsemblGenomes-Tr; EBT00001755996.
DR   EnsemblGenomes-Tr; EBT00001755997.
DR   EnsemblGenomes-Tr; EBT00001755998.
DR   EnsemblGenomes-Tr; EBT00001755999.
DR   EnsemblGenomes-Tr; EBT00001756000.
DR   EnsemblGenomes-Tr; EBT00001756001.
DR   EnsemblGenomes-Tr; EBT00001756002.
DR   EnsemblGenomes-Tr; EBT00001756003.
DR   EnsemblGenomes-Tr; EBT00001756004.
DR   EnsemblGenomes-Tr; EBT00001756005.
DR   EnsemblGenomes-Tr; EBT00001756006.
DR   EnsemblGenomes-Tr; EBT00001756007.
DR   EnsemblGenomes-Tr; EBT00001756008.
DR   EnsemblGenomes-Tr; EBT00001756009.
DR   EnsemblGenomes-Tr; EBT00001756010.
DR   EnsemblGenomes-Tr; EBT00001756011.
DR   EnsemblGenomes-Tr; EBT00001756012.
DR   EnsemblGenomes-Tr; EBT00001756013.
DR   EnsemblGenomes-Tr; EBT00001756014.
DR   EnsemblGenomes-Tr; EBT00001756015.
DR   EnsemblGenomes-Tr; EBT00001756016.
DR   EnsemblGenomes-Tr; EBT00001756017.
DR   EnsemblGenomes-Tr; EBT00001756018.
DR   EnsemblGenomes-Tr; EBT00001756019.
DR   EnsemblGenomes-Tr; EBT00001756020.
DR   EnsemblGenomes-Tr; EBT00001756021.
DR   EnsemblGenomes-Tr; EBT00001756022.
DR   EnsemblGenomes-Tr; EBT00001756023.
DR   EnsemblGenomes-Tr; EBT00001756024.
DR   EnsemblGenomes-Tr; EBT00001756025.
DR   EnsemblGenomes-Tr; EBT00001756026.
DR   EnsemblGenomes-Tr; EBT00001756027.
DR   EnsemblGenomes-Tr; EBT00001756028.
DR   EnsemblGenomes-Tr; EBT00001756029.
DR   EnsemblGenomes-Tr; EBT00001756030.
DR   EnsemblGenomes-Tr; EBT00001756031.
DR   EnsemblGenomes-Tr; EBT00001756032.
DR   EnsemblGenomes-Tr; EBT00001756033.
DR   EnsemblGenomes-Tr; EBT00001756034.
DR   EnsemblGenomes-Tr; EBT00001756035.
DR   EnsemblGenomes-Tr; EBT00001756036.
DR   EnsemblGenomes-Tr; EBT00001756037.
DR   EnsemblGenomes-Tr; EBT00001756038.
DR   EnsemblGenomes-Tr; EBT00001756039.
DR   EnsemblGenomes-Tr; EBT00001756040.
DR   EnsemblGenomes-Tr; EBT00001756041.
DR   EnsemblGenomes-Tr; EBT00001756042.
DR   EnsemblGenomes-Tr; EBT00001756043.
DR   EnsemblGenomes-Tr; EBT00001756044.
DR   EnsemblGenomes-Tr; EBT00001756045.
DR   EuropePMC; PMC2293248; 18296527.
DR   EuropePMC; PMC3626951; 24426112.
DR   EuropePMC; PMC3910547; 24501644.
DR   EuropePMC; PMC4317669; 25685257.
DR   EuropePMC; PMC4363355; 25888315.
DR   EuropePMC; PMC5011910; 27595771.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; CP000817.
DR   SILVA-SSU; CP000817.
XX
CC   Bacillus sphaericus C3-41 is available from Wuhan Institute of
CC   Virology, Chinese Academy of Sciences. Email address: yzm@wh.iov.cn
CC   DNA used for sequencing was isolated from B. sphaericus C3-41
CC   following standard protocols.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4639821
FT                   /organism="Lysinibacillus sphaericus C3-41"
FT                   /strain="C3-41"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:444177"
FT   gene            211..651
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0001"
FT   CDS_pept        211..651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0001"
FT                   /product="DnaA"
FT                   /note="Chromosomal replication initiator protein; ATPase
FT                   involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37647"
FT                   /db_xref="GOA:B1HS29"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS29"
FT                   /protein_id="ACA37647.1"
FT                   /translation="MLLALVTAIAHAASLAVAEAPAKAYNPFFIYGGVGLGKTHLMHAI
FT                   GHYVLEHNPNAKVVYLSSEKFTNEFINSIRDNKALDFRNKYRNVDVLLIDDIQFLAGKE
FT                   STQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEASATFTF"
FT   gene            686..841
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0002"
FT   CDS_pept        686..841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0002"
FT                   /product="DnaA"
FT                   /note="Chromosomal replication initiator protein; ATPase
FT                   involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37648"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS30"
FT                   /protein_id="ACA37648.1"
FT                   /translation="METRIAILRKKAKADGLEVPNEVMLYIANQMDSNIRELKVRLFAS
FT                   LPIHRS"
FT   gene            913..1041
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0003"
FT   CDS_pept        913..1041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0003"
FT                   /product="DnaA"
FT                   /note="Chromosomal replication initiator protein; ATPase
FT                   involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37649"
FT                   /db_xref="GOA:B1HS31"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS31"
FT                   /protein_id="ACA37649.1"
FT                   /translation="MTILDIQNAVGEHFSIRLEDFTAKKRTKLIAFPRQIAHVFIT"
FT   gene            1025..1198
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0004"
FT   CDS_pept        1025..1198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="Bsph_0004"
FT                   /product="DnaA"
FT                   /note="Chromosomal replication initiator protein; ATPase
FT                   involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37650"
FT                   /db_xref="GOA:B1HS32"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS32"
FT                   /protein_id="ACA37650.1"
FT                   /translation="MYLSRELTDFSLPKIGEEFGGRDHTTVIHAHEKISSLLKNDVQLQ
FT                   QDVKQIRSMLGK"
FT   gene            1369..2505
FT                   /gene="dnaN"
FT                   /locus_tag="Bsph_0005"
FT   CDS_pept        1369..2505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="Bsph_0005"
FT                   /product="DnaN"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA polymerase sliding clamp subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37651"
FT                   /db_xref="GOA:B1HS33"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS33"
FT                   /protein_id="ACA37651.1"
FT                   /translation="MKFDILRDRLLEGLNDVMKAVSSKTTIPILTGIKIDVTEEGIRLT
FT                   GSDADITIQTFIPVEEDGQQIIHIAETGSIVVQARMFNEIIRKLPTNDVEIQVTPGFQT
FT                   HIRSGKSEFHLIGSDAAEYPLLPELTEDQKFTIPADLLKTIIRETVFAVATSESRPVLT
FT                   GVNWQIKNETLICVATDSHRLARRKVQLENLPEVEHSVVIPGKSLNELNKVLEDSTNLV
FT                   QIVITSQQVLFKTGDVLFFSRLLEGNYPDTSRLIPEEYQTNVTINGKSLLQAIDRASLV
FT                   ARGDRNNVVRFEILGHQAVEVSSNSPEIGKVQEEIPVESLEGEGLKISFSAKYMMEALK
FT                   AIDGQDVVIQFTGAMRPFILRSVHDDAILQLILPVRTY"
FT   gene            2617..2841
FT                   /locus_tag="Bsph_0006"
FT   CDS_pept        2617..2841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0006"
FT                   /product="Hypothetical yaaA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37652"
FT                   /db_xref="GOA:B1HS34"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS34"
FT                   /protein_id="ACA37652.1"
FT                   /translation="MQDIKIDEEFITLGQLLKISDAISSGGMAKWFLQENAVYVNGEVD
FT                   DRRGRKLRNGDVVNIPGCGRFQIVGPTGQ"
FT   gene            2845..3960
FT                   /gene="recF"
FT                   /locus_tag="Bsph_0007"
FT   CDS_pept        2845..3960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="Bsph_0007"
FT                   /product="RecF"
FT                   /note="Recombinational DNA repair ATPase (RecF pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37653"
FT                   /db_xref="GOA:B1HS35"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HS35"
FT                   /protein_id="ACA37653.1"
FT                   /translation="MHIEQIKLTNYRNYDALALNFSPKINVFIGENAQGKTNVMESIYV
FT                   LAMAKSHRTTNDKELIRWDSDYGKIEGAVQKRHGILPIELTITKKGKKGKINHIEQSRL
FT                   SHYIGQMNVVMFAPEDLNVVKGSPQIRRRFIDMEIGQISPVYLHDLLTFQKVLKQRNHF
FT                   LKMNQGKSMSNDVMYEVYNEQYIHAATQIIRKRFQFMDLLQEWAEPIHAGISQGKETLI
FT                   IKYRTVAGIEKEHSSSEIENTLHQKLMEAREREFDRGVTLVGPHRDDLQFLVNGYDVQT
FT                   YGSQGQQRTTALSLKLAEIELIKQETNETPILLLDDVLSELDDYRQSHLLNTIQGEVQT
FT                   FVTTTSVEGIHHETMEQAQLFHVKQGAIEKS"
FT   gene            4053..5987
FT                   /locus_tag="Bsph_0008"
FT   CDS_pept        4053..5987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0008"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37654"
FT                   /db_xref="GOA:B1HS36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS36"
FT                   /protein_id="ACA37654.1"
FT                   /translation="MKAVAIENEGLQNQAYEADQIQVLEGLEAVRKRPGMYIGSTSSKG
FT                   LHHLVWEIVDNSIDEALAGFCTDIQVTIEKENWIRVEDNGRGIPVSIQEKMGKPAVEVI
FT                   MTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSVETIVQVHREGHIHEIKFQRGKTIQE
FT                   LKIIGDTDRNGTTTRFKADPEIFKETTVYEYDILAHRIRELAYLNRGIKITIADEREGE
FT                   ERSTTYHYEGGIRSYVEHLNQSKEPIHDPIDVLGEKDGISVEIAMQYNAGFSSNIFSFA
FT                   NNINTYEGGTHESGFKTALTRVINDYARKGGLLKEADANLTGEDVREGLTAIVSVKHPD
FT                   PQFEGQTKTKLGNSEVSQITNSLFSDGFERFMLENPTVARKVVEKGLMAARARVAAKKA
FT                   REFTRRKNALEVSSLPGKLADCSSTNPADCEIYIVEGDSAGGSAKSGRDRHFQAILPLR
FT                   GKILNVEKARLDKILSNAEIRAMITAFGTGIGEEFNLEKARYHKIIIMTDADVDGAHIR
FT                   TLLLTFFFRFLRPLIEAGYIYIAQPPLYQVKQGKHVEYCYDDETLKEILERLPKMPKPN
FT                   VQRYKGLGEMNAEQLWDTTMDPEHRTLLQVELDDAIKANQAFERLMGDEVEPRRQFIEE
FT                   NAVYANLDI"
FT   gene            6013..8478
FT                   /locus_tag="Bsph_0009"
FT   CDS_pept        6013..8478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0009"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37655"
FT                   /db_xref="GOA:B1HS37"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS37"
FT                   /protein_id="ACA37655.1"
FT                   /translation="MSEQERSGVKGINITEEIETSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYGMQELGNTADKPYKKSARIVGDVMGKYHPHGDSSIYDAMVRMAQDFSYRYMLV
FT                   DGHGNFGSVDGDGAAAMRYTESRMSKIAMEMLRDINKDTIDYTDNYDGSEKEPIVLPSR
FT                   YPNLLVNGAAGIAVGMATNIPPHHLGETIDAVIALSENPAITTEELMEIIPGPDFPTGG
FT                   LILGRSGIRRAYESGRGSIIIRAKVEIEQKANGKETILVHELPYQVNKAKLIEKIAELV
FT                   RDKKIDGITNLRDESDRRGMRVVIEVRKDANANVVLNNLYKQTAMQSSFGINMLSLVNG
FT                   QPKVLGLKEMLYHYLEHQKVIIRRRTEFDLRKAEDRAHILEGLRIALDHIDEIIAIIRG
FT                   SRSGEEAKPQLMERFNLSERQAQAILDMRLVRLSGLEREKIEAEYQELQVLIAELKAIL
FT                   ADEAKIVDIIRTEILELKDRYSDTRRTEITSGGIEMIEDEDLIPVENSVVTLTHNGYIK
FT                   RLAANTYRSQKRGGRGVQGMGTNEDDFVEHLMNTSTHDTILFFTSKGKVFRAKGYEIPE
FT                   YGRTAKGLPIVNLLNIDKGEKVTAMIRVGSFDEDAYFIFTTKTGITKRTPVSQFANIRT
FT                   NGLIAISLREDDDLISVRLTDGDKQIIIGTRDGMLVRFQEDDIRSMGRTAGGVRGIKLR
FT                   DGDEVVGMEIVEPGQEILVVTEKGYGKRTSEDDYRLQSRGGVGLKTMQITDKNGPMVAV
FT                   KTVDGSEDIMLITINGMLIRMDVNDISLIGRSTQGVRLIRLGDDELVATVAKVEKEEEL
FT                   PEDEEEIEE"
FT   gene            8620..9702
FT                   /locus_tag="Bsph_0010"
FT   CDS_pept        8620..9702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37656"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS38"
FT                   /protein_id="ACA37656.1"
FT                   /translation="METIHVPISELGVGRVISEDIFANTQYPIIFKDTTISHVHLQVFQ
FT                   AFNIFNVPVYKNQNDIHSEKREIDVEVVVEDIPTFRKSYNHSIEQFKKEFKNWEAGSKV
FT                   DIAKARTIILPLVEMVLEDRTIIFDLNEFSNPKDYLYHHCVATALISSVVAQKLGYDRG
FT                   TTIQIAIGGLLADCGMAKVHPRIRDKKTPLTEQEFDEIYKHPIYSYNMVKDLTILKETM
FT                   KEAIFQHHERLNGSGYPKGEKIANISIFAQIIAVADVFHAMTCERVYRSKQSSFKVIEM
FT                   INESEFGKFDIKVVRALIDIVADLPIGTIVELSNLERGEVMFVNKFAPTRPLIKLVHTG
FT                   EIFDLGKNRSFYISRIITNL"
FT   gene            10101..11641
FT                   /locus_tag="Bsph_rRNA0116S"
FT   rRNA            10101..11641
FT                   /locus_tag="Bsph_rRNA0116S"
FT                   /product="16S ribosomal RNA"
FT   gene            11736..11812
FT                   /locus_tag="Bsph_tRNA1"
FT   tRNA            11736..11812
FT                   /locus_tag="Bsph_tRNA1"
FT                   /product="tRNA-Ile"
FT   gene            11825..11900
FT                   /locus_tag="Bsph_tRNA2"
FT   tRNA            11825..11900
FT                   /locus_tag="Bsph_tRNA2"
FT                   /product="tRNA-Ala"
FT   gene            complement(12016..12153)
FT                   /locus_tag="Bsph_0012"
FT   CDS_pept        complement(12016..12153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37657"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS39"
FT                   /protein_id="ACA37657.1"
FT                   /translation="MPRHSPCALNNLTYQLSIHFTFRCQPHSFNQSRTEVRSFIYSIAA
FT                   "
FT   gene            12129..15045
FT                   /locus_tag="Bsph_rRNA0123S"
FT   rRNA            12129..15045
FT                   /locus_tag="Bsph_rRNA0123S"
FT                   /product="23S ribosomal RNA"
FT   gene            15234..15340
FT                   /locus_tag="Bsph_rRNA015S"
FT   rRNA            15234..15340
FT                   /locus_tag="Bsph_rRNA015S"
FT                   /product="5S ribosomal RNA"
FT   gene            15617..16510
FT                   /locus_tag="Bsph_0014"
FT   CDS_pept        15617..16510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0014"
FT                   /product="Hypothetical yqhO protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37658"
FT                   /db_xref="GOA:B1HS40"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS40"
FT                   /protein_id="ACA37658.1"
FT                   /translation="MWIDGVFSGGGLKGFALVGAYQVLEDENFRFKRVAGTSAGAILAA
FT                   FIAAGYSGREIEMMLEELDVPSLLDSRRTILPFPFMKWINVYNHLGLYKGKALEKWFFK
FT                   KLAEKGVYTFGDLPKDSLKLVASDLTNGRMIVLPDDLHKYEIDAKNFSVACALRMSCGI
FT                   PFFFEPVTLKTGKGESIIVDGGVLSNFPLWIFDDREGRKVRPILGLKLSRRREEQCPHE
FT                   IKNGLNLFEALFSTMKDAHDERYISRRHERDIIFIPVEDYSATQFDLNEETKETLLEIG
FT                   RNRTIQFLRNWPRLRL"
FT   gene            16818..18361
FT                   /locus_tag="Bsph_rRNA0216S"
FT   rRNA            16818..18361
FT                   /locus_tag="Bsph_rRNA0216S"
FT                   /product="16S ribosomal RNA"
FT   gene            18456..18532
FT                   /locus_tag="Bsph_tRNA3"
FT   tRNA            18456..18532
FT                   /locus_tag="Bsph_tRNA3"
FT                   /product="tRNA-Ile"
FT   gene            18545..18620
FT                   /locus_tag="Bsph_tRNA4"
FT   tRNA            18545..18620
FT                   /locus_tag="Bsph_tRNA4"
FT                   /product="tRNA-Ala"
FT   gene            18849..21762
FT                   /locus_tag="Bsph_rRNA0223S"
FT   rRNA            18849..21762
FT                   /locus_tag="Bsph_rRNA0223S"
FT                   /product="23S ribosomal RNA"
FT   gene            21954..22060
FT                   /locus_tag="Bsph_rRNA025S"
FT   rRNA            21954..22060
FT                   /locus_tag="Bsph_rRNA025S"
FT                   /product="5S ribosomal RNA"
FT   gene            22358..23821
FT                   /locus_tag="Bsph_0017"
FT   CDS_pept        22358..23821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0017"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37659"
FT                   /db_xref="GOA:B1HS41"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS41"
FT                   /protein_id="ACA37659.1"
FT                   /translation="MWETKFAKEGLTFDDVLLVPAHSEVLPKDVDLSVQLTPKIKLNIP
FT                   MISAGMDTVTESKMAIAMARQGGIGIIHKNMGIDEQAEQVEKVKRSENGVITNPFFLTP
FT                   THQVFDAEHLMGKYRISGVPIVDSMENQKLVGIITNRDLRFISDYSLKIEDVMTKEDLI
FT                   TAPVGTTLEDAEKILQQYKIEKLPIVDEEGRLTGLITIKDIEKVIEFPNAAKDTHGRLL
FT                   VGAAVGVSKDTMVRIEKLVEAQVDIVVIDTAHGHSEGVLQTIRSIRETYPELEIIAGNV
FT                   ATAEGARALFEAGADVVKVGIGPGSICTTRVVAGVGVPQITAVYDCATVARELGKTIIA
FT                   DGGIKYSGDIVKALAAGGNVVMLGSLLAGTSESPGETEIFQGRRFKVYRGMGSIGAMEK
FT                   GSKDRYFQEDAKKLVPEGIEGRLPYKGPLADTIYQLIGGIRAGMGYCGAPHLEYLRENA
FT                   QFVKMTGAGLRESHPHDVQITKESPNYSM"
FT   gene            23963..25294
FT                   /locus_tag="Bsph_0018"
FT   CDS_pept        23963..25294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0018"
FT                   /product="D-alanyl-D-alanine carboxypeptidase precursor"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37660"
FT                   /db_xref="GOA:B1HS42"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS42"
FT                   /protein_id="ACA37660.1"
FT                   /translation="MKKKMNTVLRLLLIPVLLIGIFAGIPAKASAETDLGLTVDAAILI
FT                   DADSGKILYEQNADTSLGIASMTKMMTEYLLLDAIDAGTVKWDQEYHVTDYTYRMSQNR
FT                   ALSNVPLRRDGSYTIRELYEAMAIYSANAATVAIAETIAGTETEFLKLMNKKAEELGLE
FT                   GYKFVNATGLNNADLFGMHPAGTGPEDENVMPAKYVAKLAYHLLKDHPKVLETSQITKK
FT                   TFREGTEDAIEMSNWNFMLPGLVFEYQGVDGLKTGTTNFAGHCFTGTAERNGTRLIAVV
FT                   MKAVDASGQGSYKARFDATAKLFNYGFSQFSKQEILPANYTFKDQKTVKVTKGKEDKVE
FT                   IAVKEPISFMIKSSDKDLYKPKLVLDKKSLEAGVKKDTVVGKVVIERTEGTDYGFIDGK
FT                   DISSDIVTTGSVERASGISLFFQGIGNFFGNLWSGISDFVGGLF"
FT   gene            25395..27230
FT                   /locus_tag="Bsph_0019"
FT   CDS_pept        25395..27230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0019"
FT                   /product="Asparagine synthetase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37661"
FT                   /db_xref="GOA:B1HS43"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS43"
FT                   /protein_id="ACA37661.1"
FT                   /translation="MCGITGWASFQKNLKASEKVLQAMTRTLNRRGPDDENIWCSEHIA
FT                   FGHRRLAVIDLIGGKQPMKKLHDGINYVITYNGELYNTEELRKELEKRGHTFTTHSDTE
FT                   VLLTAYIEWKEQCVDFLNGIFAFGIWDEQEQSLFLCRDRLGVKPLYFTEQQGGILFASE
FT                   VKALLAHPMVQAAINTEGLASMMAVGPSRAPGKTLFQNIEELRPGFAMRFSREGLRKWQ
FT                   YWQLQSRKHEETLEETIEQVRWLLTDAIERQLISDVPICTFLSGGLDSSIITGIAADRF
FT                   RQQNNQLHTYSIDYEDNERFFNPHAFQTSTDTYWIQKMTEAFKTTHHAEEITQQQLIDL
FT                   LVESVIVRDSPGMADVDSSLLWFCREIKRDFTVALSGECADEIFGGYPWFKEKTTGFPW
FT                   IRSLAERNAILQEKWDKKLKIESYAQQLYTQTITEVPLLDGESPAEVKHREMFYLNMQW
FT                   FMQTLLERKDRMSMGASLEVRVPFADHRLVEYAWNIPWEMKNLDGIEKGLLRKSMAHLL
FT                   PDEVLYRKKNPYPKTYHPVYTAGVQTWLREILKDKNSILHELFEYKKLTELIESGGSSF
FT                   KIPWYGQLMAGPQLLAYLGQIHSWFEHYHIQLIES"
FT   gene            complement(27248..28675)
FT                   /locus_tag="Bsph_0020"
FT   CDS_pept        complement(27248..28675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0020"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37662"
FT                   /db_xref="GOA:B1HS44"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS44"
FT                   /protein_id="ACA37662.1"
FT                   /translation="MDMLLFQLERNGDKPLYDQLYNGIKEAIISKKIAVGEKLPSKRKL
FT                   ADFLNISQTTIEIAYAQLLAEGYIMSKSRVGYFVEEIDELPYIQQDIVIPFNEHVKKKS
FT                   YKIDFNPGSIDIDAFPFQIWRKYAKELFDEASKNLLLTGEPQGELSLRTEIANYLYQSR
FT                   GVICNPEQIVVGSGTEQLLPMILRLFRDDTCFALENPGYPAVHRMFSQHKRKVYPIAVD
FT                   EEGIVIHELERTQANVVYITPSHQFPTGAVLSATRRAQALNWAAQSSSRYIIEDDYDSE
FT                   FRYTGKPIPALHALDRNDKVIYMSTFTKSLMPSLRVAYFVLPPQLLATYNDVFNYYSST
FT                   VPRFDQHIVANFMHDGHFAKHLNRMRKVYRKKHDQLTSILEKYSSSIKITGEQAGMHIL
FT                   LDVKHELPEKQLQQLAFYAGIGIYPLSDYRLDHGESSQAQFLLGFGGIPVHVIEQSIEQ
FT                   LMDCWGIQKNNPSTTTK"
FT   gene            28779..29663
FT                   /locus_tag="Bsph_0021"
FT   CDS_pept        28779..29663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0021"
FT                   /product="Pyridoxal biosynthesis lyase pdxS"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37663"
FT                   /db_xref="GOA:B1HS45"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS45"
FT                   /protein_id="ACA37663.1"
FT                   /translation="MKQTGTNLVKRGMAEMQKGGVIMDVINAEQAKIAEAAGAVAVMAL
FT                   ERVPSDIRKAGGVARMADPRIVEEVLGAVSIPVMAKARIGHIVEARVLEAMGVDYIDES
FT                   EVLTPADEEYHLLKSNYTVPFVCGCRDLGEAARRIGEGAAMLRTKGEPGTGNIVEAVRH
FT                   IRKVNAQVRKVVGMTEDELMTEAKLLGAPFELLREIKRLGRLPVVNFAAGGVATPADAA
FT                   LMMELGADGVFVGSGIFKSDNPEKFAHAIVEATTHYKDYKLIAEISKELGVPMKGIDIA
FT                   QLGLNERMQERGW"
FT   gene            29665..30228
FT                   /gene="pdxT"
FT                   /locus_tag="Bsph_0022"
FT   CDS_pept        29665..30228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="Bsph_0022"
FT                   /product="Glutamine amidotransferase subunit"
FT                   /EC_number="2.6.-.-"
FT                   /note="Predicted glutamine amidotransferase involved in
FT                   pyridoxine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37664"
FT                   /db_xref="GOA:B1HS46"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS46"
FT                   /protein_id="ACA37664.1"
FT                   /translation="MKRIGVLALQGAVREHVQMLESLGCEAVEVKHKQDLVKLDGLVLP
FT                   GGESTTMRKLLDRFELLEPIREIAQRGLPMFGTCAGLILMATTLVNDEPHLAVMDVTVA
FT                   RNSYGRQVDSFEVMLDIPKIGEAIPAVFIRAPHIVKVGKDVEILAEHEGKIILAQDRHL
FT                   LGCSFHPELTSDTRILEYFVASMV"
FT   gene            30638..31918
FT                   /locus_tag="Bsph_0023"
FT   CDS_pept        30638..31918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0023"
FT                   /product="Seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37665"
FT                   /db_xref="GOA:B1HS47"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HS47"
FT                   /protein_id="ACA37665.1"
FT                   /translation="MLDIKRVRDNFAEIKEMLLTRNEDLGNLDDFENLDAKRRELIAKT
FT                   EELKAERNKVSEQISVMKRNKENADEVIARMRQVGDEIKELDIQLNDVEDRFKDMMMRL
FT                   PNVPHESVPVGTTEDDNVEEYTWGEIPAFDFEIKAHWDLATDLKIVDFERGAKVTGSRF
FT                   LFYRGLGARLERALMTFMMDLHAEEHGYEEMLPPVIVNRESLTGTGQLPKFEEDVFKLA
FT                   ETDYFMIPTAEVPVTNFYRDEILTAEALPQGFAAYSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVKPEESYEQLELLTGHAEKVLQLLGLPYRKLKMCTADLGFTAAKKYDLEVW
FT                   IPAQNMYREISSCSNFEDFQARRANIRFRREPNAKPEYVHTLNGSGLAIGRTVAAILEN
FT                   YQQADGSVVIPEVLRPYMGGKEVIAPK"
FT   gene            complement(32373..32885)
FT                   /locus_tag="Bsph_0024"
FT   CDS_pept        complement(32373..32885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0024"
FT                   /product="Hypothetical yaaJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37666"
FT                   /db_xref="GOA:B1HS48"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS48"
FT                   /protein_id="ACA37666.1"
FT                   /translation="MDIFETDRLFMKQALEEAKKAAILGEVPIGAVLVYDGEIIARAHN
FT                   LRETTQNATTHAELMVIQEACQKIGSWRLEKTTLYVTLEPCPMCAGAILQSRVPRVVYG
FT                   ARDIKAGCVDSLYRILNDARFNHECEVSEGILADECGQILTDFFRALRERKKAEKKTRQ
FT                   AAMTEKN"
FT   gene            33070..33399
FT                   /gene="yozA"
FT                   /locus_tag="Bsph_0025"
FT   CDS_pept        33070..33399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yozA"
FT                   /locus_tag="Bsph_0025"
FT                   /product="YozA"
FT                   /note="Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37667"
FT                   /db_xref="GOA:B1HS49"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS49"
FT                   /protein_id="ACA37667.1"
FT                   /translation="MDEEIKITKMENSQHLDDETLFVVSQTFKALSDPTRIRILNLLCA
FT                   DEHSVNDIAEILDLGQSTVSHQLRFLKNLRLVKFRREGTTLFYSKDDDHIMNLLKQAIE
FT                   HAAHN"
FT   gene            33418..34365
FT                   /gene="czcD"
FT                   /locus_tag="Bsph_0026"
FT   CDS_pept        33418..34365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="Bsph_0026"
FT                   /product="Cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37668"
FT                   /db_xref="GOA:B1HS50"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS50"
FT                   /protein_id="ACA37668.1"
FT                   /translation="MGHNHDHGHDHTHGANKKVLIVSFIIITSYMVVEAIGGFLTNSLA
FT                   LLSDAGHMLSDSISLAIALLAFVFGEKAASYSKTYGYKRFEILAAVLNGVTLIGIALFI
FT                   FYEAIERFANPPEVATTGMLIISTIGLLVNILVAWIMMRGSDTKDNLNMRGAFLHVLSD
FT                   MLGSVGAIVAALLIMFFGWGWADPLASVIVALLVIRSGYYVTKSAIHVLMEGTPSNVDV
FT                   QEIIQLIEQTDGVESIHDLHIWTITSGTNALSCHAVVNKYLKIVDGEHILRKIEHNLEH
FT                   KGIKHVTIQLETASHPHESSILCQLKNVHEHHHE"
FT   gene            34435..34767
FT                   /locus_tag="Bsph_0027"
FT   CDS_pept        34435..34767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37669"
FT                   /db_xref="GOA:B1HS51"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS51"
FT                   /protein_id="ACA37669.1"
FT                   /translation="MEDIVKEDACHTEGATSCRKSHHPERVKKDLTTRLNRIEGQIRGI
FT                   KGMIEKDVYCDDVITQLSATQSALNSVAKILLEGHLKGCVVDRLSEGDDAVLDELVVTI
FT                   QKLMKK"
FT   gene            34802..35008
FT                   /gene="copZ"
FT                   /locus_tag="Bsph_0028"
FT   CDS_pept        34802..35008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="Bsph_0028"
FT                   /product="Copper chaperone copZ (Copper-ion-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37670"
FT                   /db_xref="GOA:B1HS52"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS52"
FT                   /protein_id="ACA37670.1"
FT                   /translation="MQNVTLNVQGMSCGHCVNAVEKNVGALTGVEQVKVNLAEGLVDVA
FT                   FDDAQVSLDQIKETIDDQGYEVK"
FT   gene            35090..37501
FT                   /locus_tag="Bsph_0029"
FT   CDS_pept        35090..37501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0029"
FT                   /product="Copper-transporting P-type ATPase copA"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37671"
FT                   /db_xref="GOA:B1HS53"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS53"
FT                   /protein_id="ACA37671.1"
FT                   /translation="MSSDHKEANLQITGMTCAACATRIEKGLNKMDGVEQATVNLALEK
FT                   SSIKYDPAKLSEADFEKKIEALGYGVVKQKTELDITGMTCAACATRIEKRLNKMSGVSS
FT                   ANVNLALEKAMIEFNPSEVNIADIIAKVEKLGYGAHQKADEQETEDHREKVIKQQQQKF
FT                   ILSAILSLPLLWTMVGHFSFTSFLYVPEFLMNPWVQMVLATPVQFIIGKQFYVGAYKAL
FT                   RNGSANMDVLVVMGTSAAYFYSVYQAIVTIGTHHGPHLYFETSAVLITLILLGKLFEAK
FT                   AKGRSSEAIKKLMGLQAKTAIVVRDGMEREVPLEEVMIGDVILVKPGEKIPVDGEVLEG
FT                   TTAVDESMLTGESLPVDKKQGDQLFGSTINKNGFIKMTATKVGRDTALAQIIKVVEDAQ
FT                   GSKAPIQRLADQISGVFVPIVVGIAIVTFIVWIIWVRPGEFTPALEVLIAVLVIACPCA
FT                   LGLATPTSIMAGSGRAAEFGILFKGGEHLEQTQSIDTVVVDKTGTVTHGKPVLTDVLLA
FT                   PDQEETHFLSLIGAAEKQSEHPLAEAIVHGIEERGIALGDVQFFEAIPGYGVQATVSGQ
FT                   GVIIGTRKLMQQYGIQLDNILPKMEELERNGKTAMLAAINGQYAGVVAVADTVKDTSKE
FT                   AIHRLQDMGITVIMMTGDNERTAQAIGTEVGVNQVIAEVLPEGKADEVKKLQAQGKNVA
FT                   MVGDGINDAPALATANIGMAIGTGTDVAMEAADITLIRGDLNSIADAILMSRKTMRNIK
FT                   QNLFWAFAYNTLGIPIAAIGLLAPWVAGAAMAFSSVSVVLNALRLQRVKL"
FT   gene            37652..38323
FT                   /locus_tag="Bsph_0030"
FT   CDS_pept        37652..38323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0030"
FT                   /product="Hypothetical yaaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37672"
FT                   /db_xref="GOA:B1HS54"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS54"
FT                   /protein_id="ACA37672.1"
FT                   /translation="MIESIEQKEELLVTVPFVTVEGPIGVGKTSLSKEIAATFNYHLLK
FT                   EIVDENPFLNKFYENIEEWSFQTEMFFLCNRYKQLTDIKKFRLAHAKPVVADYHIFKNL
FT                   IFAKRTLASTEYEKYEEIYKILTKDMPVPNVVVYLHASVETLMKRIAMRGRDFEKMISR
FT                   DYMEQLVIDYHSFIEHFEKMHPEIPVIRFNGDQLDFVKNPDDLNYVLKIIKDTLQKRSL
FT                   Q"
FT   gene            38323..38991
FT                   /locus_tag="Bsph_0031"
FT   CDS_pept        38323..38991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0031"
FT                   /product="Hypothetical yaaF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37673"
FT                   /db_xref="GOA:B1HS55"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS55"
FT                   /protein_id="ACA37673.1"
FT                   /translation="MNLREKYDIPPQTVITIAGTVGVGKSTMTKALAEALNFRTSFEKV
FT                   DTNPYLDKFYEDFEKWSFHLQVYFLAERFKEQKRIFEYGGGFIQDRSIYEDTGIFAKMH
FT                   YDKGTMSPTDYETYTNLFDAMVMTPYFPHPDLLVYLEGPIDAVIGRIQERGRAMEQQTP
FT                   NDYWIEMHERYENWINNFNSCPVLRLDINDYDLLKNPDAIESIVSRIGHMLKQTSHLRK
FT                   "
FT   gene            39081..39608
FT                   /locus_tag="Bsph_0032"
FT   CDS_pept        39081..39608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37674"
FT                   /db_xref="GOA:B1HS56"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS56"
FT                   /protein_id="ACA37674.1"
FT                   /translation="MYCGSGIGRSPVYGEKAAELGAVLAKHGHGVVYGGSKTGLMGKVA
FT                   DAVLAAGGEVIGVMPTHLQKRELAHASLTEIHFVESMHIRKAKMAELADAFIALPGGAG
FT                   TLDEYFEVFTWAQIGLHEKPVILYNVNGFYDALLQHFKIMLEEGFIRSEQKSFFRIANT
FT                   ADDILRLLKKHG"
FT   gene            39673..40581
FT                   /gene="bdlA"
FT                   /locus_tag="Bsph_0033"
FT   CDS_pept        39673..40581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bdlA"
FT                   /locus_tag="Bsph_0033"
FT                   /product="Biofilm dispersion protein bdlA (Chemotaxis
FT                   regulator bdlA)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37675"
FT                   /db_xref="GOA:B1HS57"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS57"
FT                   /protein_id="ACA37675.1"
FT                   /translation="MQGADTQVTDDLVVQAIERNIAIIRFDMDRRVAYVNELFAKTLGY
FT                   TVQELLGKNHKDFCLPNFVHSPAYEQFWRNLVAGNSYQDKIERIDANGHRVWLEATYMP
FT                   VFANHSNKVIGVSKIATNITERQNEITNVADQLKEMSNGLHQRSETGIQNSQELLSTIQ
FT                   EVSQESKENVSNLTQLQNQADSIKGIVKTIQEIAAQTNLLALNAAIEAARAGEYGRGFD
FT                   VVAKEVRKLSVRVEQSISEVKDNIEGIEREISQVTDSITKIAEKVEKTHEQITITTKDF
FT                   SEIATAAEALDEQSKQFIEII"
FT   gene            40667..41296
FT                   /locus_tag="Bsph_0034"
FT   CDS_pept        40667..41296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37676"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS58"
FT                   /protein_id="ACA37676.1"
FT                   /translation="MLWMTKVEVSFQHVPTTAISDATGGHTNLCSTIKPLADHFKIAGR
FT                   AVTVRLPDGENGAVLEAIRAANEGDILVIDAKGNTNRAVAGDFVVSLAKGVGVQGFVVD
FT                   GVIRDIAAIRELDFPVFSLGTTVAAGNKNGGGKVNVPIAIGGVTVHPGDYIIGDVDGVI
FT                   VVPQQDAEKVIEAAEEKMLKDEKRAQEAHANGKESILAYLDKVLGN"
FT   gene            complement(41342..42616)
FT                   /gene="gltT"
FT                   /locus_tag="Bsph_0035"
FT   CDS_pept        complement(41342..42616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltT"
FT                   /locus_tag="Bsph_0035"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37677"
FT                   /db_xref="GOA:B1HS59"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS59"
FT                   /protein_id="ACA37677.1"
FT                   /translation="MKKKFKISLAAQILIGLILGIIVGGIFYGNPKIETYLQPLGDIFL
FT                   HLIKMIVVPIIISTLIVGVAGTGDMKQLGRLGGKSIIYFEIITTVAILVGLLSANIFQP
FT                   GAGINMSELSQGDISKYVTTTEEVQHEGPFDIIVGIVPTNIIQSMAEGNMLAIIFFSVI
FT                   FGLGVAAVGERGKPVLDFFQGVADAMFWVTNLVMKFAPIGVFGLIGVTVSKYGFASLVP
FT                   LAKLAILVYATMLFFIFVVLGLVAKFAGISIFYLIKVLKDELILAFSTASSEAVLPRIM
FT                   LKMEKLGAPKDIVSFVIPTGYSFNLDGSTLYQAIAALFIAQMYGIHLSIGEQITLMLVL
FT                   MVTSKGIAGVPGVSFVVLLATLGTVGIPLEGLAFIAGIDRILDMGRTVVNVIGNSLASL
FT                   VMAKWEGRFDREKMKNYFNENENLA"
FT   gene            complement(42707..43585)
FT                   /gene="glnL"
FT                   /locus_tag="Bsph_0036"
FT   CDS_pept        complement(42707..43585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnL"
FT                   /locus_tag="Bsph_0036"
FT                   /product="Sensory transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37678"
FT                   /db_xref="GOA:B1HS60"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS60"
FT                   /protein_id="ACA37678.1"
FT                   /translation="MRYFIVDDDRASRVMLKQIIEDSGLGTVIGEARNGEDAIPQILMT
FT                   QPEFVLIDLLMPKLDGIATVEHLIQNRFEGQFIMISQVVNKEMVGEAYEQGIEFFIHKP
FT                   INRIEVENVLKKTTEQFRLKNSLLVIRQSLTNIELSEQKANKATSRDHIQSILNDMGIV
FT                   GEIGSEDIIAIIETLLAHQHKIAPLPPLKELYEEIAAVTKATPDEILKESKAIEQRVRR
FT                   TILAAMINLANLGVVDYTNSEFEYYAPRYFDFKEIRQLMTQIEDHDNRKAKVNIKKFIQ
FT                   VLYSDILTKVN"
FT   gene            complement(44973..45062)
FT                   /locus_tag="Bsph_tRNA85"
FT   tRNA            complement(44973..45062)
FT                   /locus_tag="Bsph_tRNA85"
FT                   /product="tRNA-Ser"
FT   gene            45697..47433
FT                   /locus_tag="Bsph_0038"
FT   CDS_pept        45697..47433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0038"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37679"
FT                   /db_xref="GOA:B1HS61"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS61"
FT                   /protein_id="ACA37679.1"
FT                   /translation="MSGQAHVKRTLQNALLANKTTHAYLFSGPRGTGKTSTAKIFAKAL
FT                   NCEHAPSEEPCNECATCLSITDGSHPDVIEFDAASNSRVEEIRDIIEKVRFAPASSRYK
FT                   VYIIDEVHMLSTSAFNALLKTLEEPPPHAVFILATTEPHKLPATIISRCQRFDFKRLST
FT                   NDIIERMKVVLEDIELPYEEQGLKVIAQSAAGGMRDALSLLDQVVSFSGEKLKLEDTLL
FT                   VTGSISQEVFYDLANALKAKDVAQMLALLEQLITDGKDPLRLSEDLITFFRDLLLLQTS
FT                   EDLAELLELVSPEERVLSLAHEFAPDMLYGYIDILAKTQQEMRFSHHTKIYLETALLKM
FT                   VQFSGGSTNQAISPTSDTVISPDLAQKIVALEQMVQQLSLQLQSGAPAQASQAPKEQRP
FT                   RAKNPNGYKAPTGRIQEVLKDATKQDVQRIKSIWAQALNQLQKSQSALLAEAEPVAASS
FT                   SAFVLKFKYDIHCQMVADNQSLKAHFTQLIAGQTGIMYEMLCIPEESWLKMREEFIRDH
FT                   SMQHKKISAASENGEELLEPPPAEISDEPFIDDAQPLASQDPLVTEAEKLFGKDFVEIM
FT                   ED"
FT   gene            47455..47769
FT                   /locus_tag="Bsph_0039"
FT   CDS_pept        47455..47769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0039"
FT                   /product="UPF0133 protein"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37680"
FT                   /db_xref="GOA:B1HS62"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HS62"
FT                   /protein_id="ACA37680.1"
FT                   /translation="MRGMGNMQGMMKKMQKMQKEMMEAQEALNAEQFEGVAGGGMVKVT
FT                   VSGQREVVSVNLDESVVDPEDIEMLQDLIVIATNEALKKVEEKTNSTMGKFTQGLNLPF
FT                   "
FT   gene            47823..48377
FT                   /gene="recR"
FT                   /locus_tag="Bsph_0040"
FT   CDS_pept        47823..48377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="Bsph_0040"
FT                   /product="Recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37681"
FT                   /db_xref="GOA:B1HS63"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS63"
FT                   /protein_id="ACA37681.1"
FT                   /translation="MKLPGIGPKTAARLAFFVLSMKEEDVLSFSKALIDAKRNLSYCSV
FT                   CGNITDVDPCHICTDKQRDHSIICVVQDTKDVIAMEKMRDYNGMYHVLQGAISPMDGIG
FT                   PEDINVASLLVRLHDESVQELILATNSTIEGEATAMYISRLVKPSGIRTTRIAHGLPVG
FT                   GDLEYADEVTLSKAMEGRREL"
FT   gene            48391..48606
FT                   /locus_tag="Bsph_0041"
FT   CDS_pept        48391..48606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37682"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS64"
FT                   /protein_id="ACA37682.1"
FT                   /translation="MFFRSKGKLKKEFDDRLVNLIKETKEDLQQAKIIEELMDDYDLGA
FT                   IAQRKAAESIHFYLFKEARIRRVLIK"
FT   gene            48680..48952
FT                   /locus_tag="Bsph_0042"
FT   CDS_pept        48680..48952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37683"
FT                   /db_xref="GOA:B1HS65"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS65"
FT                   /protein_id="ACA37683.1"
FT                   /translation="MSWLVIMSICVPVGLLFLYVIIRHAKLGKILEGLSVFWFRFAFAF
FT                   LLLFMIHLGIGYIGYNVPINLFSVLTIAVLGIPGVLGITALIFIL"
FT   gene            49243..50787
FT                   /locus_tag="Bsph_rRNA0316S"
FT   rRNA            49243..50787
FT                   /locus_tag="Bsph_rRNA0316S"
FT                   /product="16S ribosomal RNA"
FT   gene            50882..50958
FT                   /locus_tag="Bsph_tRNA5"
FT   tRNA            50882..50958
FT                   /locus_tag="Bsph_tRNA5"
FT                   /product="tRNA-Ile"
FT   gene            50971..51046
FT                   /locus_tag="Bsph_tRNA6"
FT   tRNA            50971..51046
FT                   /locus_tag="Bsph_tRNA6"
FT                   /product="tRNA-Ala"
FT   gene            51274..54186
FT                   /locus_tag="Bsph_rRNA0323S"
FT   rRNA            51274..54186
FT                   /locus_tag="Bsph_rRNA0323S"
FT                   /product="23S ribosomal RNA"
FT   gene            54378..54484
FT                   /locus_tag="Bsph_rRNA035S"
FT   rRNA            54378..54484
FT                   /locus_tag="Bsph_rRNA035S"
FT                   /product="5S ribosomal RNA"
FT   gene            54601..55041
FT                   /locus_tag="Bsph_0046"
FT   CDS_pept        54601..55041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37684"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS66"
FT                   /protein_id="ACA37684.1"
FT                   /translation="MATGLYTSEAINIQREKLESFIQNREKWAVLIPGYLHHELLNENN
FT                   MIWVFQGDFGIIQKAVKVELQMKSLEPHQVLFDLVGLSDPINGDGLFEIKQHQDESLQL
FT                   TGSLTMKASGFLSGMMNPVLEKFVPQLVEQLVRQMAVTVAKE"
FT   gene            55227..56660
FT                   /locus_tag="Bsph_0047"
FT   CDS_pept        55227..56660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0047"
FT                   /product="Hypothetical yaaO protein"
FT                   /note="Arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37685"
FT                   /db_xref="GOA:B1HS67"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS67"
FT                   /protein_id="ACA37685.1"
FT                   /translation="MFVLQKKKPIIEGLERFRQQQNISFHVPGHKHGELSHLPQAFKDV
FT                   MRYDVTELSGLDDLHYPEEMILEAEHLLADTYGAMKSFFLVGGSTVGNLAMIYATCQKG
FT                   DTIIVQRNAHKSIFHAIELVGAKPIFVSPIWDERTLTATHVTFLDLKEAVENYSEAKAV
FT                   VLTYPTYYGVTSNEIQQQITYCHEKGIPVLVDEAHGAHFQACSLFQPSALSLGADVVVQ
FT                   SAHKTLPAMTMASFMHVRSELIGADKIHHYLRMLQSSSPSYVLLASLDDARYYVQTYME
FT                   SDGAYIIEKRNQWIEALRSISSLDVIEVDDPLKLLLRVKGYSGFQLQEALEAKQVYGEL
FT                   ADRNQVLFILPLLKQGHTYPFAEIRVRIKEAVTLLLEAAKTDNIKASQTAYKFVQLTEP
FT                   VYTFDEMASLNKEWLPYMRTIGRISASMIIPYPPGIPLLVPGERITVAKLSQLEELLAA
FT                   GATFQGNHRLTEKMIQVIK"
FT   gene            56661..57308
FT                   /locus_tag="Bsph_0048"
FT   CDS_pept        56661..57308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0048"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37686"
FT                   /db_xref="GOA:B1HS68"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS68"
FT                   /protein_id="ACA37686.1"
FT                   /translation="MEAINSMNSNLFITFEGPEGAGKTTVIQKIAERLAEKNIDVLATR
FT                   EPGGIEIAEKIRTIILNPAHTAMDERTEALLYAAARSQHYFEKVRPALDAGKLVICDRF
FT                   IDSSLAYQGYARGIGIDEVLSINEFAIGKKLPDMTILFDIAPEVGLARIYATGNREVNR
FT                   LDVESLPFHQKVHEGYLLLVERYPERIRMVNADQDIDSVVEEVWSLLLKAIQ"
FT   gene            57678..57800
FT                   /locus_tag="Bsph_0049"
FT   CDS_pept        57678..57800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0049"
FT                   /product="YaaQ"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37687"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS69"
FT                   /protein_id="ACA37687.1"
FT                   /translation="MVAPVSPLGGNADSYIPYPVEVEVGGATVFVLPIEQFHHF"
FT   gene            58145..58372
FT                   /gene="yaaR"
FT                   /locus_tag="Bsph_0050"
FT   CDS_pept        58145..58372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaR"
FT                   /locus_tag="Bsph_0050"
FT                   /product="YaaR"
FT                   /note="Uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37688"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS70"
FT                   /protein_id="ACA37688.1"
FT                   /translation="MLVKRFLQETVEHGMELKQSHTWNRFGEGRRLKIIDTIDTRLVEL
FT                   AQDILDEEKEAIDLLDKIGEIKGLLINLYM"
FT   gene            58669..59673
FT                   /locus_tag="Bsph_0051"
FT   CDS_pept        58669..59673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0051"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37689"
FT                   /db_xref="GOA:B1HS71"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS71"
FT                   /protein_id="ACA37689.1"
FT                   /translation="MAKNVEELFVLQPVVMKQLQTIFDKNRLAHAYIFDGEKGTGKADI
FT                   MHFFVKLMLCEHPNENVPCETCRNCRRVDSGNHPNIHQIYPEGQFIKIDQMRELIGEMK
FT                   MMGVEEGRKIYVLHHADRLNTASANMILKFLEEPDGEVTAILITEQMQSILPTIRSRCQ
FT                   HIKFQKMPRHVLLQHLQGNNISHSMASTVSMMTNELEMAISLASDEQFALARKTVLKLV
FT                   EAIRQNVHEAMLIVHEEWLPHFKEKSEMEQALDLLLFAYRDIVSIKANPEAACTYPDML
FT                   PLFKEIALYSTYEQLSKQMESILQARASLQRNMNRTLLMEQLMLNLQEGYTFV"
FT   gene            59666..60481
FT                   /gene="yaaT"
FT                   /locus_tag="Bsph_0052"
FT   CDS_pept        59666..60481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaT"
FT                   /locus_tag="Bsph_0052"
FT                   /product="Stage 0 sporulation protein YaaT"
FT                   /note="signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37690"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS72"
FT                   /protein_id="ACA37690.1"
FT                   /translation="MYNVVGVRFKKAGKIYYFDPASFLLEDSQYVIVETARGVEYGKVV
FT                   VPQKVVGDNDVVLPLKQVLRPADDRDRIQVEENAAESKRAFELASTKIIEHNLEMKLVD
FT                   VEYTFDRNKIIFYFTAEGRVDFRDLVKDLASVFRTRIELRQIGVRDEAKLLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPSKISGLCGRLMCCLKYENDEYEEAKEGMPDL
FT                   GEVAMTPDGRGKVVGLNVLERLVQVYLQEQERTVEYTLEELLACEKNLI"
FT   gene            60500..60865
FT                   /gene="yabA"
FT                   /locus_tag="Bsph_0053"
FT   CDS_pept        60500..60865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="Bsph_0053"
FT                   /product="YabA"
FT                   /note="Initiation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37691"
FT                   /db_xref="GOA:B1HS73"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS73"
FT                   /protein_id="ACA37691.1"
FT                   /translation="MAWVKDRNFLDTVMEFEQQLEAMQEQFGALKQFVALMMEEHKALE
FT                   TENHHLRTRLEELLSNTHSVQAAEVKKESPLDIGEGYDNLARLYQEGFHVCHVHFGSSR
FT                   KGEDCLFCLSFLNKQNV"
FT   gene            60929..61678
FT                   /locus_tag="Bsph_0054"
FT   CDS_pept        60929..61678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0054"
FT                   /product="Hypothetical yabB protein"
FT                   /note="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37692"
FT                   /db_xref="GOA:B1HS74"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS74"
FT                   /protein_id="ACA37692.1"
FT                   /translation="MEKWLKDDERLDYLLAENLRIIQSPSVFSFSLDAVLLSKFVNIPY
FT                   HKGNIVDLCSGNGVIPLFLSVRTKGQITGVELQPRLLDMAERSIRYNQLENQIQMILGD
FT                   VKEIPKQLGIEKYDVVTCNPPYFLAHEASDKNLSEHHAIARHELYLTLEEAIQSASKLL
FT                   KQGGKAAFVHRPGRLLDIVTAMRANRLEPKRMQLIYPKEGKEANTLLIEGIKDGKPDLK
FT                   ILPPLYVYKNNNEYTAEVREILYGKEQ"
FT   gene            61716..61925
FT                   /locus_tag="Bsph_0055"
FT   CDS_pept        61716..61925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0055"
FT                   /product="UPF0213 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37693"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS75"
FT                   /protein_id="ACA37693.1"
FT                   /translation="MYAGYTNNVEKRVAVHNAGKGAKYTRARGPVKCIYKEEYETKEEA
FT                   MRAEYAFKQLTRTQKIMYIRRGES"
FT   gene            61922..62797
FT                   /gene="yabC"
FT                   /locus_tag="Bsph_0056"
FT   CDS_pept        61922..62797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabC"
FT                   /locus_tag="Bsph_0056"
FT                   /product="UPF0011 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37694"
FT                   /db_xref="GOA:B1HS76"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS76"
FT                   /protein_id="ACA37694.1"
FT                   /translation="MKSQKSTIHDQTGCLYLVGTPIGNLEDISVRALRILKEVDIIAAE
FT                   DTRNTRKLCNYFEIETPLMSYHEHNLAVGGEKLLTFLQEGKTIALVSDAGLPCISDPGA
FT                   DIVEKAIAQNFPVVPIPGPNAAITALIASGLTPQPFFFYGFLNRGKKERRQQLELLKKR
FT                   QETILLYEAPHRIKETLKDMEAILGNRRIVLARELTKKFEEFLRGTLAEAVEWSQAEEI
FT                   RGEFCIVIEGNQQVEEEDSEEAYWHTLSIIEHVDYIIEQTDVSSKEAIKEVAKQRQLAK
FT                   RDVYNEYHKQ"
FT   gene            complement(62984..63262)
FT                   /gene="abrB"
FT                   /locus_tag="Bsph_0057"
FT   CDS_pept        complement(62984..63262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="Bsph_0057"
FT                   /product="Transition state regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37695"
FT                   /db_xref="GOA:B1HS77"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS77"
FT                   /protein_id="ACA37695.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALKIYVDDDKIIL
FT                   KKYMPNMTCAVTGEVSDDNFRLVGGKLILSPEGAEMLVKEIQSNLKK"
FT   gene            63597..65588
FT                   /locus_tag="Bsph_0058"
FT   CDS_pept        63597..65588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0058"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37696"
FT                   /db_xref="GOA:B1HS78"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS78"
FT                   /protein_id="ACA37696.1"
FT                   /translation="MEAVLVSEQKKTFYITTPIYYPSGKFHIGTAYTTVASDAIARYKR
FT                   LRGYDVRFLTGMDEHGQKIQEKAAEAGKHPQDYVNEIAESAKKLWALMDITYDDFIQTT
FT                   QERHTKAVEKIFQKFLDNGDIYKGEYEGWYCTPCESFFTETQLVDGNCPDCGRPVHKVK
FT                   EESYFFNMKKYADRLLAYYEENLEFIEPESRKNEMINNFIKPGLEDLSVSRTSFDWGIK
FT                   VPGDAKHVIYVWVDALTNYITSLGYLSDDETLFNKYWPADVHVVGKDIVRFHTIYWPIF
FT                   LMALDLPLPKKVFAHGFIMMKDGKMSKSKGNVIYPEMLIERYGLDATRYFLLRELPFGS
FT                   DGVFSPESFIERTNFDLANDLGNLLNRTISMINKYFDGIIPSENLQSTEFDAALKEQAE
FT                   SVRIKYEESMEKMQFSVVLADLWTLVSRTNKYIDETQPWVLAKEEADKPKLGTVMRNLA
FT                   ESLHQIAVMLQPFMTTTPKRMMEQLGLDDKFLAWDTIETFGNTIPANIKVVEKGIPIFP
FT                   RLESEVEIAYIREEMRGSVKTSQEEEVNSGTKSDENPEIPEITIDDFMKIDLRVATVTA
FT                   CETVPKADKLLKLQVDLGYEQRQVVSGIAKFYSPDELIGQKVIVVANLKPVKLRGELSQ
FT                   GMILAGEKDGILKLASVDSKLENGAKVK"
FT   gene            65842..66612
FT                   /locus_tag="Bsph_0059"
FT   CDS_pept        65842..66612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0059"
FT                   /product="Putative deoxyribonuclease yabD"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37697"
FT                   /db_xref="GOA:B1HS79"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS79"
FT                   /protein_id="ACA37697.1"
FT                   /translation="MFIDTHVHLNADQYEEDLQEVINRALEAKVEKMVVIGFDRKTIER
FT                   TMELIEQFDFIYGVIGWHPVDAIDCTQEDLEWIEELAAHPKIVGIGETGLDYYWDKSPK
FT                   DVQQVIFRKQIQLAQKINLPIIIHNRDATGDVVKILREENAASVGGVMHCFSGSVETAR
FT                   ECIAMNFMISLGGPVTFINARLPKEVATEIPLEHLMIETDAPYLAPHPYRGKRNEPAFV
FT                   PLVAEEIARLKGLTIEEIAQATTDNAKIFFGIDS"
FT   gene            66853..67959
FT                   /locus_tag="Bsph_0060"
FT   CDS_pept        66853..67959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0060"
FT                   /product="Hypothetical yabE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37698"
FT                   /db_xref="GOA:B1HS80"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS80"
FT                   /protein_id="ACA37698.1"
FT                   /translation="MLYQGTKKAVKLEANGETIEVSTHAKTVEQLLQDQNIDVAEHDKI
FT                   SPSLNTKIVNGLAIQWEQAKEVTISVDGNQSKVWTTETLVKDILKEANIEVSKHDTLAQ
FT                   GLDTELGAENKIDIQRAFQLTLVDGVNKRQVWSTSTTVANFLKQQGIQLNEFDRVENNL
FT                   EDVITPASKITVVRVEKVIDVVEDSLDFAVEKKRDASLQKGKEKVVATGEKGSVSRTYE
FT                   VVKENGKVVAKNLQSEAVLKEPKKQVVAVGTKTVVASAATVSRGSAEPASGKEFYVTAT
FT                   AYTPYCNGCSGTSATGINLRSNSNLKVVAVDPSVIKLGSKVWVEGYGTAIAGDTGGAIK
FT                   GNKIDILVQTDAQARNWGRKKVRIKVLN"
FT   gene            68154..68720
FT                   /locus_tag="Bsph_0061"
FT   CDS_pept        68154..68720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0061"
FT                   /product="Hypothetical yabF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37699"
FT                   /db_xref="GOA:B1HS81"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS81"
FT                   /protein_id="ACA37699.1"
FT                   /translation="MQIKEIIVVEGKDDTTAIKRAVQADTIETNGSAISEETLKRIQHA
FT                   QEKRGVIVFTDPDYPGRRIRAIIEERVKGVKHAFLPKAKTIAKNGKGLGIEHAADDDIR
FT                   EALRLVYTPHLEEPNEDDITLEDLMTARLIGHPQSKHRRDRLGELLNIGATNGKQLHKR
FT                   LKMFQITEKQFGAAVAQLDQEENDA"
FT   gene            68713..69594
FT                   /gene="ksgA"
FT                   /locus_tag="Bsph_0062"
FT   CDS_pept        68713..69594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="Bsph_0062"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37700"
FT                   /db_xref="GOA:B1HS82"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HS82"
FT                   /protein_id="ACA37700.1"
FT                   /translation="MHKDIATPIRTQEILKKYGFSFKKSLGQNFLIDPNILRNIVSHAK
FT                   LTENSGAIEVGPGIGALTEHLARSAKKVVSFEIDQRLLPVLEDTLSPYNNVSIVHSDIL
FT                   KADVAKVIAEEMPGIEDIMVVANLPYYVTTPILMKLLNDRLPIRGFVVMMQKEVADRIT
FT                   AKPGTKEYGSLSIAIQYYVKADIAMTVPKTVFMPQPNVDSAVIRLIKHDEPPVKVINED
FT                   FLFVVTRASFVQRRKTIYNNLQAGLPNGKTQKDFILEALAAANIEPTRRGETLTIQEFG
FT                   KLADALYPVFAK"
FT   gene            69751..70011
FT                   /locus_tag="Bsph_0063"
FT   CDS_pept        69751..70011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0063"
FT                   /product="Protein veg"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37701"
FT                   /db_xref="GOA:B1HS83"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS83"
FT                   /protein_id="ACA37701.1"
FT                   /translation="MPKTLADIKKSLDCHLGKRLQLKANGGRKKTVECAGILRETYRAI
FT                   FVVELDQEDNTCKRVSYSYTDILTEAVEITFLDEAKAAVAK"
FT   gene            70145..70306
FT                   /gene="sspF"
FT                   /locus_tag="Bsph_0064"
FT   CDS_pept        70145..70306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="Bsph_0064"
FT                   /product="small acid-soluble spore protein (minor
FT                   alpha/beta-type SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37702"
FT                   /db_xref="GOA:B1HS84"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS84"
FT                   /protein_id="ACA37702.1"
FT                   /translation="MSPRLKEEIAKELGFYDVVQKEGWGGIKARDAGNMVKRAIEMAER
FT                   ASNEQERK"
FT   gene            70466..71392
FT                   /locus_tag="Bsph_0065"
FT   CDS_pept        70466..71392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0065"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37703"
FT                   /db_xref="GOA:B1HS85"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS85"
FT                   /protein_id="ACA37703.1"
FT                   /translation="MNKLVRKGIVYMCSYKGGRKMLYVKAPAKINLTLDVLYKRPDNFH
FT                   EVEMVMTTVDLADRISLESREDGVIQIISTDNFVPNDHRNFAYQAARLIKDTYGIKQGV
FT                   SITIEKEIPIAAGLAGGSSDAAATLKGLNELWNLGLSIDELAELGAKIGSDVSFCVYGG
FT                   TALATGRGEKIKEIPAPPNCWVVLAKPKIGVSTAEVYGGLKVEGLEHPNTKQMIQAIET
FT                   KDYELLCSSLGNVLETVTFKLHPEVIMLKEQMKRFGADATLMSGSGPTVFGLVDSEARV
FT                   SRIYNGLRGFCEEVYAVRILGERNTLA"
FT   gene            71449..72282
FT                   /locus_tag="Bsph_0066"
FT   CDS_pept        71449..72282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0066"
FT                   /product="Pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37704"
FT                   /db_xref="GOA:B1HS86"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HS86"
FT                   /protein_id="ACA37704.1"
FT                   /translation="MKWKRSERLVDMTYYLLEHPHQLIPLTYFSELYQSAKSSISEDLT
FT                   IVKETFEEKGIGLLMTVPGAAGGVKYIPKMSEAEVRSVIQDLKAELEHSDRLLPGGYLF
FT                   MTDLLGNPDLINRVGKVFASAFADQQIDVIMTVATKGISIAHAIARHLNVPVVVVRRDS
FT                   KVTEGSTVSINYVSGSSRRIQTMVLSKRSMKSGQRVLITDDFMKVGGTMNGMKNLLEEF
FT                   DCQLAGIAVLVEAEHADETLVDDYYSLVKLHEVNEKDRTIALSEGNYFSKRGHDK"
FT   gene            72279..72653
FT                   /gene="yabJ"
FT                   /locus_tag="Bsph_0067"
FT   CDS_pept        72279..72653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="Bsph_0067"
FT                   /product="UPF0076 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37705"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV1"
FT                   /protein_id="ACA37705.1"
FT                   /translation="MKVVATSNAPAAIGPYSQGISVNGIFYSSGQIPLTATGELVEGDI
FT                   TVQTNQVFANVKAVLEAAGTSLENVVKTTVFMKDMNDFVAMNEVYASHFGEHKPARSAV
FT                   EVARLPKDVKVEIEVIAIVK"
FT   gene            72926..73180
FT                   /gene="spoVG"
FT                   /locus_tag="Bsph_0068"
FT   CDS_pept        72926..73180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="Bsph_0068"
FT                   /product="Putative septation protein spoVG (Stage V
FT                   sporulation protein G)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37706"
FT                   /db_xref="GOA:B1HSV2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV2"
FT                   /protein_id="ACA37706.1"
FT                   /translation="MRAIASITLDNEFVVHDIRVIDGNTGLFVAMPSKRTPDGEFRDIA
FT                   HPINSDTRNKIQEIILNAYHNSSELEETDKEEELESMGV"
FT   gene            73284..73400
FT                   /locus_tag="Bsph_0069"
FT   CDS_pept        73284..73400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37707"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV3"
FT                   /protein_id="ACA37707.1"
FT                   /translation="MIKRENQQFYDILHDIRAEGAVDFGIHLFVNSTCLENR"
FT   gene            73427..74821
FT                   /gene="glmU"
FT                   /locus_tag="Bsph_0070"
FT   CDS_pept        73427..74821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="Bsph_0070"
FT                   /product="Bifunctional protein glmU"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="Includes: UDP-N-acetylglucosamine pyrophosphorylase
FT                   (N-acetylglucosamine-1-phosphate uridyltransferase);
FT                   Glucosamine-1-phosphate N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37708"
FT                   /db_xref="GOA:B1HSV4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV4"
FT                   /protein_id="ACA37708.1"
FT                   /translation="MSVLEDLQMSNIFAVILAAGQGTRMKSKLYKVLHPVCGKPMVQHV
FT                   VDHIQTLDVNRIVTVVGHGAEKVQQQLGDKSEYVLQAEQLGTAHAVQQAEGILGNEEGT
FT                   TLVVCGDTPLIRPETMQALFEHHQAKKAKATILTAIAENPTGYGRILRSENGQVEQIVE
FT                   QKDASAAQQLVKEINTGTYCFDNKLLFETLKLVKNDNAQGEYYLPDVIEILQKQGDIVE
FT                   AYVTDDFEETLGVNDRVALSQAETLMRARINEKHMRNGVTIIHPETTYISAEAVIGSDT
FT                   VIQPGCMIEGATVIGEDCNIGPNTQIADSRIGDRTTVHSSVVRESAIAEDTAIGPFAHI
FT                   RPLSDIGSHVKIGNFVEVKKSKLGNDTKVSHLSYIGDAEIGSNVNVGCGSITVNYDGKN
FT                   KFKTIIEDDVFVGCNTNLVAPVKVGKGSFIAAGSTITKEVPEDALAIARARQENKPNYV
FT                   SKLNSK"
FT   gene            74846..75805
FT                   /locus_tag="Bsph_0071"
FT   CDS_pept        74846..75805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0071"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37709"
FT                   /db_xref="GOA:B1HSV5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV5"
FT                   /protein_id="ACA37709.1"
FT                   /translation="MPYHYANSQLKIFSLNSNNPLAQEIAQEMGVELGKSSVKHFSDGE
FT                   VQISIEESIRGCDVFIVQSTSAPVNEHLMELLIMVDAVKRASARTVNVVMPYYGYARQD
FT                   RKAKAREPITAKLVANLLETAGATRVIVLDLHAPQIQGFFDILIDHLMAVPLLSDYFKS
FT                   KGIPEDEIVIVSPDHGGVTRARKMAERLKAPIAIIDKRRPKPNVAEVMNIVGNVDGKVA
FT                   ILIDDIIDTAGTITIGADALRAAGAKEVYACCSHPVLSGPAIERIENSSIKELVVTNTI
FT                   QLAEDKKSPKITELSVAKLMADAISRVYENKSVSTLFD"
FT   gene            76069..76665
FT                   /locus_tag="Bsph_0072"
FT   CDS_pept        76069..76665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0072"
FT                   /product="50S ribosomal protein L25 (General stress protein
FT                   CTC)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37710"
FT                   /db_xref="GOA:B1HSV6"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HSV6"
FT                   /protein_id="ACA37710.1"
FT                   /translation="MSTVLSVTKRETGHRSTLTQLRKGGAIPAVIYGYKLDSTPISISA
FT                   KEFKKSIQKNGQNSVFSLDLEGKKVNVVVSEVQQCSLKDEVNHVDFLAINMAEELEVDV
FT                   PIKLIGQSVGVSEGGILMQPNLELKVKVKPAELPDSIEVDISSLKVGESLTVAEIRHQT
FT                   PVEIISEDDYLLVTIVAPVSAEQEEVSASVEEEQV"
FT   gene            76767..77378
FT                   /locus_tag="Bsph_0073"
FT   CDS_pept        76767..77378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0073"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37711"
FT                   /db_xref="GOA:B1HSV7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV7"
FT                   /protein_id="ACA37711.1"
FT                   /translation="MWYGKIMTIRFERREVLMKIIVGLGNPGKPYEHTRHNIGFDVIDA
FT                   LAEKWGTPLTNSKFNGMYTTVHRPEGKVLLVKPLTYMNLSGECVGPLMDYFDIDVEDLI
FT                   VIYDDLDLETGKLRLRQKGSAGGHNGIKSLIQHLGTQEFNRIRVGISRPPAGMKVADYV
FT                   LGKFSKEDQVSMNEAIEKSVNAVEVSLSKPFLDVMNHFNK"
FT   gene            77582..77809
FT                   /locus_tag="Bsph_0074"
FT   CDS_pept        77582..77809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37712"
FT                   /db_xref="GOA:B1HSV8"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV8"
FT                   /protein_id="ACA37712.1"
FT                   /translation="MSVRYRCRHCEVEIGTLPFDADDTIRKLHIFELGEADDYVEKDQH
FT                   GHTTVHCICEQCEDSLRQYPDYHALNKWIQ"
FT   gene            77952..81461
FT                   /locus_tag="Bsph_0075"
FT   CDS_pept        77952..81461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0075"
FT                   /product="Transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37713"
FT                   /db_xref="GOA:B1HSV9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSV9"
FT                   /protein_id="ACA37713.1"
FT                   /translation="MEVLRQLVSRDKHITSFLQDIQSGQTASQLITGLTGSARPVMVDA
FT                   LFEYVKKPIYIVSPNLLQAQRMVDELAGLLGEENVHYYPADEFIAADLSVASPELRAER
FT                   IATLDCLARGEKAVYVIPVAGLRKIMQPKEHWLHYFLQTTVGDEIEVDAWLQTLVEMGY
FT                   VRNSMVTTPGEFALRGGILDIYPPYLASPIRIELFDTEVDSIRTFSADDQRSINKLQKI
FT                   RILPASEVILTKSERQTLAERLEKALGASLKKVKRQETKELLYQHIQYDIELLQQGNLP
FT                   DYVNKYGSLLYDKSAYLGDYFAQDGIVLFDELGRIQEVMDAWEREEEEWFLSLIEEGKM
FT                   VHDVKPAFTLKEIVAMLSQQKLSFSLFSRTFSGITFNKTTNFSCKPMQQFHGQMALLQS
FT                   EIERWLLGKFTVLIVARDKERVKRVQQMLEEYDIHAAIGEPTEPGIYIVDGALSSGFEL
FT                   PLQRMAIVTEDELFKQQAKKKARTQKMTNAERIKSYTEIKPGDYVVHVHHGIGKYIGVE
FT                   TLEVNGTHKDYLHIRYRADDKLYVPVEQIDLIQKYVASEDREPKLHKLGGAEWKKAKAK
FT                   VSSAVQDIADDLIKLYAKREAEKGHAFTPDNDDQRNFEAMFAYEETEDQLRSIVEVKRD
FT                   MERERPMDRLVCGDVGYGKTEVAIRAAFKAIQDGKQVAFLVPTTILAQQHYETIRERFQ
FT                   DFAINVGLLSRFRSKKEQTATLKGLKEGQVDIVIGTHRILSKDLIFQDLGLLIVDEEQR
FT                   FGVTHKEKIKQLKTNVDVLTLTATPIPRTLHMSMVGVRDLSVIETPPANRFPVQTYVME
FT                   HSGALVREAIEREMARGGQVFYLYNRVEDMARKVEEIQVLVPEARIGHAHGKMSETELE
FT                   SVILSFLEGDYDVLVTTTIIETGVDIPNVNTLIVHDADRMGLAQLYQLRGRVGRSNRVA
FT                   YAYFMYQRDKVLTDVAEQRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAQQHGFIDS
FT                   VGFDLYSQMLQEAIAERQTGVKKEEKPEIEILLSVDAYIPDVYIPDGYQKIQMYKRIKA
FT                   MDQVEEYGEIMEELEDRFGDLPIETERLLRVARMKVWGLGAGVISVKEKQKLITILLSE
FT                   QGTANVDGSKIIEESMKFERAVGFGMDGMQLKLTIDERKCGKYQPFDILEELMQIIDKA
FT                   KKL"
FT   gene            81709..82245
FT                   /locus_tag="Bsph_0076"
FT   CDS_pept        81709..82245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0076"
FT                   /product="Stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37714"
FT                   /db_xref="GOA:B1HSW0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW0"
FT                   /protein_id="ACA37714.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIYTDREGEVI
FT                   LKKYSPINDLGEFAREYVETLYETLGTPAFVTDRDEVIAVAGIGKKEYINRRITSFAEG
FT                   FMEERSTKIEKMETSIEIVPGQYEQVKSYCATPIMVNGDPIGCIIVLSKVHFVGEVEVK
FT                   VVETAANFLAKQMNS"
FT   gene            82405..84027
FT                   /locus_tag="Bsph_0077"
FT   CDS_pept        82405..84027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0077"
FT                   /product="conserved membrane-spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37715"
FT                   /db_xref="GOA:B1HSW1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW1"
FT                   /protein_id="ACA37715.1"
FT                   /translation="MSQRFGMKSYMKGAALLTIAALIVKVLSAIYRVPFQNLVGDEGFY
FT                   IYQQVYPVISIFVVWTSSGFAIAISKMLADNDCIVDTIERNEKRSMIMRVVFRYLTVLS
FT                   LLFFAVLFGGADKIAQLMGDTQLAPLIRTGSLVVLVMPALAILKGGFQSRGIMEPIAYA
FT                   QVVEQAIRVTVILTGTFVIMTTTKSLYAAGKMAVIGTVVGEIIAFVLLAYIFSKRFGLF
FT                   RVHLRLHKAKSLPIMKEVTWLSLSVSMSGLLLLGYQLVDSFTIYSLLIDHGMDSTVAKE
FT                   TKGIYDRGQPLVQLGVVIASSLSLAIVPLVAHLSKKQEGRSAIPFIQLTYKASILFGWA
FT                   ASLGLMLVMPYLNEMLFKTNALSEVLIVYVFQIVPLSIILTFTAILQGYGKLKKPALFL
FT                   MIGFVLKIILNVRLIGWLGVLGAAIANDIGLLVTAFLLIVYLKTITGIQLASKEFYKKV
FT                   GLASISMAVVVLVWLQLVSAFLGHLLSPRSVAVIAGFTAVGLGAFVMLTMIAKKRVLVE
FT                   KEWYLLPFGRRMAVYQLWLNSKK"
FT   gene            84028..85506
FT                   /locus_tag="Bsph_0078"
FT   CDS_pept        84028..85506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0078"
FT                   /product="Hypothetical yabN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37716"
FT                   /db_xref="GOA:B1HSW2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW2"
FT                   /protein_id="ACA37716.1"
FT                   /translation="MEILNTLTIIGLGAGDFNQLQMGVYKKLKAAKKLFVRTVDHPVLE
FT                   ELAAEGITFESFDKVYEKHDAFQPVYAEIAESLIAATAIEDIMYAVPGHPLVAEQTVQL
FT                   LIEAANEGTFNLVIEGGQSFLDPIFGALKIDPIEGFQLLDGTSFSMHDINMRQHILIAQ
FT                   VYDTFSASEVKLTLMEKYDDEYPVTVVTAAGSSEEKIVTVPLYELDQSVEVNNLTTVYV
FT                   PPVNSQEEALRDWTTFRTIIATLRGPNGCPWDQKQTHESLKKYLLEEAHEYLAAVDAED
FT                   DFAMIEELGDVLLQVFLHAQIGEDQGYFKLEDVLASISEKMIRRHPHVFGDVAVEDADG
FT                   VVANWEAIKAEEKGMTDKPLLDGEYRASSALQTAFNYQNRAAKVGFDWPDVEGAWDKFA
FT                   EEWQEFRHEVTNGSSISRLDELGDVLFTLVNLARFYKLSPEEAILHANEKFARRFGYVE
FT                   AQVKASGKSFADFTLDQLDRFWNEAKQLEREKEL"
FT   gene            85503..85793
FT                   /locus_tag="Bsph_0079"
FT   CDS_pept        85503..85793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0079"
FT                   /product="Hypothetical yabO protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37717"
FT                   /db_xref="GOA:B1HSW3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW3"
FT                   /protein_id="ACA37717.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRITINEKVAKASSSVKAGD
FT                   ELAIRFGQKIVTARVEEIRETVKKEDAAKMFTILKEERLEKIEPEFIDDEE"
FT   gene            85933..86232
FT                   /locus_tag="Bsph_0080"
FT   CDS_pept        85933..86232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37718"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW4"
FT                   /protein_id="ACA37718.1"
FT                   /translation="MTLHQESNRYTIPSGEHILTIRNRKRMDMTSVKSIERFDQEEFFI
FT                   KTSQGHLLIRGEELHIVHLDVDKGLLTLEGTVKTLQYDEEESGFSKGFLHKLFG"
FT   gene            86229..86720
FT                   /locus_tag="Bsph_0081"
FT   CDS_pept        86229..86720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37719"
FT                   /db_xref="GOA:B1HSW5"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW5"
FT                   /protein_id="ACA37719.1"
FT                   /translation="MIVSEQFFQLIVMVVSGIAVGFIIDSVRLIVFSTPKRSSLRKWMM
FT                   VFELLTWILLGGLTYYLLFWLKDGAWRAYDPLAQIAGIFLYQSFFQTILRFIARVLVNI
FT                   TWRPFWFIVRFIVSVIRHILQFLLNIVMIVIRPFVKIYSYLSYTFLKKLRYLKYNKKQQ
FT                   "
FT   gene            86738..87142
FT                   /locus_tag="Bsph_0082"
FT   CDS_pept        86738..87142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0082"
FT                   /product="cell division protein DivIC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37720"
FT                   /db_xref="GOA:B1HSW6"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW6"
FT                   /protein_id="ACA37720.1"
FT                   /translation="MTRRHSSNDEQQNFTKLDNDYVRNTDKAINRKQQARKRKLRRIVF
FT                   FAIVPVIIIALLLNVLSNQHETLAIKEKSKEEAKQHLSELKEEQDSLNLKIKQLQDDEY
FT                   IAKLLRKEYYLSEKGEIIFIIPDKEDKKDD"
FT   gene            87277..87714
FT                   /locus_tag="Bsph_0083"
FT   CDS_pept        87277..87714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0083"
FT                   /product="Hypothetical yabR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37721"
FT                   /db_xref="GOA:B1HSW7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW7"
FT                   /protein_id="ACA37721.1"
FT                   /translation="MSIEVGSKVQGKVTGITTFGAFVELPDGKTGLVHISEVADNYVKD
FT                   INEHLKVGDEVEVKVMNVEADGKIGLSIRKAKPQAERPERPERPARPRRDNRSNDRNDR
FT                   HQPKENFEQKMARFLKDSDERLATLKRATESKRGGRGARRG"
FT   gene            complement(87805..88056)
FT                   /locus_tag="Bsph_0084"
FT   CDS_pept        complement(87805..88056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37722"
FT                   /db_xref="GOA:B1HSW8"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW8"
FT                   /protein_id="ACA37722.1"
FT                   /translation="MSALTKAALICGSGSMIILISILINLPFVIQIMLLLCGLAVSVYG
FT                   VFLLVKMVVHPAEKVSIAPADEKVVTPIKKKKGPSSTL"
FT   gene            complement(88201..88272)
FT                   /locus_tag="Bsph_tRNA84"
FT   tRNA            complement(88201..88272)
FT                   /locus_tag="Bsph_tRNA84"
FT                   /product="tRNA-Glu"
FT   gene            complement(88278..88354)
FT                   /locus_tag="Bsph_tRNA83"
FT   tRNA            complement(88278..88354)
FT                   /locus_tag="Bsph_tRNA83"
FT                   /product="tRNA-Met"
FT   gene            complement(88364..88438)
FT                   /locus_tag="Bsph_tRNA82"
FT   tRNA            complement(88364..88438)
FT                   /locus_tag="Bsph_tRNA82"
FT                   /product="tRNA-Gly"
FT   gene            88875..91259
FT                   /locus_tag="Bsph_0085"
FT   CDS_pept        88875..91259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0085"
FT                   /product="Stage II sporulation protein E"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37723"
FT                   /db_xref="GOA:B1HSW9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSW9"
FT                   /protein_id="ACA37723.1"
FT                   /translation="MTSIDWYNTADVDDRKLGIKKKQIFIGSLFFLTSFFLAQSVVFEA
FT                   AVPFSVPFWAIIRTKYREYAKFVLFGSLAGCFFLGFGQVVILALQIIMYECIMRFRYWR
FT                   LPQSIAVSLAVLLVQFMWQGAMYQGLPPVLVQFYVGCEAALALIMTLFMQVLFVNSYEW
FT                   FTSHWTYEKLGSGLVVFAAMLTGMQAVVFSYFSLPIFLLQLFICFGALVGSVPLATVIG
FT                   AVLGTLIGVAKLSFTGMLSVATLTGLCAGMGAKGGRFGVAIGSILPSVFFLFYDATLPL
FT                   DSVYFTSIAIGSVLFLTIPRKYSDKVRDKLFPQREEVLIARQNWLTEHVTYKLEHFQHF
FT                   VQFMKELVFERFMTAPVEEAKEVSPMNTCLSCFRYDHCWGAQNNGMDKLMTDWFHMKGV
FT                   GKESAIHRVEEQMRYKCVKSTKIFEELDTELYRERINGQYFHGKKMIALQLRDMSNHLN
FT                   QLIAEMKEDTVSFVSVEKDIIERLKDAHIECFQLDVLNNKPGARKIVCALAPARVDWEK
FT                   DTTLAERMILPILYEIFNEPFEIEKVVACEIPFRHIQICFRSAISFEVEYDIYSMSKDA
FT                   TLYSGDSHALFQLHPGLFAILLSDGMGQSKEAQHESRKLIHLMRECLNYNMNPETAMHT
FT                   LHYVMSLKQQDDMYATLDFALVDLQHGDLWSWKAGGMSTYILRGKEIIKVESNAAPVGF
FT                   LSISAVEAEKRKLKAGDVILMHSDGLFSSVADWDEQEETFLAYAQQVASTNNTIQEKLT
FT                   TIMQSFQDYFEIEDDCTVLMLEVTHVVPTWAVFRPAQYSVS"
FT   gene            91297..92703
FT                   /locus_tag="Bsph_0086"
FT   CDS_pept        91297..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0086"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /EC_number="6.3.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37724"
FT                   /db_xref="GOA:B1HSX0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX0"
FT                   /protein_id="ACA37724.1"
FT                   /translation="MSFELKIKTFIEKEQLLQQGDHLLIAVSGGVDSMALLHYFVQTKE
FT                   HWNIRVEAVHVDHMLRGEASAEDRAFVQKYCDDNGVYLHATAISIPTILAKENGNIQLI
FT                   CRRERYRYFKEVLYETNANKLVTAHHADDQLESVLMALTKNATMNSMQGIRPQRNFEGK
FT                   TLIRPFLTVTKTEIGEYLLRKGLNYREDASNSKDTYVRNRFRHHVVPLLEAENPRVTEQ
FT                   VTHFTSQLQEDNAFLMTLAQDVFSKTITRSNENTYSMEIEAFQLVPLALQRRLILILLN
FT                   YLYKDSNTIQSYALLTSILKLCDTTAGYAEIHLPEDFLAVRRYGKLIIRKNSSTEDHAS
FT                   SEKIIISAANGWTTLMNGERLCVVKLHDLSSELITDTAQLFYFNASKLHLPLYIRARKD
FT                   GDRMLLKGMDQPKRLSRLFIDEKIPLNERNSWPLLISQSDEVVAVIGVRMGMFFSTTPQ
FT                   PNDDTVLIVD"
FT   gene            92771..93313
FT                   /locus_tag="Bsph_0087"
FT   CDS_pept        92771..93313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0087"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37725"
FT                   /db_xref="GOA:B1HSX1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX1"
FT                   /protein_id="ACA37725.1"
FT                   /translation="MLQNDIEKVMITEEQLQERIADLGAQLTEEYKDAFPLAVGVLKGA
FT                   MPFMTDLMKRFDSFIELDFMDVSSYGNATVSSGEVKILKDLNTSVEGRDVLIIEDIIDS
FT                   GLTLSYLVDLFKYRKAKSIKIVTLLDKPSGRKVNLSADYVGFEVPDGFVVGYGLDYAEK
FT                   YRNLPYIGILKPEVYSF"
FT   gene            93643..95619
FT                   /locus_tag="Bsph_0088"
FT   CDS_pept        93643..95619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0088"
FT                   /product="Cell division protease ftsH-like protein"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37726"
FT                   /db_xref="GOA:B1HSX2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX2"
FT                   /protein_id="ACA37726.1"
FT                   /translation="MIIGIFGTFNGGKSPTKELTYHEFQQALDKKEITSATIQPDKSVY
FT                   VVEGTLKGYEKGQSFTVNIPRDNQSLMDRIDEAAKEKNSNIKYLAAPETSGWIQFFTGI
FT                   IPFIIIIFLFFFLMSQSQGGGNKVMSFGKSKAKLYDDQKKKVRFTDVAGADEEKAELVE
FT                   VVDFLKDHRKFTEIGARIPKGILLVGPPGTGKTLLARAVAGEAGVPFFSISGSDFVEMF
FT                   VGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDG
FT                   FGANEGIIIIAATNRPDILDKALLRPGRFDRQITVGHPDVKGREAILKVHARNKPLADT
FT                   VDLAAVAQRTPGFSGADLENLLNEAALVAARKSKRTINMADIDEASDRVIAGPAKASRV
FT                   YSAKEKKLVSFHEAGHVVVGLELDEADTVHKVTIVPRGQAGGYAIMLPKEERFFTTRQE
FT                   LLDRIAGLLGGRVAEEIVLGEVSTGAHNDFQKVTSIARAMVTEYGMSENLGAMQFGSSQ
FT                   GGNVFLGRDFNSDQNYSDSIAYEIDKEMQKIIDTQYERTKRILTEKRELLDLIANTLME
FT                   KETLNAQEIEHLRDHGVLPEPEAIVEGNNTPKVEAKPTLDTIGEPVVEKELLSKDPNPT
FT                   TLDLAKEGKESNDTPKGIDEKRE"
FT   gene            95782..96615
FT                   /gene="ytbE"
FT                   /locus_tag="Bsph_0089"
FT   CDS_pept        95782..96615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbE"
FT                   /locus_tag="Bsph_0089"
FT                   /product="YtbE"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37727"
FT                   /db_xref="GOA:B1HSX3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX3"
FT                   /protein_id="ACA37727.1"
FT                   /translation="MGTVTLNNGLKMPLVGYGVFRVPEGEDLAEAVKTAIAKGYRSIDT
FT                   AQVYRNEESVGRGIRAAIEEGLVTREELFITSKVWNDGLSYDETLAAYDSSLEKIGLDY
FT                   LDLYLVHWPGIDTNYLDVYKALEKIYQDGRVRSIGVSNFHVHHLEYLLKEATVVPVINQ
FT                   IEFHPHLTQEEVRAYCTDKGIQVEAWSPLMNGALLEEALIQELASKYGKTPAQIVLRYD
FT                   VQHNVVTIPKTMTETRMIENLDIFDFALTDDEMTQLDALNDGLRCGPDPEKFNFK"
FT   gene            96779..97561
FT                   /locus_tag="Bsph_0090"
FT   CDS_pept        96779..97561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0090"
FT                   /product="Type III pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37728"
FT                   /db_xref="GOA:B1HSX4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX4"
FT                   /protein_id="ACA37728.1"
FT                   /translation="MGVSTLILVLDAGNSNIVLGVYDDKEQLAFHWRMVTDLYKTEDEY
FT                   AMQVLSFFNHAGISFEQVTGIIISSVVPPIMYSLEAMCQKYFRKKPLVVGPGVKTGLNI
FT                   KYENPREVGSDRIVNAIAALDLYKAPCIIVDFGTATTYCYLNEKGDYMGGAIAPGITIS
FT                   TEALYTQAARLPRIEIVRPAHIVGKTTVSAMQAGIFYGFVGQVEGIVNRMKGQSKEEPL
FT                   VIATGGLANLIAGETQIIDVVDPFLTLKGLYKLYKRNQ"
FT   gene            97565..98464
FT                   /locus_tag="Bsph_0091"
FT   CDS_pept        97565..98464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0091"
FT                   /product="33 kDa chaperonin (Heat shock protein 33)
FT                   (HSP33)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37729"
FT                   /db_xref="GOA:B1HSX5"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX5"
FT                   /protein_id="ACA37729.1"
FT                   /translation="MRDISFMKDYLVRGLGFNGQVRVFAARTTATVAEAQRRHDTWPVV
FT                   SAALGRSMTAAVMMGAMLKGEEKITIKIEGNGPIGPMVIDSNAHGEVRGFVTNPHVHFD
FT                   LNEQGKLDVRAGVGTEGALTIVKDLGLRDMFSGQTPIVSGEIAEDFTYYFATSEQVPSS
FT                   VGLGVLVNPDNTILAAGGFILQLMPGCEEETINEIEQHLATIEPVSKMIEKGFTPEQIL
FT                   EAVLGNGHLQILDSMPVEFKCQCSKERFGAAILGLGIAEIKEMIEEDGSADAQCHFCLE
FT                   TYHFSKEELEGFIDELKS"
FT   gene            98448..99419
FT                   /locus_tag="Bsph_0092"
FT   CDS_pept        98448..99419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0092"
FT                   /product="Hypothetical yacD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37730"
FT                   /db_xref="GOA:B1HSX6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX6"
FT                   /protein_id="ACA37730.1"
FT                   /translation="MSSNRNRRPSATATTNQTPLLQRRLKTKPALAVIAVLLLGNILWF
FT                   IGWVIPNKGQEIGSDEQVAAIDGDVITRQEWMIAMEERYGKETLQSLVNETVMEKAAKT
FT                   YKIKVTDQEIDLELALMRSAQDKFDTAMQNLTAEQLRQKIRSQLILDKVLTKDVVINEE
FT                   SIEKYYEENQGLYNTKTSYRTNFIEVDAKKAADEALGELKNGSDFSVLAREISLDSASA
FT                   SLGGDVGFLTENQENVDPAIINAVKSTKVNEVSKAFKLDNGHYGIVQVQEILEGQSFTY
FT                   DDVKEHIERELALEQLPQSVTPEAFWSEFNATWYYGESKKEK"
FT   gene            99695..100624
FT                   /locus_tag="Bsph_0093"
FT   CDS_pept        99695..100624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0093"
FT                   /product="Cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37731"
FT                   /db_xref="GOA:B1HSX7"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX7"
FT                   /protein_id="ACA37731.1"
FT                   /translation="MSRLANSIAELVGKTPIVKLNHATSENEGTVYVKLEYFNPGSSVK
FT                   DRLALAMIEAAEKDGTLQPGGTIIEPTSGNTGIGLAMIAAAKGYKAILVMPETMSLERR
FT                   NLLRAYGAELVLTPGPAGMKGAIAKAEELSAEHGYFLPQQFTNPANAVIHRLTTGPEIV
FT                   EAFDGLTLDAFVAGVGTGGTITGAGSVLKEKYPTIEIIAVEPKDSPVLSGGQPGPHKIQ
FT                   GIGAGFVPTVLDTDIYSSVFPVENEVAFEVARKVAREEGILCGISSGAAIYAAIEAAKR
FT                   LGKGSNVLAIVPSNGERYLSTPLYQFED"
FT   gene            100805..102184
FT                   /locus_tag="Bsph_0094"
FT   CDS_pept        100805..102184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0094"
FT                   /product="Para-aminobenzoate synthase component 1"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37732"
FT                   /db_xref="GOA:B1HSX8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX8"
FT                   /protein_id="ACA37732.1"
FT                   /translation="MDADSFFYSYKKQTETQHSHVFLESGRGGHFTIAAWNPLATAQAV
FT                   ENGLLVNWRNGRSEVLPGESLALLEELVADYQVSYNVELPIFQGGAIGFVTYDYARNIE
FT                   VLPNTAIDDLHIPDIFFYLFDCWAVHDVKSNTVTLMKLEDCVVDLDEWATNWQVAAQDG
FT                   LATRKFEKTNAIEVDNDESELLVSFAGTEFEAAVKKIQTYIAEGDVFQVNLSVRQSKNL
FT                   SATAMDVYEALRAFNPSPYMAYMEAPDFAVVSGSPELLVKRQGKELSTRPIAGTRPRGK
FT                   SEAEDLALAQELIDNDKERAEHVMLVDLERNDLGRVSTYGTVEVDEFMVIERYSHVMHI
FT                   VSNVRGEIAEGKTNADVIRAMFPGGTITGAPKIRTMEIIEELEPVRRGLYTGSIGWLGY
FT                   TGDMEFNIVIRTAFIKDGVAHIQAGAGIVIDSVPAREYQESLNKAKAMWQAKAMAEERA
FT                   K"
FT   gene            102181..102762
FT                   /locus_tag="Bsph_0095"
FT   CDS_pept        102181..102762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0095"
FT                   /product="Para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /EC_number="2.6.1.85"
FT                   /EC_number="4.1.3.27"
FT                   /note="Includes: Para-aminobenzoate synthase glutamine
FT                   amidotransferase component II (ADC synthase); Anthranilate
FT                   synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37733"
FT                   /db_xref="GOA:B1HSX9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSX9"
FT                   /protein_id="ACA37733.1"
FT                   /translation="MILMIDNYDSFIYNIVQYLGEFGHEIIVKRNDVLTIEDIEQLAPD
FT                   MIVISPGPCSPNEAGESLNIIRYFAGNIPILGVCLGHQAIAQVFGGQVIRAERLMHGKT
FT                   SPVLHAEVGLHKAMPNPFQATRYHSLIVEKETLPTCLEVTAWTEEGEIMGLRHKDYPIE
FT                   GVQYHPESIMTEQGKKLLRQFIEMYVEGVK"
FT   gene            102790..103602
FT                   /locus_tag="Bsph_0096"
FT   CDS_pept        102790..103602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0096"
FT                   /product="Aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37734"
FT                   /db_xref="GOA:B1HSY0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY0"
FT                   /protein_id="ACA37734.1"
FT                   /translation="MAEKDLRISPFDHGFLYGLGFFETFRTYKGQVFGWDAHMERLQQA
FT                   LSQYRIHLTYPESVLLEVVQQLNQQARGQDGYFRLNVSAGEHNIGLQPTEYTTPNVILF
FT                   RKELQDTPRGTEKTAQWLTTPRNSPEQGLRVKSHHFGNNVLGRFELPSLAEQEGFFLTE
FT                   AGYVAEGVTSNVFWVKNDILYTPSLETGILPGIVRAWVIKKANALGIEVSEGFYRKEDL
FT                   QQSTECFITNSVQELVPIINVENQQLLGNRGPVYMRLHDAFAQEVEQR"
FT   gene            103616..104470
FT                   /locus_tag="Bsph_0097"
FT   CDS_pept        103616..104470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0097"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37735"
FT                   /db_xref="GOA:B1HSY1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY1"
FT                   /protein_id="ACA37735.1"
FT                   /translation="MLEKYMKPLTINGIPLDFTKETFVMGILNVTPDSFSDGGKFNSVE
FT                   AAVAQAKKMVADGAKIIDVGGESTRPGYERISDEKEIARIVPVIQALLKEVDAIISVDT
FT                   YKANVARAAIEAGAHMINDIWGAKAEPEIAQVAADLHVPIILMHNRENLDYGVDFWASA
FT                   KADIEKSIVIAHQAGVPDHHIILDPGIGFAKNTEHNIAMMQHLEDLVEMGYPVLLATSR
FT                   KSMIGNVLKLPVDERLEGTGATVVYGIEKGCHMIRVHDVKEMARAAHMADVLVGKRLYK
FT                   EEA"
FT   gene            104470..104835
FT                   /locus_tag="Bsph_0098"
FT   CDS_pept        104470..104835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0098"
FT                   /product="Dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37736"
FT                   /db_xref="GOA:B1HSY2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY2"
FT                   /protein_id="ACA37736.1"
FT                   /translation="MDYIHLKDMQFYGYHGVLAAETTLGQRFRANVSLAVDMTMAGETD
FT                   DLAYTVNYAEVYAVCRDIVEGEPFKLIEALVVKIANVILTTYPEKVKGVRVELIKPDPP
FT                   IHGYYKEVSVEVTRGDF"
FT   gene            104835..105347
FT                   /locus_tag="Bsph_0099"
FT   CDS_pept        104835..105347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0099"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37737"
FT                   /db_xref="GOA:B1HSY3"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY3"
FT                   /protein_id="ACA37737.1"
FT                   /translation="MKDVYLSIGTNMGERYENLQKAIALLREKVNIEVVRVSSVYETAA
FT                   VGYTDQADFLNIAVHLKTDASSTEMLKICQSIEQELGRVREFRWGPRIIDLDILLYNHE
FT                   NIETENLIVPHPRMYERAFVLVPLVEITPTPFGGQLQQAHHLLQQMDCESEGISLWKPT
FT                   NEPLTVN"
FT   gene            105417..106457
FT                   /locus_tag="Bsph_0100"
FT   CDS_pept        105417..106457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0100"
FT                   /product="Probable tRNA-dihydrouridine synthase 1"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37738"
FT                   /db_xref="GOA:B1HSY4"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY4"
FT                   /protein_id="ACA37738.1"
FT                   /translation="MSQTTEKPFRIGDIVMDNRVVLAPMAGICNSAFRLTVKEFGAGLV
FT                   YAEMISDKGIVQKNEKTLGMLYIDERENPLSLQIFGGDKETLVEAAKYVDQNTTADIID
FT                   INMGCPVNKIIKCEAGARLLLDPNKVYEMVAAVVDAVKKPISVKMRIGWDDEHIFAIEN
FT                   AQAVERAGASAVAVHGRTRVQMYEGKANWDIIRQVKENVKIPVLGNGDVETPQDAKRML
FT                   ETTGVDAVMIGRAALGNPWMIYRTVQYLETGELKEEPSVREKMDVCLLHFERLLQLKGE
FT                   GIAVREMRKHASWYLKGIRGNGKARNAINQTETAAELRALLNGLVREYEESESNFFIPE
FT                   AKEFII"
FT   gene            106636..108138
FT                   /locus_tag="Bsph_0101"
FT   CDS_pept        106636..108138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0101"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37739"
FT                   /db_xref="GOA:B1HSY5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HSY5"
FT                   /protein_id="ACA37739.1"
FT                   /translation="MKQVSNIEELNDQLLVRRQKMTTILENGQDPFGSRFERTHLSTEV
FT                   KEQFADQTKEQLEENLQEVIIAGRIMTKRGKGKAGFAHIQDLGGQIQIYVRQDHVGEEA
FT                   YELFKQADLGDIVGIRGNVFRTQVGELSVKAEEFTFLTKALRPMPEKFHGLQDVEQRYR
FT                   QRYLDLMTNEDSKLTFIARSKIIRAIRNYLDNAGYLEVETPMLHTIAGGAAARPFITHH
FT                   NALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGISTRHNPEFTMIELYEAYAD
FT                   YQDIMSLTENLIAHVAQEVLGTTTVQYGEDEINLAVGWKRVHMVDAVKEATGVDFWQPM
FT                   TKEQAQALAKEHGVEVKDVHEVGHIINEFFEQKIEETLVQPTFVYGHPVEISPLAKKNP
FT                   EDERFTDRFELFIVRREHANAFTELNDPIDQRQRFEAQLAEKAAGNDEAHEMDNDFIEA
FT                   LEYGMPPTGGLGIGIDRLIMLLTNSPSIRDVLLFPTMRHITK"
FT   gene            108330..108611
FT                   /locus_tag="Bsph_0102"
FT   CDS_pept        108330..108611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37740"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY6"
FT                   /protein_id="ACA37740.1"
FT                   /translation="MNYKIINKQVFEQAQLRSVSDVPFTEEELEHGMKLVVAKKDENLT
FT                   LYLVEVDGHKKFDVRWDDSSEIFSGWYSAWDNFLWCLNIVDPQDDGLK"
FT   gene            109241..110783
FT                   /locus_tag="Bsph_rRNA0416S"
FT   rRNA            109241..110783
FT                   /locus_tag="Bsph_rRNA0416S"
FT                   /product="16S ribosomal RNA"
FT   gene            110878..110954
FT                   /locus_tag="Bsph_tRNA7"
FT   tRNA            110878..110954
FT                   /locus_tag="Bsph_tRNA7"
FT                   /product="tRNA-Ile"
FT   gene            110967..111042
FT                   /locus_tag="Bsph_tRNA8"
FT   tRNA            110967..111042
FT                   /locus_tag="Bsph_tRNA8"
FT                   /product="tRNA-Ala"
FT   gene            111270..114181
FT                   /locus_tag="Bsph_rRNA0423S"
FT   rRNA            111270..114181
FT                   /locus_tag="Bsph_rRNA0423S"
FT                   /product="23S ribosomal RNA"
FT   gene            114373..114479
FT                   /locus_tag="Bsph_rRNA045S"
FT   rRNA            114373..114479
FT                   /locus_tag="Bsph_rRNA045S"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(114523..115974)
FT                   /locus_tag="Bsph_0105"
FT   CDS_pept        complement(114523..115974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0105"
FT                   /product="amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37741"
FT                   /db_xref="GOA:B1HSY7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY7"
FT                   /protein_id="ACA37741.1"
FT                   /translation="METIVNTLVDYIWGNALVYLALGVGLYFTVLTKAVQFRYIPEMIR
FT                   LLRERKESKEGISSFQAFCMALSGRVGVGNIAGVATAIAAGGPGAVFWMGIMAFLGGAS
FT                   AFIESTLAQLYKEKADDQYRGGSPYYIEKGLRLKGFAIFVACVICLSYGVLVPGIQANT
FT                   IATSFNTAFHIPPFITGALIVILLGLIIFGGVKRIARVADKVVPIMALAYVILTLIILG
FT                   ANVSEIPGMVKLIITSAFGTNAIFGGIVGTAIAWGVRRSVFSNVAGAGEATFSSAAAEV
FT                   SHPAKQGLVQGFSIYIDTIIVCTATALMILITGMYNVTPSGTTTPLVENIPGVVAGTAY
FT                   TQAAVSTVFNDFGSGFVATAIFLFAFTTLMAYYYIAETTIVYLDNKLRLPILKLVLKMV
FT                   FLLVVYVGSVQSVSLMWGLGDIGFGSMSYLNFIAIVLLTKPAIRVLQDYDRQKKAGLDP
FT                   IFDPREVGIKNAEFWIEYSNMHKKN"
FT   gene            complement(116243..117463)
FT                   /locus_tag="Bsph_0106"
FT   CDS_pept        complement(116243..117463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0106"
FT                   /product="Opine oxidase subunit A"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37742"
FT                   /db_xref="GOA:B1HSY8"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY8"
FT                   /protein_id="ACA37742.1"
FT                   /translation="MNNKVIIIGAGPAGLAAAITLAEKNIAVLVIDEYLYAGGRLLGQL
FT                   YEEKPGTWWNGIVESERLVERAKAVHVEFLLQTSVSDLEKIGQMWVIHTTKGAFRTQHL
FT                   LLATGAAESPFPIPGWTLPGVMSVGAAQVMTNVHRVKPGKRGVIVGVNVLSSAIAMELQ
FT                   LAGVHVAAITLPPTNLLTEGYSNPLEVMTSLLHVAHMAPSPLVKIGSKLMKNDFMKKLG
FT                   ITFYPKNGVKMWDIPIMLRKAVIEIVGKNQVEGVILATVNTDGSIVKGSEQHIKADFIC
FT                   IAGGLYPLAELASLAGCPFHYIEQLGGFIPLHNEQMETNLEGLYVAGNITGIEGAKVAL
FT                   AQGEVAALTIAQHLNGGASNHDIKLAIQAVEKTRATAHIQFHPEILAGRQQMKQIWNES
FT                   VGSLSIH"
FT   gene            complement(117453..117794)
FT                   /locus_tag="Bsph_0107"
FT   CDS_pept        complement(117453..117794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0107"
FT                   /product="sarcosine oxidase alpha subunit"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37743"
FT                   /db_xref="GOA:B1HSY9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSY9"
FT                   /protein_id="ACA37743.1"
FT                   /translation="MTERIINHPVLGALTQKEKVTFTYDDHLFEGYKGESLAAALLAQG
FT                   IRTLRLHEETGQPRGIYCNIGHCFECRVNVNGLEGGRACLTPLSDGMAVKSGQTLPTTV
FT                   RDWRKNDEQ"
FT   gene            complement(117791..118060)
FT                   /locus_tag="Bsph_0108"
FT   CDS_pept        complement(117791..118060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37744"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ0"
FT                   /protein_id="ACA37744.1"
FT                   /translation="MQNKSMIVCRCEEISYDELVESASKYKCSARELKLRTRAGMGYCG
FT                   GRTCRTMVDSIAHLHHPRKNDEVSLKHQAPIRPVRFSNLGEVKS"
FT   gene            complement(118199..119884)
FT                   /gene="yqiR"
FT                   /locus_tag="Bsph_0109"
FT   CDS_pept        complement(118199..119884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiR"
FT                   /locus_tag="Bsph_0109"
FT                   /product="Putative sigma L-dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37745"
FT                   /db_xref="GOA:B1HSZ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ1"
FT                   /protein_id="ACA37745.1"
FT                   /translation="MNKILKRNFAITSTDDIVSKINDASKQYFVIENHKPYGAVRGKRK
FT                   NDVHYVACHTIQLDCPLKNAIEYMKEYEFLLVCNEEKKYLGYLRRESLAYDLAYELECG
FT                   NAYLQTILNTINESCTVINAEQNVVYWTKGAESIFSVSGENIIGKPITHFFKEDQLEIL
FT                   HTLQHRKSVYQQQHFPREDLVVMINSNPVMLHNKTIGAVVAETDITHVKKLNEELHITS
FT                   EKLLNLEKQMSTNGLAFDPFTLIRGNSPKLKEVLEKVKKVAETEANILIYGESGVGKEL
FT                   FARAVHAIREKSEAPFVAINCGAIPSGLFESEIFGYEKGAFSGAHQKGKKGKVELARGG
FT                   TLFLDEIGEMPLEMQVKILRLLQEKTFYTVGGTKEMDVEFNLVAATNRDLKQLVTEGKF
FT                   REDLYYRLNVVNFTVPPLRERASDILEISNYFLYEKSIKYNRPIQGIPTEIANALLKYH
FT                   WPGNVRELSNVIERLVVFSDEGAIHMEDLPTDILAVMPKDKAMDVKIDFPLGTELNNQL
FT                   EHYEREIILDQLAKVNGNKKTCAKNLGITRATLYNRLKKLNIDV"
FT   gene            120035..121240
FT                   /locus_tag="Bsph_0110"
FT   CDS_pept        120035..121240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0110"
FT                   /product="Glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37746"
FT                   /db_xref="GOA:B1HSZ2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ2"
FT                   /protein_id="ACA37746.1"
FT                   /translation="MNRKEEGDMKNSHHDIVIIGGGIIGGAIAYYCAKAGLDITVLEKN
FT                   ELASGTSSRCDGNILAIDKDPGFDSQMSLVSQRLVHELNRELDMSFEYRNPGSILVCES
FT                   ELEMEAAQQWVNRQQEAGLDFTMLDREDLRNESKYFADDLYGGLECKTDSTVNPYMLTF
FT                   SMFHSAEKLGAKIKKHTEVKNIKKQPDDTFSLETNEGWITANKVINACGIWAPFIGQML
FT                   SVDIPIKPRKGHILVASRQEPVGLRKVMEFGYLISKFGGERKVDADIEKYGVALVFEPT
FT                   EAQNFLIGSSREFVGFDTKVNHDVAKMIARRAVRFYPKIADMSIIRTYAGLRPWTEDHL
FT                   PIICEVEEVPGFYIAAGHEGDGISLAAVTGKLIQELLQHKDSCIPTEPVHLSRFQKGVL
FT                   HE"
FT   gene            121237..122256
FT                   /locus_tag="Bsph_0111"
FT   CDS_pept        121237..122256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0111"
FT                   /product="proline racemase"
FT                   /EC_number="5.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37747"
FT                   /db_xref="GOA:B1HSZ3"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ3"
FT                   /protein_id="ACA37747.1"
FT                   /translation="MNFQKLFTTIDTHTGGNPTRSLISGMPKLEGKTMSEKMLFMQENY
FT                   DWIRKFLMNEPRGHSVMSGVIITEPCQPEADFGVIYIETGGYLPMCGHDTIGVCTALIE
FT                   ANLIEVTTPFTNIKLDTPAGLIDVQIKVTDGVAKEVTFKNVPSFLLKTIEINDSELGVV
FT                   ECEIAYGGNFYGIIDARKINLDLAVDNSTKIINTAIRLRNAVNAVEDIVHPEYSFIHGL
FT                   THIEFYTDPVNPLADLKNTVVVPPGGIDRSPCGTGTSAKIATLYLKNKLVLNESFVYES
FT                   IVGTMFKARVLEEVTISGLTAVIPEVTGSAWIMGMHRFFYNDQDPLKEGYLMIPPMDH"
FT   gene            122269..123141
FT                   /locus_tag="Bsph_0112"
FT   CDS_pept        122269..123141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37748"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ4"
FT                   /protein_id="ACA37748.1"
FT                   /translation="MNFHKSFQTIDTQVVGEAFRIIVQSPIMLMHEDILEADHQLNTQF
FT                   EDTKQLLLNEPRGHRGMNGCLVLPSAIASYRLLFFQHAASTNFKYEALVATMTALIEQG
FT                   TIELSKNNTYSIETVKGVYEAYVKLSEKRDAVLSVHLILKPAQLEGEQVIIDNERRYIV
FT                   VEKPQQFKAIVLEELAEISTWGLLESEKYSTADGVIMYEQLNSSVRSVTFERDGYILRS
FT                   PGVDSILALIAVLGEEAVRKNDSIFGSSIEIIQKHEAGYEVALTAYITGIHQFVVDRED
FT                   PLHHGFIIV"
FT   gene            123169..124071
FT                   /locus_tag="Bsph_0113"
FT   CDS_pept        123169..124071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0113"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37749"
FT                   /db_xref="GOA:B1HSZ5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ5"
FT                   /protein_id="ACA37749.1"
FT                   /translation="MKKLEGVFPVLVTPMKNQTDIDWDGYRQNIEHFIEAGVTGIAING
FT                   STGEFVSLTKEERFKAVEVAVDQIKGRMTLIVGTAAETTAEAIIYTQQAEQAGADAALL
FT                   INSYYAHPKDEEIYVHFKSVAESVKFPIMIYNNPFTSGVDIGLETILKVGRDVPNITHI
FT                   KESSGSIGKARDIVRQGQNDIEVFCGSEDLAIESLLVGAVGWISVSGNIVPELVTKLYS
FT                   QVKEGNLEAAWAIYDRLLPLCAFLEGSGKYVQITKRAMELKGWAGGPCRLPRLPLTEEE
FT                   DAQLKAIMTNLDVLAIEHY"
FT   gene            124071..125573
FT                   /locus_tag="Bsph_0114"
FT   CDS_pept        124071..125573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0114"
FT                   /product="Aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="similar to mitochondrial Aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37750"
FT                   /db_xref="GOA:B1HSZ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ6"
FT                   /protein_id="ACA37750.1"
FT                   /translation="MEKGGRLMEAVLTLKPQIKEFLQSTIGLYIDGKYVQAQSGKTLNV
FT                   LNPANEEVIAVVSEAQAEDIDLAVHAAQQAFEGQWSMMEAAERSRIIYKLADLLEEHRE
FT                   ELAQLESLDNGKPYKAALADDVDGTVQHFRYYAGWATKITGQTVQVSKDYLNYIVHEPV
FT                   GVVGQIIPWNFPLAMAAWKLGAALAVGCTVVIKPAAETPLSLLYVGQLMKQAGFPDGVV
FT                   NIVPGTGEAGEAIVTHKGVAKVAFTGSTKTGIHVMKKAADDVKSITLELGGKSPAIVLP
FT                   DADVEEAIEGTFAGTMYNHGQNCSACTRVFVHSSLYNLFIERLAEKAKALKIGSGLDPE
FT                   TDMGPLVSQKQLNTVLDYIEKGKEEGARIVAGGDRALEKGYFVQPTIFADVQDTMIIAQ
FT                   EEIFGPVMSILSFETVDEVIVRANNSKYGLAASIWTENVKKAHYIASKLQAGTVWINDF
FT                   GLEWETMPFGGYKQSGIGREMGGEYGLSNYTEVKSVFVNMKQ"
FT   gene            complement(125643..126929)
FT                   /locus_tag="Bsph_0115"
FT   CDS_pept        complement(125643..126929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0115"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37751"
FT                   /db_xref="GOA:B1HSZ7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ7"
FT                   /protein_id="ACA37751.1"
FT                   /translation="MQLSIKQTQELQIVMSAQLRQAIELLQYSTQELEQYIREQELVNP
FT                   LIELSEPTFKEHLQISKTCGRHYNNWHLSTKCEKNIRDELFQQVRLTFDNEKDIQLLKH
FT                   IIYHLDDNGYYEQSIQSSYNDLEIEKGIHLLQTIGPLGIGARNLKECLLLQTIYGPNSP
FT                   AHADTIISNYLEELAHNNWKKISKELDISLNDLQIIYLFIQSLQPKLSSLFYQELVHTT
FT                   IPDIIVDIVDGGITFSLNDYYLPKVSIHADYFPYIKAHSSEKSYFKKHLADYHWLVNSI
FT                   EQRRNTMINIMKALIEKQRKFFLDGLDAIQPLTLREIADQIDVHESTVSRITTNKYVQT
FT                   AFGTFELKELFSSKLSTANGHSVSQIKVKSLLSDYIKSENKAKPFSDQKIAEYFNSALG
FT                   IEISRRTIAKYREDMSIPSSARRKIIPFK"
FT   gene            complement(127111..128175)
FT                   /locus_tag="Bsph_0116"
FT   CDS_pept        complement(127111..128175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0116"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37752"
FT                   /db_xref="GOA:B1HSZ8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ8"
FT                   /protein_id="ACA37752.1"
FT                   /translation="MSKLEQLRNALQAQGTSAIIITNAQNRRYLTGFTGSAGTVIVTNT
FT                   RALLLVDFRYTQQATEQSKTFEVHEIDRNRLYEMIQEILDQESIQSVGFEQHHVTYYTY
FT                   QLMANKLTATLKPLSTIVENLRMIKTPEEIEIIKKAAWISDEAFKHILTFIKPGLSEIE
FT                   IANELESHMRKNGATGAAFDMIVASGHRSALPHGVASSKVIEQGDMLTLDFGAYYQGYR
FT                   SDMTRTIAVGEPPEQLKEIYQIVYDSLQHALSNMKAGITGQNADSYTRDYITAKGYGDN
FT                   YGHGAGHGIGLDIHEDIFMSTVCEDVLEENMVLTVEPGIYLPQVGGVRIEDDVIITKDG
FT                   VEVITHSPKELIIL"
FT   gene            128314..129990
FT                   /gene="dppE"
FT                   /locus_tag="Bsph_0117"
FT   CDS_pept        128314..129990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppE"
FT                   /locus_tag="Bsph_0117"
FT                   /product="Dipeptide-binding protein dppE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37753"
FT                   /db_xref="GOA:B1HSZ9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1HSZ9"
FT                   /protein_id="ACA37753.1"
FT                   /translation="MAKKTKWLFVLLGLMLVILVGCYGKPTSGNTAKSNESDNATADGD
FT                   DNIATQELHLVATGDLTTMSSLGSVDALAVTAMNSVFEGLYRIGPENTPIPGMAESHEV
FT                   SEDGTVYTFKIRKDAVWSNGSPVTAYDFEYAWKRAINPETQAIYSYLMLDIKNAANVQT
FT                   EEDPLYGKVEEIGIKALNDDTLEVQLNAPIPYFISLTTYAPFFPLNKEFTESQGDQYAL
FT                   EADNMIYNGPFMMESWQHGQGWTFVKNESYWDKDTVKLTKITQKIVKDTATAVNLYEAG
FT                   EIDTAELSSEYVAQYKDSPEYSTFLKPNTYFIRMNHENKYLSNLNIRKAIDMAWDKQGF
FT                   ADVILQDGSIPAYYLVPQGLSTDDKGNDFRDGNGDMNKTDIELAKEAWATGLKELGVDQ
FT                   VKLEFLTYDRAESKKAAEFIKNQLETNLEGLELTINMQPNKQKLALEGAVDFDLDYGGW
FT                   GPDYQDPMTYIELFESTAYYNQSNYKNEKVDAFIKQAKTTSDVTERWELMQQAEKLMME
FT                   DVAFAPTFQKGLSRLTKPYVKNLYEHPFSADISYKWVEIVK"
FT   gene            complement(130031..130237)
FT                   /locus_tag="Bsph_0119"
FT   CDS_pept        complement(130031..130237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37754"
FT                   /db_xref="GOA:B1HT00"
FT                   /db_xref="InterPro:IPR025007"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT00"
FT                   /protein_id="ACA37754.1"
FT                   /translation="MQGGLFNGITYSFKRFFARVTKNGVYAFELDGDLEFVHAPSCNFT
FT                   YPLLLAGIIGCSTTAILSIVFYL"
FT   gene            130209..130322
FT                   /locus_tag="Bsph_0118"
FT   CDS_pept        130209..130322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37755"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT01"
FT                   /protein_id="ACA37755.1"
FT                   /translation="MIPLKSPPCTTTNEAPVIVEVSDTRKILLINVKKVIG"
FT   gene            complement(130393..132384)
FT                   /locus_tag="Bsph_0120"
FT   CDS_pept        complement(130393..132384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0120"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37756"
FT                   /db_xref="GOA:B1HT02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT02"
FT                   /protein_id="ACA37756.1"
FT                   /translation="MKKILEVKNLSVSFNTYNGEVQAVRNISFDLFEGEILAVVGESGS
FT                   GKSVTSKSLLRLNPTESTMVKSGHIFYNGHDILSSSEQEIRAIRGAEIAMIFQDPMTAL
FT                   NPTMTIGHQIAESIKKHTTLRGKQITNRVIELLQLVGIKEADKRYKQYPHQFSGGMRQR
FT                   IVIAMALACEPRIIIADEPTTALDVSIQAQILELLKNIQQNMNLSIIFITHDLGVVAKM
FT                   ANRVAVMYAGKIIEIGLVDEIFYHCQHPYTQGLLAAMPNPDMGTNSLYAIPGTPPNLLH
FT                   PPTGDAFAARNKHALKIDFIEEPPMFQVSDTHFAATWLLHKHAPKIVPVHQHLAQVQQE
FT                   KRNASAILDKEHPYLSLKEVKQHFSLGKNSVNKAVDGITFDIYKGEIFGLVGESGCGKS
FT                   TTGRSIIGLHSITSGEILVDGRNINDNQTKKDKLTFNSKVQMIFQDPYSSLNPRMKIMD
FT                   IIAEGLAIHEVPKSEWKPKIYELLNIVGLTKEYANRYPHELSGGQRQRIGIARALAVEP
FT                   ELIIADEPISALDVSIQAQIVNLLKQLQKERGLTYLFIAHDLSMVKYISDRIGVMYQGK
FT                   IVELANSQELYDYPVHPYTKSLLSAIPLPDPKLERDRKRIIFNEVTYQANRNTESESFV
FT                   EIRPGHFVMLTEEELIHYRSAQEGGILL"
FT   gene            complement(132398..133429)
FT                   /gene="dppC"
FT                   /locus_tag="Bsph_0121"
FT   CDS_pept        complement(132398..133429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="Bsph_0121"
FT                   /product="Dipeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37757"
FT                   /db_xref="GOA:B1HT03"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT03"
FT                   /protein_id="ACA37757.1"
FT                   /translation="MTSKLTDSTTKSHPKELFEYAPETDITDDFTYRPEQSFWQDAWRG
FT                   LRKNKAAIIGLCTIIVVLLLAIFGPFMNSHGYDEQNIARTNLPPKIPILENISFLGLNG
FT                   VDSRGIDQYEAKGIGEYFWFGTDELGRDLWTRIWEGTRISLYIAFLAATIDLIIGVAYG
FT                   AVSAFYGGRADNIMQRIIEVLVGIPGLIVNILLILILKPGIISITIAMVIVGWISMARI
FT                   VRAQILKLKSYEYVLASRTLGASNQRLIWKHLIPNTLGPIIVATTFTIPGAIFTEALLS
FT                   FIGLGLQPPTASLGTIVNDSYKLLRIYPHGMIISSIVISLIMISFNLLGDGLRDAFDPK
FT                   TRK"
FT   gene            complement(133426..134322)
FT                   /locus_tag="Bsph_0122"
FT   CDS_pept        complement(133426..134322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0122"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37758"
FT                   /db_xref="GOA:B1HT04"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT04"
FT                   /protein_id="ACA37758.1"
FT                   /translation="MIITLFIIILLSFLLMKALPGSPFNDERLPETQKELLYKKYGLDK
FT                   PVPVQFGIYLTNLVQGDLGVSFVFDNRPVTKIIKERIGASAILGFQAIIVGTIIGLLLG
FT                   IIAALRHNTIIDYSATILAVLGISIPSFVFAGFLQYWVGVKLGWLPIAFWNGFEYSILP
FT                   TIALAVGVVATIARFTRMEMLEVLSQEYILTSKAKGLSKPIIITKHGIRNAMIPIVTII
FT                   GPLTVNTITGSLVIEKIFSIPGLGEQFVNSIITNDYQLIMGTTIFYAVLFVTIVLIIDI
FT                   LYGLIDPRIRVTGGDNT"
FT   gene            134505..134580
FT                   /locus_tag="Bsph_tRNA9"
FT   tRNA            134505..134580
FT                   /locus_tag="Bsph_tRNA9"
FT                   /product="tRNA-Asp"
FT   gene            135052..135390
FT                   /locus_tag="Bsph_0123"
FT   CDS_pept        135052..135390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37759"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT05"
FT                   /protein_id="ACA37759.1"
FT                   /translation="MSKDQFLKYFYLPLLIGSMLMMVGCGDPIIEIEEANTYHWQKNMN
FT                   EVEFEKLKNDMSYIEVVETAGGAGKKVKNNEYRWNDETLLTQAYIVKFKDDKLIAKEIV
FT                   AVKGHSNR"
FT   gene            135665..136114
FT                   /gene="ydiB"
FT                   /locus_tag="Bsph_0124"
FT   CDS_pept        135665..136114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiB"
FT                   /locus_tag="Bsph_0124"
FT                   /product="UPF0079 ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37760"
FT                   /db_xref="GOA:B1HT06"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT06"
FT                   /protein_id="ACA37760.1"
FT                   /translation="MYEIIMNSLDDTERFASKLANKLEAQDTITLEGDLGAGKTTFTKA
FT                   LAKELGVKRTVNSPTFTIIKQYEGRLPFNHLDVYRLAESDEDLGWDELFYGDAVSVVEW
FT                   AHLIEQDLPQDRLAIEIYRIGENERRFVLIPRGERYEALCEELMK"
FT   gene            136111..136818
FT                   /gene="ydiC"
FT                   /locus_tag="Bsph_0125"
FT   CDS_pept        136111..136818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydiC"
FT                   /locus_tag="Bsph_0125"
FT                   /product="YdiC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37761"
FT                   /db_xref="GOA:B1HT07"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT07"
FT                   /protein_id="ACA37761.1"
FT                   /translation="MIWFGIETANTPLSIAVIKDGKIVAEMVQNIKLTHSAGAMPAIEE
FT                   ILARIDVKPNDLDAIAVSEGPGSYTGVRIGVTLAKTLAWTLQKPLVGVSSLKALAANAA
FT                   LYNGLVCPIFDARRRNVYTAVYQGETLEALVEDHHAHIDDVLVRLKALEQPILFVGTDV
FT                   DIFWENIVQMLGDYAVRAPFSIDLPRATEVIHIATKMELPSVEATHHFVPQYKRIAEAE
FT                   ANWLKEQKEKEHD"
FT   gene            136838..137263
FT                   /locus_tag="Bsph_0126"
FT   CDS_pept        136838..137263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0126"
FT                   /product="ribosomal protein (S18)-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37762"
FT                   /db_xref="GOA:B1HT08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT08"
FT                   /protein_id="ACA37762.1"
FT                   /translation="MVSDDVPAVYEIELASFPVPWTLDSFYYEVHENQYAHYVLALDEN
FT                   GSIIGFCGMWMVIDAAQITNVAVIEQARGRGIGEGLMREAMHIARLHGMEVMTLEVRVT
FT                   NTVAQNLYRKLHFQDGGIRKGYYTDNGEDALVMWVNL"
FT   gene            137263..138279
FT                   /locus_tag="Bsph_0127"
FT   CDS_pept        137263..138279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0127"
FT                   /product="Probable O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37763"
FT                   /db_xref="GOA:B1HT09"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT09"
FT                   /protein_id="ACA37763.1"
FT                   /translation="MNNGLILAIESSCDETAAAIIRNGHEIVSNVVASQIESHKRFGGV
FT                   VPEIASRHHVEQITVVIEEALAQANIKPADLDAVAVTEGPGLVGALLIGINAAKAFAFA
FT                   NNLPIIGVHHIAGHIYANALVQPMEFPLLALVVSGGHTELVYMKEHGSFEVIGETRDDA
FT                   AGEAYDKVARVLNLPYPGGPRIDQLAHEGEEAVPFPRVWLEEGSYDFSFSGLKSAVINY
FT                   KHNMDQRGEAISPAGVAKGFQESVVEVLTAKTLRAAREYQVKQVIAAGGVAANKGLRAS
FT                   LEAVFTEEGIPFFVPPLKLCTDNAAMIGAVAMPMYEAGIRGNLTMNGRPGMELKSWV"
FT   gene            complement(138725..140668)
FT                   /locus_tag="Bsph_0128"
FT   CDS_pept        complement(138725..140668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0128"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37764"
FT                   /db_xref="GOA:B1HT10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT10"
FT                   /protein_id="ACA37764.1"
FT                   /translation="MIVLQVNQLTKSFLADEILSGVKLEVQHRDRVALVGRNGAGKSTL
FT                   LKIIAGQMSYDSGDIIIPKGIQVGYLEQHAGLNSTLTIWDEMMTIFEPLLAQEQTLRSL
FT                   EQQMADSTVYENPTLYAKVMSEYDQLQHTFKDAGGYQYESDMRSVLHGMQFYPEDYDKP
FT                   ISSLSGGQRTRLALAKLLLSKPDLLILDEPTNHLDIETLSWLESYLKSYEGAILIVSHD
FT                   RYFLDQVVSIVYEVSRHRVTKYTGNYSAYLDVKAKNYERDVKLFERQQDEKAKLEDFIQ
FT                   KNIARASTTKMAQSRRKMLERTEWMESPDGDEKSASFGFTIERQSGNDVLSVDDLTIGY
FT                   GDQRISSGIKLRTFREDRIALVGPNGVGKSTLLKTIVKDLTPLAGDIRYGTNVQIGYYD
FT                   QEQAKLSSNKSVSKELWDEWPLMNEKDIRTVLGRFLFSGEDVDKVVSSLSGGEKARLAL
FT                   SKLMMQKAHFVILDEPTNHLDLDSKEVLENALIDYPGTLLFVSHDRYFINRIATKVVEL
FT                   SGTGSFEYLGDYDYYVEKKQELFELAQMKSASQPQLQQALPDKTSTSKIDKEAKKRERQ
FT                   IRRAIEELEGKMQETTTIIDRLEEALCDPAIFTDHEKIAQLQGELATAKEKHELLELEW
FT                   LELNEELEHINM"
FT   gene            140922..141557
FT                   /locus_tag="Bsph_0129"
FT   CDS_pept        140922..141557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0129"
FT                   /product="Redox-sensing transcriptional repressor rex"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37765"
FT                   /db_xref="GOA:B1HT11"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HT11"
FT                   /protein_id="ACA37765.1"
FT                   /translation="MKQELKIPQATTKRLPLYYRFIQNFAQEGMERISSKELSEAMKID
FT                   SATIRRDFSYFGALGKKGYGYDVQHLLQFFSQTLDQHETTKVALIGVGNLGSALLKYNF
FT                   QKNHNTHIVVAFDSKAPKDGKMISNIPVFHPDLLEEKYAEYGAELAILTVSPRSAQKMA
FT                   DRLAAMNAKGILNFTPERLTVPDSMQLLTIDLSVELQALIYLIRNQEV"
FT   gene            141714..141908
FT                   /locus_tag="Bsph_0130"
FT   CDS_pept        141714..141908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0130"
FT                   /product="putative sec-independent protein translocase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37766"
FT                   /db_xref="GOA:B1HT12"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT12"
FT                   /protein_id="ACA37766.1"
FT                   /translation="MAVMGGIGPMSLIIIGIVALLIFGPKKLPELGKAFGSTLREFKNA
FT                   TKGLADEDDDDKKKKELDK"
FT   gene            141926..142750
FT                   /locus_tag="Bsph_0131"
FT   CDS_pept        141926..142750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0131"
FT                   /product="Sec-independent protein translocase protein
FT                   tatCy"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37767"
FT                   /db_xref="GOA:B1HT13"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT13"
FT                   /protein_id="ACA37767.1"
FT                   /translation="MNPKDLTVIEHIEELRKRLFIVAVFFVLAMAGAFFVAKPLVKYLQ
FT                   TTGAKYNIELHAFDVVTPLAIYIQVVFLIAFILSSPVLMYQLWSFISPGLREVERRATL
FT                   SYIPYSFLLFIAGLSFSYFLLFPYVIKFMMNLSNDLDIQQTIGIHEYFTFLFKLTIPFG
FT                   FLFQLPIVVLFFSRIGILSPDLLIRIRKYSYFGLFVCAALIAPPELASHLMVSVPLFIL
FT                   YEISIMISRVGYRKYLKSEEIRLKEEQEAEQKRQIEEALEQQRRQIEELNNQ"
FT   gene            complement(142826..143455)
FT                   /locus_tag="Bsph_0132"
FT   CDS_pept        complement(142826..143455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0132"
FT                   /product="Abi, CAAX amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37768"
FT                   /db_xref="GOA:B1HT14"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT14"
FT                   /protein_id="ACA37768.1"
FT                   /translation="MKMTDLTSEQAAPITQGWYIALSFAIALILSLILTSRDKTFWNVY
FT                   QGKKETIPLTIIWGILGFILVFFGQMIGAAIEMAVFGIEGGSQNTADIVAIAKGAPIAI
FT                   LAIVVFGPILEEFVFRRVIFGSLVQTTNFWVAAIVSAIFFAIIHFDFSHILLYTICGLI
FT                   FAFLYHKTKRIWTSIIAHVMLNGFVTLVQFYAEPLQKFLQELEKMQ"
FT   gene            144172..145806
FT                   /locus_tag="Bsph_0133"
FT   CDS_pept        144172..145806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0133"
FT                   /product="60 kDa chaperonin (Protein Cpn60) (groEL
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37769"
FT                   /db_xref="GOA:B1HT15"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HT15"
FT                   /protein_id="ACA37769.1"
FT                   /translation="MAKDIKFSEDARSLMLQGVDKLANAVKITLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELENPYENMGAKLVAEVASKTNEIAGDGTTTATVLAQAIIREGLK
FT                   NVTAGANPVGIRKGIDKAVAAALTELHTISRPVSNKDEIAQVAAISAADDEVGQLIAEA
FT                   MERVGNDGVITIEESKGFTTELDVVEGMQFDRGYASHYMVTDTDKMEAVLDNPYILITD
FT                   KKITNIQEVLPLLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPGFGD
FT                   RRKAMLEDIAILTGGQVITEELGLDLKSADISSLGRAAKVVVTKDNTTIVEGVGGADAI
FT                   EARIGQIRAQLAETTSEFDKEKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVSGGGTALLNVYAAVEKVSESEEGDVATGVKIVLRALEEPVRQIANNAG
FT                   LEGSIIVDRLKREEIGIGFNAATGEWVNMMEAGVVDPAKVTRSALQNAASVAALFLTTE
FT                   AVVADIPEPAGAGMPDMSGMGGMPGMM"
FT   gene            146151..147092
FT                   /gene="fecD"
FT                   /locus_tag="Bsph_0134"
FT   CDS_pept        146151..147092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecD"
FT                   /locus_tag="Bsph_0134"
FT                   /product="iron(III) dicitrate transport system permease
FT                   protein fecD"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37770"
FT                   /db_xref="GOA:B1HT16"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT16"
FT                   /protein_id="ACA37770.1"
FT                   /translation="MDILLHAVSNGRFGTLDSVDSESYLNIILQVRMPRVIFALLIGIG
FT                   LALCGAVMQAVVQNPLADPYILGISSGASLGATFAILVGFGSSALLAQFGVAFGAFAGA
FT                   MLTSMAVLILSSIGGKATSVKLVLSGVVIGALCSSFSSLIIFFANNAEGIKTVTFWSMG
FT                   SLASASWDKTPILAIVIVLGAALFLFQHRVLNTMLLGDESAITLGINLSVYRKLYMILT
FT                   SLITGTMVAYAGMIGFVGLIIPHITRGIFGADHKRLMLGTLLLGGLFMIWADILSRTLI
FT                   ENVELPIGIITSVIGSPLFIYMIVKKGYNFGG"
FT   gene            147097..147858
FT                   /gene="fecE"
FT                   /locus_tag="Bsph_0135"
FT   CDS_pept        147097..147858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecE"
FT                   /locus_tag="Bsph_0135"
FT                   /product="putative hemin transport system ATP-binding
FT                   protein fecE"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37771"
FT                   /db_xref="GOA:B1HT17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT17"
FT                   /protein_id="ACA37771.1"
FT                   /translation="MELVAKEIEVKIGKKEIVKNISIHVNKQQFVGLIGPNGCGKSTLL
FT                   KSIYKSLVPQKGMVFLDDLDVLKSPEKKISQHLGVVGQFNEMHFDLTVQQMVMLGRTPH
FT                   KKMLESDNQKDFDIVEEALTRTNLQAYKGRSFLSLSGGEKQRVILARTIAQQPKFMILD
FT                   EPTNHLDIRYQIEILSCVRSLNIGVLAALHDLEMAAHYCDYLYAVKDGEIYAHGTPEQV
FT                   LTPEIIEALYHIKCQTFTNPVTNGLGFAYGL"
FT   gene            147872..148882
FT                   /locus_tag="Bsph_0136"
FT   CDS_pept        147872..148882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0136"
FT                   /product="probable ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37772"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT18"
FT                   /protein_id="ACA37772.1"
FT                   /translation="MKKKLLLGIGLAAVLTLTACGNTTKNTSEEAQTKEHYPLTIENFT
FT                   KAEGGSTWEKKDQVFDKAPEKIMANTRPAAELLLHLGLGDKIVGVGANFGAVDKSVEEA
FT                   YSKLNILSDEYVGKEVTLGTNPDLVFGRGGLFDNAEWGVGTVDSLNDMGIKTFVLESSI
FT                   TGGTYDSIYKDIENIGEIFNVQDKATSFIKELKDRQQDITSKLESIKEEKSFAYLHTND
FT                   PKELFVYPAHDETFFNDAFKMVKLDNIFKDETGDVSVETLIASDPDVLILPNWDGSDLT
FT                   KVREEIYANPKLSSMKAIKNKQIYIVDYNYMFGYGYNTIDGMEALAKEMYPDLFK"
FT   gene            complement(148982..149638)
FT                   /locus_tag="Bsph_0137"
FT   CDS_pept        complement(148982..149638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0137"
FT                   /product="putative phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37773"
FT                   /db_xref="GOA:B1HT19"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT19"
FT                   /protein_id="ACA37773.1"
FT                   /translation="MSTNDIQLFALPLGEPLTSAEWNVFHNVLPSHVQRNIQQYKQWQD
FT                   RQRALLGNTLIRWVLLPFMDKTTFQITQDIYGRPNVASHQHWKGDFNLSHSGDWIVLAL
FT                   TTNGRVGIDVEEIKPVNKDIMHFALSKQEFHMALHQPLHVFYELWTLKEALFKTGLFPH
FT                   LSPHMLDTIDIKKTRADLSTQLHYLDQRHPVTICWNNGSTHVKITTLNKHQLLQS"
FT   gene            complement(149635..152802)
FT                   /locus_tag="Bsph_0138"
FT   CDS_pept        complement(149635..152802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0138"
FT                   /product="peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37774"
FT                   /db_xref="GOA:B1HT20"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT20"
FT                   /protein_id="ACA37774.1"
FT                   /translation="MNNKREFDCPTSQFNKHFSKQEKLLSNHTQLLNEEDTLAYQTLNR
FT                   TMADYDKTITIPEVFYQVAQQFADRIALSYEDGKMTYRQLNEQSNQVAHMLLANGLQKG
FT                   DYVAIIMDRSKETIISLLGVLKAGGVYVPIDPSYPKERCQYLLHDTGAPFIITKNEYSD
FT                   LLNDLIHNKFQSHTVLTINQMESGLSKEDLPCNLHPSDLAYIIYTSGSTGKPKGVLLKH
FT                   TAVINLITDNQRIYHSTEEGVFSQFISYSFDPSVTETFTAFFSGARLHMLTSIERLSIE
FT                   AFADMIARERVTTATVPNAFFTQLATHLPVEYRDKLMTLQYLSVGGEALLPAIVQKWQE
FT                   KFGYSTEIINVYGPTECTVLTSYFKIKSQLTDMQSSIPIGKPIANYEMYVVNEDEQLCP
FT                   VHVTGELCIAGVGLAAGYLHQPEKTAEVFVPHLFKPDQKMYRTGDLVRLLPNGVIEFVG
FT                   RKDSQIKVRGFRIELGEIETVLSNYPTIQESVVIAKKMSDGQNHLFAYYTVASGIQLEE
FT                   RNLRDYLHNLLPDYMVPERFIELLEMPLSPTGKIDRTQLASMDTHLSRSNLYVAPENDT
FT                   QHLLANAWEYVLNVSPIGIHDNFFHIGGHSLKVLEILVQVKKHIPFLKIQDFFQYQTIA
FT                   ELDQYICNHQPEDLDVQTQPTNLVYKDLMEPGPLPISPIVKPLPMTTVLLTGATGYLGS
FT                   HVLYELLVSTKAHIYCLIRPSEKSTLEDKLMESMQFYFGHNIGRHMQNRVTIIKGDLGK
FT                   KKLHLTSEDEQTLIDEIDAIIHCGADVRHFGATEHFNNVNVNGTRYLLELAERKPGIHF
FT                   HYVSTIGIPEELAAIQWGAEEANGDFNYDTKLHNVYTQSKLEAENLVRNAVHDMIPISI
FT                   YRVGNLSCHSETGKFQRNIDDNAFYRMIKAMLYLGKTPSVQWHVDFTPINYASQALVCL
FT                   ANQPASNGHVFHLCNPVSLTYLELIDMLKEFGYDLQVMSKQEYTNWLLHDDHSIEVQEY
FT                   LALAIAQLEGDGASDSPFIFNCKKTIEFLANARIECAAPNTAFIHQMIEYGIETGYFPE
FT                   PTQVNIR"
FT   gene            complement(152934..154682)
FT                   /gene="tlpC"
FT                   /locus_tag="Bsph_0139"
FT   CDS_pept        complement(152934..154682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /locus_tag="Bsph_0139"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37775"
FT                   /db_xref="GOA:B1HT21"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT21"
FT                   /protein_id="ACA37775.1"
FT                   /translation="MKKRKKQHMSISKKITAIMVSILLLFGLVTLGLSYYIVRNSNLTD
FT                   MNQSLDDKGMILAKTIDVNTLKSILDNPSDSNPDALRLTKEMDAINDYSDSITNLFLIT
FT                   VNGENINAPVLSSSILKLGAEYNQDMIAMGLSPDFLARIKEVFETKEATATDIYSDEFG
FT                   SYKTGLTPILDDDGNMLAAYAIDYDVSMVTGKAMSEALWTLVVTVIFLIGSSIAVYTLL
FT                   RKKLTPIQQLSLQSKKVANGNLELEPLPVTSTDEVGTLTQNFNSMIENLKTVIKSTTNV
FT                   SARVSNTANILSTNMQETSDSYNTVASSMQEIASSADLQVQRAKESTITIEEMSIGIQR
FT                   IAMTSNQISESSILASEEAERGNDSTNKSVAQMNAISQAVNQSAASVKLLGDHSNKIEE
FT                   IVGIITGIASQTNLLALNAAIEAARAGEAGSGFAVVADEVRKLAEQSEASAREISTLIS
FT                   HIQHDTNESVNIMVRAVEEVDHGIVMINDSEQSFSQILTSIHHVTGQIQELSATIEEMA
FT                   AGMEQVTSAVKDMEDFSINSKDSTRAVAATSASQLNTVQQVSEEAQVLSELSEELLNVV
FT                   NTFVVK"
FT   gene            complement(155239..155700)
FT                   /locus_tag="Bsph_0140"
FT   CDS_pept        complement(155239..155700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37776"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT22"
FT                   /protein_id="ACA37776.1"
FT                   /translation="MAPEDFNSQFRPGMKIWVTLPTGTYSGTLIRTFGTGGRTAEIQLD
FT                   NGQIVTVDVSQITAAGTGAPPGNSYPPPYPPPYPTPYPPQPYPPRPYPPQPYPPRPYPP
FT                   RPYPPQPYPPQPPRPYPPFPGGQFPGFPPPLLPGLPNIMPGIIGNPRQP"
FT   gene            155867..157204
FT                   /locus_tag="Bsph_0141"
FT   CDS_pept        155867..157204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37777"
FT                   /db_xref="GOA:B1HT23"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT23"
FT                   /protein_id="ACA37777.1"
FT                   /translation="MAIIKVKKINIKNLRNVRHGEIILAVNFETFLKANVVGLYGQNGS
FT                   GKTTIVDAFGLLKTLISGWLAEVKLPSQEKRLILAGEDTASLDFEFLVENQFGTFFVHY
FT                   YVELQEDQHRLYTTLERLTYRENDKGKRSKVLMAMTENGIQIRNSHLPDMSEQARIQLL
FT                   VIQQLARKEYRSFLFHKDLKPLLQERLTEQEIQLLQNMAVDFNRDLHVVNNQNIAPLFE
FT                   ERIMPFSIHLEKTRGQIPYDLKGPALLPEDEFYALCEVIEQSNRVLAAIIPGLTIKINI
FT                   ITKQTMDDGGQGIRFEFLSQRGEQELPLRTESEGILKIISVLSVLIAVYNNPNACVVID
FT                   ELDSGVFEYLLGELLTVIDEDGKGQLFFTSHNLRVLEVLAIKNLWFTTTNENHRYMQLK
FT                   GIKEVNNARDVYLRAIQLGGQDEEVYKETKTFKIKRAFRKAGVHHD"
FT   gene            157197..157928
FT                   /locus_tag="Bsph_0142"
FT   CDS_pept        157197..157928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37778"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT24"
FT                   /protein_id="ACA37778.1"
FT                   /translation="MTKKVLLIIVEGQTEQIILEDYLDAYFENATIRFDVQREDVLTKW
FT                   DAHKRIPNIKNSVIRVIQSYLEKYKFLAKDLTAVVHITDADGCFIAPECVQVDEKIEQK
FT                   LFYTEEAILVKSNKRKEQIEQRNEMKARNVRILIANDHFSINRLKVPYQLFYFSTNLEH
FT                   VLWDERNEIPTEKIHKADEFIENLSGTIEDYLKAYLPVDTELPYREKMKKSWSYLMEGS
FT                   HSLQRGTNVPLLFEMIKTDVQ"
FT   gene            complement(157973..163057)
FT                   /locus_tag="Bsph_0143"
FT   CDS_pept        complement(157973..163057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37779"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT25"
FT                   /protein_id="ACA37779.1"
FT                   /translation="MTLSHEQKTHFQSIVDTAPSTIQPLAAALLKYMDNRNYDIEQLIT
FT                   EQHVQSLEELFSGPLLEVLTLFSSQERASHIKKLALRFDATIFQTDSLRRSFRSASSVQ
FT                   DHLFQCLQLIEEMLTFEEIGLQDLLAHHSQYEHGTYPNYSSYVLKNENEKVMSFHVFEQ
FT                   LLAEELSLENPIIEEKIESILFDEHRSSFFGHPLIRGIFKSSNSRMHEALGKLLVAAAR
FT                   QEGLRQAIVENIDHGNLDAQLKMMKLIQEHQLTRFSSVIRAVDTWMGLGYSSFENQKIT
FT                   EEVLSLAIQAMEDDHFTEQLLKSERTIDIYVALWATSTKDYTKLELLLADLLKRDKHIQ
FT                   LTTLAFLKNLSKISFTAPFVKELILTTKDIELFAFAWNNFIHANHYINSEYARDNEWEK
FT                   TLQGFMKENSQLQGIEYPLFEQLEWAKNEMTKDGLSITGKPLSFVFVHLSFEDLISTQI
FT                   ILAHYLQDEELFQRIIARSDAYPPSSRIGLLNIYCLDPITQGQREFLFNSLRDRSSINR
FT                   SLALKKIHALTPTQEEIAKIEDLLANKSGALRKEAISLLKVQPQDHVLQSAERLIKDNK
FT                   QLKRLGGLELLLEASKDYNLANEQITALCSLLPKITKNEQVFLEQLVARDVPEYNESNG
FT                   FGLYTPHAPISYDSITNSSIKMNSEEPWQQLIPLYVQTPTPIEKFFQYDLDKLLFKLEQ
FT                   LIHILDEYADFEYETFQWNDTKMTTTLGQKYSILATKTDSQRHASLDVYPIPEAIVQWI
FT                   QSSSFSSEDLAYFNFYSHLSEYPAAHDLSEAAHVLIQPFFQYEEIKKYVAQFNSLKYHY
FT                   TLQQIFSVLSQDIKNISGETTLHTEAVSLLERHTPVFNSFNQAAGIVLQLLHQIPADQW
FT                   QVNVRDKGYYYYQSTSTIIDLDIIEAFVDRLSNYATYEDYAKMLAINEELTKRMQKENY
FT                   SPILYDLSLFQYLDAFKAGLLKQDHLYEAIFTNTLASEIFTEPSKLLDRYQSFDDLTDF
FT                   LAIRNEAIDRILAIELKRGDTPTAVTKLASSISYFEGIDYFLQILQALDGEKLSRGYIW
FT                   QAETKKDVFSRLLTSCYPKKEETAQQLKEAWQKTEISKERLIEAMMYNQHWIDLVSEVI
FT                   DWEGLKESAWYFIAHTTDSLSDFAKDQIALFSSITAEDFGDGAFDLAWFQSAYQTLGSK
FT                   KFKVVYDAAKYASEGANHRRAQLYADTAIGKLSPKPLMKEIQEKRNKDKLRALGLIPLK
FT                   SADDKDALDRYQFIQQFLKESKQFGAQRRASEARAASIALENLARNAGDGEATRFIWRM
FT                   ELSAFNDIQQLFKAQPIEQITAHLQIEEDATITIIVEKDGKRLKNIPTALKKHADVVTL
FT                   QEARKDLQEQYKRARPALEQAMALETIFSAEELINLLAHPILAPLLQKLVFISGEHVGM
FT                   ITPEGLQVLSGNVVNLAPTTTLMIAHPYHLLESGQWRQWQAYMFEHKIQQPFKQVFREL
FT                   YLINADEKGRKQSLRYAGHQVNPSQTVALLKTRGWQISYETGPRKVYYKENIVASLYAQ
FT                   ADWFTPAEIEAPTIEGVYFYNRLTGKDIVLDDIPAAIFSEVMRDMDLVVSVAHVGGVDP
FT                   EASHSTVDMRSIIVEELAKLLKLSNVETKKQHVLIEGKLASYSLHLGSGIVHQVGGSMI
FT                   PIVAVPSQHRGRIFLPMVDDDPRTAEIMAKLLLLSEDTKIKDPAILAHIRSYEQTH"
FT   gene            complement(163071..163490)
FT                   /locus_tag="Bsph_0144"
FT   CDS_pept        complement(163071..163490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37780"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT26"
FT                   /protein_id="ACA37780.1"
FT                   /translation="MRLFYQQKVIGKKSRKLQKIPFFIEEPVINLQDLLIKIVTQQVQQ
FT                   YNEKMVDTPLHLYLTDQQLDHAAQYGKVHFGEKKNGSFQPVDQAVSTMLQAFQDELFLV
FT                   LHNEETIDSLNSPLAVQEDDVFTFIKLTMLAGRIW"
FT   gene            complement(163659..163862)
FT                   /locus_tag="Bsph_0145"
FT   CDS_pept        complement(163659..163862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37781"
FT                   /db_xref="GOA:B1HT27"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT27"
FT                   /protein_id="ACA37781.1"
FT                   /translation="MDFLIALQLGQIIVQVRKAPSFFSIYFHTYLFLKNTCVTSSVFSL
FT                   LFVLERKMIHTPTKTIVQTFYF"
FT   gene            164091..165263
FT                   /locus_tag="Bsph_0146"
FT   CDS_pept        164091..165263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0146"
FT                   /product="spore peptidoglycan hydrolase
FT                   (N-acetylglucosaminidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37782"
FT                   /db_xref="GOA:B1HT28"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT28"
FT                   /protein_id="ACA37782.1"
FT                   /translation="MGQALVIPIVGSFYYVQPGDSLWSIGQRLGINYVTLAQVNGINPN
FT                   QPLAVGMRLYIPQPPKTRAETLAYLEPRGTSVSEVLLDQAREAGPYLTYLALFSYEARR
FT                   DGTLRIPPSQGVPQITDDTGASLAMVVTNLENFSFSGELARDIFQSTAVQDLLFDNILA
FT                   EANKLGDVKDIHFDFENLPGDQREAYNNFLRRAVEKFHTQGYTVSTALAPKTSASDRGP
FT                   WTAGHDYRAHGEIVDFVLLMTYEWGYSAGPPMAVSPLPEVEEVVKYAVSEIPAGKIMLG
FT                   QNLYGYDWTLPFVQGGPIAEALSPQRAIETAKRYNAAIQYDWRAQAPFFEYYDEQGRAH
FT                   IVWFEDARSIQAKFNLVKQYNLRGIGYWKLGLPFPQNWLLIGANFDVVKK"
FT   gene            165369..167603
FT                   /locus_tag="Bsph_0147"
FT   CDS_pept        165369..167603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37783"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT29"
FT                   /protein_id="ACA37783.1"
FT                   /translation="MYFRRDILGKFKKLGIILTSTAFSVGMLAPISQASANVKESSERI
FT                   EIQVASTETKITKNMLIKKLRSLFPEEFKFVADQDFNSGPGHFYRDDTTVRYELNFYKT
FT                   IKGKDVHGSFVFKGDDLELEHFYYQPANMAEAIYPAKYSENEAQKIAQKFLGKFVNSDN
FT                   FKLRDDNNEYGFNITRPLSEPITYSFTYSPIYNGVLIGDQSITINVLANGDVTGMSSNA
FT                   ESISKASFDNLDQKKKEEDVLAQVRENLAMELRYYIDYDYRSDQSNVKLVYAPVTGFNG
FT                   VHALNGQWQTANGFTEQLPKTKSVEKISAQPLPPRKNGITATEAEEFAKNFLKVDESKA
FT                   KLTIDLVDERENDNGETIYSVNYTYMYGNGGSGSSLEINKATGELVQYHDLSRDFLTDN
FT                   KVNAISKDAALKKAIDYLKEWAPSYLHEYSMPIEDAVFDQYSKDYYFTFPRIMNGIAVV
FT                   GDGLHVGIGADGTLRSLSVNKQKIDNWQPIKNVISADKAKEAYSKALTLQLQYVKQDTE
FT                   SKLHYDLVYAPTYNGSLYNQIDAVSGEWLNNVDGSTEKPVISHPTAAKELNYLFNQNVL
FT                   DVKDIANFNADAAVTKGEALKILLHSLTYGYYGSGDGEKQSFNNIDKKHPLYGVVEQAV
FT                   KMGIIQPANQFALDATLSRQEFAEWSIKLLQLDNVAKYKDIYKLNFADAASIDPAYTGY
FT                   IALANGMGLIDAQQNNFNATKSVSYADLAVSTVRLAKAIQENKVDRNFYY"
FT   gene            167711..168175
FT                   /locus_tag="Bsph_0148"
FT   CDS_pept        167711..168175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37784"
FT                   /db_xref="InterPro:IPR025623"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT30"
FT                   /protein_id="ACA37784.1"
FT                   /translation="MKLKLLLAISFVMVILYGCNKEEVKDVPTNAPADQNASQQTGDTP
FT                   TDQVTFNFLEFSLDVDYSATESYEVEYENKKTGISAKLQDDRQNVKLQGDEAYTKLEPL
FT                   FKQLNFDSTTPNDEVIDQVIKVFNIEDNYQSIEVEVEFMDGNEKEFKRLP"
FT   gene            complement(168226..170211)
FT                   /locus_tag="Bsph_0149"
FT   CDS_pept        complement(168226..170211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0149"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37785"
FT                   /db_xref="GOA:B1HT31"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT31"
FT                   /protein_id="ACA37785.1"
FT                   /translation="MKKDINQKQHQLEAFRVSDKNQPLTTNQGLKIAEDEHSLKAGNRG
FT                   PTLLEDFHFREKMTHFDHERIPERVVHARGSAAHGIFETYECASDITKAQFLNGKGTKT
FT                   PVFVRFSTVAGSRGSADTVRDARGFATKFYTQEGNYDLVGNNIPIFFIQDAIKFPDFVH
FT                   AVKPEPNNEIPQAQSAHDTFWDFIANNQESAHMVMWHMSDRSIPRSYRMMEGFGVNTYR
FT                   FINSEGKSHFVKFHWKPVLGVKSLVWDEAQIIAGKDPDFHRRDLWESIERGDYPEWELS
FT                   VQLIPLEDEFKFNFDILDATKIWPEEEVPVRILGKMTLNKNVDNFFAETEQAAFHVGHV
FT                   VPGIDFSNDPLLQGRLFSYTDTQLIRLGGPNFHEIPINKPICPFHNNQRDGYGRQTINV
FT                   GQVSYHKNSLADNTPSPVSEEEGGYTHYEEKVEGHKVRARSESFKDHFTQARLFWLSMT
FT                   EIEKEHIINAFSFELGKVKSKAIRKQVVDMFAHVSHSLATAIADNIGIVPPVQVEVPHI
FT                   MQTSPAVSQILNAVESVKTFKVAVIVAENTEENLNELIATLLSKNIVVELVSTKQGLLN
FT                   GFEIHETFATASSVLYDGIYVSGSFHDLNQQAKAEQFIEEAYQHFKTIGLAKNVSFSQH
FT                   LANKNGVANNLPSFIQLLAKHRHWER"
FT   gene            170384..170818
FT                   /locus_tag="Bsph_0150"
FT   CDS_pept        170384..170818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0150"
FT                   /product="putative transcriptional regulator MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37786"
FT                   /db_xref="GOA:B1HT32"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT32"
FT                   /protein_id="ACA37786.1"
FT                   /translation="MKEDNRNLKAFTVLFRAYQTIQEATKRDLLQFDLNQTEFSVLEFL
FT                   YHRGEQPIQVIGKRILIASSSITYVIDKLEQKGYVYRKSCPRDRRVTYVLLTHEGQILM
FT                   EEIFPKHEQKINEIFEVLEPQELDTMILSLKKVGKNANEH"
FT   gene            170868..171851
FT                   /locus_tag="Bsph_0151"
FT   CDS_pept        170868..171851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0151"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37787"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT33"
FT                   /protein_id="ACA37787.1"
FT                   /translation="MNHLKGVHHVTAITSSAEENYKFFTYVLGMRLVKKTVNQDDIQTY
FT                   HLFFADDKGSAGTDMTFFDFPNIQKGVHGTNEISKTSFRVPTDASLEYWEKRFDRLHVK
FT                   HTGIKEQFGKKTLSFVDFDDQQYQLISDEHDTGIASGTPWQVGPIPLKYAITGLGPVFI
FT                   RVANFNYFKDVLEKVMLFTEIGEEGDFHLFEVGEGGNGAQVIVEHNTVLPVARQGFGTV
FT                   HHAAFRVEDRAVLDEWTARFESFGFHTSGYVNRHFFESLYARVAPQILFELATDGPGFM
FT                   GDEPYETLGEKLSLPPFLEPKRTQIEGLVRPIDTVRSSITFDKEYE"
FT   gene            171920..172537
FT                   /locus_tag="Bsph_0152"
FT   CDS_pept        171920..172537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0152"
FT                   /product="Putative NAD(P)H nitroreductase ydfN"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37788"
FT                   /db_xref="GOA:B1HT34"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT34"
FT                   /protein_id="ACA37788.1"
FT                   /translation="MEFSKLIDKRRSANNFLKDVKMTEEDIRPILEDVKLAPSAFNLQH
FT                   ANYIVVLDETMKEKVREAAYGQYKVHSASGVILVLGDKKAYKNTAELSQGMVDLGIITT
FT                   YELEEIVAENTHFYEDRGDAFMKEEAIRNASLSAMLFMLAAKNRGWDTCPMIGFDNQKM
FT                   RELFNVPEEQEIALMITIGKEKESSRRLRGYRKPVEEFATYY"
FT   gene            172572..173144
FT                   /locus_tag="Bsph_0153"
FT   CDS_pept        172572..173144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0153"
FT                   /product="Hypothetical yieF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37789"
FT                   /db_xref="GOA:B1HT35"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT35"
FT                   /protein_id="ACA37789.1"
FT                   /translation="MNNIHLGGNIVKVVAIVGSIRKESYNMQLAQFIEKRYAEKLDLEV
FT                   LSLKDLPMYNQDIENEAPQAVLDFKAKVKAADAVLWITPEYNGTVPGVMVNAIDWLSRV
FT                   DKVMIGKPSIIMGASMGNLGTVKAQLHLRDILFSPGINSPLLSGNDVYIGAVHTKFDEE
FT                   GNLTDEGTVKFLDVVIDNFLNWSKKYI"
FT   gene            173274..174674
FT                   /locus_tag="Bsph_0154"
FT   CDS_pept        173274..174674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0154"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37790"
FT                   /db_xref="GOA:B1HT36"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT36"
FT                   /protein_id="ACA37790.1"
FT                   /translation="MRKLSLKLGIIFFITLFCIETFMMFFLHASLTNSRVEEELASLQA
FT                   RGNSHRTILEQNFNNETLAHVVLMESEESTDVVVTDAEGIILASSQLHPEIKELIKKID
FT                   ETIPYEGKILQDNWREVKAIATISPMKREQTTIGYVFMFQNTDSIHALMKRLNKHFLIV
FT                   GIVSGLVTIAVIIVLSRKLAEPLIQMKEATLKMSKGDFTVALSTNGKDELGDLSNAIQL
FT                   LSNELNHLRQEREEFLSSIAHELRTPITFIKGYTDILYKRDLSAQDRQKYLAIIREETN
FT                   RLSRLIKDLFDLAKMDENSFIIEKQNLDLQAFFTGIKGKLSPAFQEKDIHFEVCCENGL
FT                   TLWADEARLEQIIINLLNNALTYCGQGDTTTVNVKKVNGVLTIIIRDTGRGIPNKDLPF
FT                   IFERFYRVEKSRSRALGGSGLGLAIVKELVQAHGGEVTVKSELNKGTVFELSFKGVGAD
FT                   ENHFMHRR"
FT   gene            174682..175332
FT                   /gene="srrA"
FT                   /locus_tag="Bsph_0155"
FT   CDS_pept        174682..175332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srrA"
FT                   /locus_tag="Bsph_0155"
FT                   /product="Transcriptional regulatory protein srrA
FT                   (Staphylococcal respiratory response protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37791"
FT                   /db_xref="GOA:B1HT37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT37"
FT                   /protein_id="ACA37791.1"
FT                   /translation="MLDLLTLYLEPVFHCRAMSSIHDALIYLEEEHVDLVLLDIMMPEM
FT                   DGFQVCQEIRKFWHVPIIMLTAKGEHSDIVKGLNIGADDYILKPFDEEELLARIHAVLR
FT                   RTKVENKVVVFEGLRLDKESFELYFQQEAIPLTPKEFSMMSLFLDYQNKVFSREHLINT
FT                   VWGYHVSIEDRTIDSHVRNLREKLRKSGFPADDYLQTVWGIGYKWHKFADRKP"
FT   gene            complement(175389..175973)
FT                   /locus_tag="Bsph_0156"
FT   CDS_pept        complement(175389..175973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0156"
FT                   /product="Hypothetical ydhK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37792"
FT                   /db_xref="InterPro:IPR011438"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT38"
FT                   /protein_id="ACA37792.1"
FT                   /translation="MTFKRRWSGGLLLAVVLLTLSACSEDKTEPSSTSNNTPESEQQTE
FT                   MDHSTMNHSSSAEVPATLKKAEDPTFPVGSTALIKDGHMEGMKGAEATIVGAYKTTAYI
FT                   ISYNPTSGGERVENHKWIIHEELIDVGEAPLSSDTEVKTTATHMAGMKNATVRIEEAVP
FT                   TTVYMVDYISTTNGETVKNHKWVTEDELTAQ"
FT   gene            complement(176090..176688)
FT                   /pseudo
FT                   /locus_tag="Bsph_0157"
FT                   /note="This region contains a gene with one or more
FT                   premature stops or frameshifts, and is not the result of a
FT                   sequencing artifact; biotin biosynthesis protein;
FT                   KO:K03523; identified by sequence similarity; putative"
FT   gene            177228..178274
FT                   /locus_tag="Bsph_0159"
FT   CDS_pept        177228..178274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0159"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37793"
FT                   /db_xref="GOA:B1HT39"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT39"
FT                   /protein_id="ACA37793.1"
FT                   /translation="MNKKFMLFSLVLLLVLIVSMTFAVMVGSVSVTPLYVWKVILSKLP
FT                   FIQQTIEQDWSRSQEIIIWQIRVPRVILAAIVGAGLAIAGAAIQALVRNSIADPYILGI
FT                   SSGAAVGATSVIILGAFSFLGIYALSVSAFIGSLLAIGLVFFLSRVGGRVSIFRLLLAG
FT                   MAVSFILTAISNFILMMSKQEGALKAVMFWMLGSLAGAKWSNIIIPASIFFIVFALLWL
FT                   FYRNLNLLLLGEEAAVTLGVNLQQFRIQLILLVSLLTGVLVAVSGSIGFVGLIIPHIVR
FT                   LIVGSNYKYVIPVSALLGGIFLVWADALARIIIAPQEMPIGIITAFCGGPFFIWLLRRN
FT                   NYSFGEGD"
FT   gene            178280..179071
FT                   /gene="fecE"
FT                   /locus_tag="Bsph_0160"
FT   CDS_pept        178280..179071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fecE"
FT                   /locus_tag="Bsph_0160"
FT                   /product="Iron(III) dicitrate transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37794"
FT                   /db_xref="GOA:B1HT40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT40"
FT                   /protein_id="ACA37794.1"
FT                   /translation="MTLEAKQVSFSIYDQQILHEVSVKIKKKQFVGLIGPNGSGKSTLL
FT                   KNMYRLLKPESGTVLLNEQDILKQSSKAIAKNLAVVSQETPVLFDFTVHDLVSMGRTPH
FT                   KKLLELDQEQDFQIVKNALKQTGILHLAKRSFSSLSGGEKKRVMVARALAQQAHVLILD
FT                   EPTNHLDIQHQLQLMDLIQTLHLTVVAALHDLNIAAMYCDQIYVLQRGRIVCHGTPEEV
FT                   LTPSLLQEVFGVFADIQTHTLTGKPYLTYVPEQFARRTNPI"
FT   gene            complement(179161..179475)
FT                   /locus_tag="Bsph_0161"
FT   CDS_pept        complement(179161..179475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0161"
FT                   /product="quaternary ammonium compound-resistance protein,
FT                   small multidrug resistance protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37795"
FT                   /db_xref="GOA:B1HT41"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT41"
FT                   /protein_id="ACA37795.1"
FT                   /translation="MGWVFVILAAVAEIVGVIGLRFYSQHKTVRNLLLYIGGFGLSFAL
FT                   LYASFNYLQLSIAYVVWVGIGTVGAVLVNIMFFGESKNLARIISIVAIIIGVAGLKAVS
FT                   "
FT   gene            complement(179475..179828)
FT                   /locus_tag="Bsph_0162"
FT   CDS_pept        complement(179475..179828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0162"
FT                   /product="sugE protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37796"
FT                   /db_xref="GOA:B1HT42"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT42"
FT                   /protein_id="ACA37796.1"
FT                   /translation="MQKEWMYVGLTSLFELFWIFGFNVANSWWHWIIIVSIIAIDFHFL
FT                   SKACEKLPTGTVYAIFAGAGAIGTTLMDIFIFNGDFNAIKGIFMVILVLGVIGLKLADN
FT                   PSKDPSTTKGVDA"
FT   gene            complement(179900..180499)
FT                   /locus_tag="Bsph_0163"
FT   CDS_pept        complement(179900..180499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0163"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37797"
FT                   /db_xref="GOA:B1HT43"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT43"
FT                   /protein_id="ACA37797.1"
FT                   /translation="MAKVRDIMSKEEKIIQAAIEVFREKGIEKTKVSDIVKAAGIAQGT
FT                   FYLYFPSRLSVMPAIAKNMVERIIATVEEGVSDHKPFEQQLEEVVEMIFLITKEYGDIV
FT                   ALIYAGIAQTEHLKEWENIYSPYYHWMSNFLLTAQQQGVIRDSINPSRSAKLIIGLIES
FT                   AAEQIYLFDDSKDETMQQLKLELLDFLYHALGLRHA"
FT   gene            180620..180796
FT                   /locus_tag="Bsph_0164"
FT   CDS_pept        180620..180796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37798"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT44"
FT                   /protein_id="ACA37798.1"
FT                   /translation="MTMEDIKFAQLDPQQLAKINELEKKMGVTLVAYDSSSTPPHSSGA
FT                   YEENNSTTNHHPS"
FT   gene            180866..182032
FT                   /locus_tag="Bsph_0165"
FT   CDS_pept        180866..182032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0165"
FT                   /product="Hypothetical yqxK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37799"
FT                   /db_xref="GOA:B1HT45"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT45"
FT                   /protein_id="ACA37799.1"
FT                   /translation="MKEFYADLHIHIGRTAKGRAVKITGSKTLTLARILETASARKGLD
FT                   IIGIIDCHSPEVIEEMKVMIDQGELVELAEGGLRFQETTLIPGSEIEIYDHHCHGPIHV
FT                   LAYFPTLLRMEQFSDWMSQHMKNIHLSSQRIYCEGRTLQKKVRELGGLFIPAHVFTPFK
FT                   SLYGKGVHRSLTEVFDPQLIDAIELGLSSDTNMVRQIKELQSYPFVSNSDAHSLGKLAR
FT                   EYQKLRLADANFIELQMALRDQQGRAIIANYGLNPLLGKYHQTVCSKCGEQLSNEAMIC
FT                   TNCESTQIIKGVATRIQELSENFPHEKNRPPYIHQVPLDFIPGIGPKMMERLLHAFGTE
FT                   MNILHQVTMEQLEQIVPHKIAKLIDAARTGHLDIEVGGGGIYGKVHME"
FT   gene            182136..183758
FT                   /locus_tag="Bsph_0166"
FT   CDS_pept        182136..183758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0166"
FT                   /product="possible S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37800"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT46"
FT                   /protein_id="ACA37800.1"
FT                   /translation="MKLSKKCRFLATSMLALQLTIPVVANAEETGDYIAPSWTTQADYV
FT                   ALGDSIAHGMNEVGAIGLGYPDYVAQALQKEGFITSFNKGFAMSGYTTKNVLADIQNDV
FT                   AKTVTGFGYPIEQVKLKASIKEAEIITLTIGANDLLPILKESQTAGIDTLAIIKATKEA
FT                   VTNIAAILTEIKKLNPQAEVYVMGYYNSFPYYGESLQNQFKILLATMNTTIKTTVEKAG
FT                   AFFVPTSDIVAKDVPSYLPNPENIHLSEAGYFAVANEAFLPIIKTSSLWDVTNAIQVHV
FT                   KDHKTVDISWREATDNVGVENYQVYVNGKLASTVTADTTEMTLTDLTENTDYTITIKAI
FT                   DAAGNESVQNPTAAFTTRETIRFTDTAHHWAKEYIQQAAEAGMMNGYPDGTFKPNQNVT
FT                   RAQVASILVRSLGISTQEKTPFTDIAKYDAKTQSEIAAAYAHGIIKGADGKFNPARPVS
FT                   RAELAVMIERAYEQQFKQPYIVQGSSPFTDITSYNAETKHAITMLFELGIVSGDGQKYS
FT                   PAASTTRGQAAKIMVNLNQLFNK"
FT   gene            184381..184632
FT                   /locus_tag="Bsph_0167"
FT   CDS_pept        184381..184632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37801"
FT                   /db_xref="GOA:B1HT47"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT47"
FT                   /protein_id="ACA37801.1"
FT                   /translation="MFYKGTEGWHWLDAMYFAVVSLIPTGVETGLYPTTSFSKIFTMIY
FT                   LIVGTGVMFIMLLTLGRSIVDFSLNEEEAVAVKKRLKK"
FT   gene            complement(184682..184969)
FT                   /locus_tag="Bsph_0168"
FT   CDS_pept        complement(184682..184969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37802"
FT                   /db_xref="InterPro:IPR020516"
FT                   /db_xref="UniProtKB/TrEMBL:B1HT48"
FT                   /protein_id="ACA37802.1"
FT                   /translation="MAQIINEQDIINAICLSQAYYKSIRPEDVIVELTYDDDTGFGAEV
FT                   EVNGQIEILNTGAMIGALRVWIKDVLHGDPFSTGIELVLDDEEGIIAKLS"
FT   gene            complement(184957..185421)
FT                   /locus_tag="Bsph_0169"
FT   CDS_pept        complement(184957..185421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37803"
FT                   /db_xref="GOA:B1HTR2"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR2"
FT                   /protein_id="ACA37803.1"
FT                   /translation="MKKILAALFAATLIFSTVGAALFISDTPTAEAKSYKSGKKGFSNN
FT                   NNSSNIQKSQDTSKDQKNATTNKNNTNSTNKADTTKKGGFFSGGLMKGLMLGGLAGLLF
FT                   GSLFSGMGLLGNILGLLINVAAIAVIVMLVVKIMNMFKDKKRKEEAQWHK"
FT   gene            185894..186622
FT                   /locus_tag="Bsph_0170"
FT   CDS_pept        185894..186622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37804"
FT                   /db_xref="GOA:B1HTR3"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR3"
FT                   /protein_id="ACA37804.1"
FT                   /translation="MLAIMGLSFVIMMIGYVFVIFIQIENVLWHILFFYAFLIFGYTMF
FT                   LYTSVLAYAVLYHFTPIRYEPNYIIALGSGLIGDRVPPLLASRLNEAVKQYKKYGERPF
FT                   IIVSGGQGTDENVSEAKAMKKYLLDVHDIPANKVLMEDQSTNTEENMIFTKNIMDQHAQ
FT                   GEKYRSIFVTNNFHVFRASLYAKKAKLDAEGVGSKTAFYYVPNAFTREFIGLLEMNKWA
FT                   HMTVFLIITLFIGLLLRAYV"
FT   gene            186676..187980
FT                   /locus_tag="Bsph_0171"
FT   CDS_pept        186676..187980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0171"
FT                   /product="Hypothetical ybeQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37805"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR4"
FT                   /protein_id="ACA37805.1"
FT                   /translation="MQGRKTMYEQILAKRNKERIQSLQEIMQTKNTMFAQNITLLTFTE
FT                   VNLTALQKILYQIVRGLLKDQQQRHLQIVHSDQTQSVQDNVLTLLAEYDDVLRDAIPQP
FT                   IYILIWQISSLERLTSRVEVVDDVLDVVEWYFDHQDDQVKILDEEDLDHEVMIDLYKEA
FT                   VEDQDTDAQYQLGEYYNAKEGNCFQPEKSLKWFELAAAQGNADAQYVLGNFYFEGVGVE
FT                   ENYTQAFSLYERAALQGHADAANNLADMYFNGEGVPLDFTLARKWFDFAASKNVAEAMF
FT                   TLGIIYEQGLGVNKDTNAAFNMYKKSAEAGYVEAQYRLGGIYLEGRLDQAKDINRGLFW
FT                   YERAAEQFHIDAFYDLGFIWSKGLTGIRNIEKGIHWFKQAALQGDADAKLQLGHIYNNG
FT                   EGIARNLKEALKWYRLAADAGIEEAAKIVEELKGL"
FT   gene            188610..189902
FT                   /locus_tag="Bsph_0172"
FT   CDS_pept        188610..189902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0172"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37806"
FT                   /db_xref="GOA:B1HTR5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR5"
FT                   /protein_id="ACA37806.1"
FT                   /translation="MIFQKQSKTKALDLQQYTVKMDLSNRQLMVKQIEMLNVTKQDLQY
FT                   LKAFQPYVMDNVDHIVNRFYNMIGTEQHLVNIISHHSSVEKLKVTLRQHIIEMFNGTID
FT                   EVYYQRRVKIAKVHVHIGLRTQWYICAFQDLSLSFIDLVEQHIGHPQDQFNTIRAISKI
FT                   CNFEQQLVLEAYENTVEQHKENMEQEKEVIERQIVQSSELLAAISQETNSSFCRLSEQS
FT                   GDIEQLAKRSLEVSTLAENQALDGRECLKKQSQNMHNIIQSLHDIEENIEQLSDMSKEM
FT                   ETIMSVVTNIANQTNLLALNAAIEAARAGEAGKGFSVVADEVRKLSIQTKESVTAVALL
FT                   LQKTSERTEKLEQSLINIQDEVASGEDNMLHTEGQFTNIVGAMTEAKDQNDCMATKIQA
FT                   IAGILSGLGTSFTEVTNSAEKLASFAQNLKS"
FT   gene            190094..190285
FT                   /locus_tag="Bsph_0173"
FT   CDS_pept        190094..190285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37807"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR6"
FT                   /protein_id="ACA37807.1"
FT                   /translation="MKTVVVLGGGITGLCTMHYLQRQVKEKNLDVQLVLVEKNTYLGGK
FT                   LYSAYEQVLLWKLVLILL"
FT   gene            190258..191487
FT                   /locus_tag="Bsph_0174"
FT   CDS_pept        190258..191487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0174"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37808"
FT                   /db_xref="GOA:B1HTR7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR7"
FT                   /protein_id="ACA37808.1"
FT                   /translation="METGADSIVARHKGVMELVQELDFEDHLVYNETGISYIYTNNELH
FT                   AIPADSTFGIPMSVASLEESTLISDQAKQEALKDLTLPNAGFTKESSIGEFLTYYLGEE
FT                   LVENQIAPVLAGVYSGDLHQLSIASTLPYLIDYKNEYGSIIKGFDANREQFVKAANKKF
FT                   ISFQNGLSSLIERLEQTLTDVDIIKGVATSQVKKMENHYLISLTSGQNIEADYVVLALP
FT                   NEAVQSILQDDSLTHYFNQFTTASAITIYLGFDVPDANLPADGTGYIVSHNSDVTCNAA
FT                   TWTSRKWKHTSKNNQLLVRLFYKSINPAYEQLRDMTDDELAAVALEDVRKSLGIDEKPT
FT                   VVNVTKWIDQMPKYDLAHREALQGLLLELNENYPNLSIAGCSYFGVGIGACIQNGKKIG
FT                   EELAEELSNL"
FT   gene            191683..193626
FT                   /locus_tag="Bsph_0175"
FT   CDS_pept        191683..193626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0175"
FT                   /product="bifunctional homocysteine
FT                   S-methyltransferase/5,10-methylenetetrahydrofolate
FT                   reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37809"
FT                   /db_xref="GOA:B1HTR8"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR8"
FT                   /protein_id="ACA37809.1"
FT                   /translation="MRRNNNDESLKPSFYIKEGFLLYRDRGREARFMGLLERLKTHVLT
FT                   ADGAIGTVLYGYGLEYCHEEMNVQRPELIEKIHREYIAAGADIIQTNTYGANAIKLARY
FT                   GLESSVQRFNEAAITIAKRAAADGGQFVLGTIGGIRGIRKSDATLNDILKTVEEQASVL
FT                   LAGNPDGLLLETYYDFEELTATLKMLRAKTNIPIIAQVSMHEPGVLQNGMSLNIALHEL
FT                   EILGADIVGVNCRLGPYHTIQAFEGVELPEKAFMSAYPNASLLDLEDGRVVYESEADYF
FT                   GRAAVELRDQGVRLIGGCCGTTPKHIAAAKKYLEELSPVSEKYAKPAKIEIVRDAEPAK
FT                   YEPLHEKVKRERSVIVELDTPRHLEIEGFLEGAKQLYEAGADVVMMADNSLASPRISNI
FT                   AMGALLKSTNGVRPLTHITCRDRNLIGLQSHLMGLNALGIHDVLAVTGDPTKVGDFPGA
FT                   TSVYDVSSMELIQLIKQLNEGVSFSGKPLRKKANFSVAAAFNPNVRVLDRAVARLEKKI
FT                   EHGADYFISQPVYTKEKMIEIYEATKHLQAPIYIGIMPVTSYKSAEFLHHEVPGIKLSE
FT                   DALARMKACGEDKERATLEGIAIAKELVEVAAQYFNGIYLITPFLRYDVTLELMKYIEQ
FT                   LDEQKKGVSING"
FT   gene            193619..197050
FT                   /locus_tag="Bsph_0176"
FT   CDS_pept        193619..197050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0176"
FT                   /product="Methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37810"
FT                   /db_xref="GOA:B1HTR9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTR9"
FT                   /protein_id="ACA37810.1"
FT                   /translation="MAKHLIEEQLDKRILILDGAMGTMLQNENLTADDFGGEELDGCNE
FT                   NLVLTRPDVIEKIHHKYLEAGADIICTNTFGGTPLVLNEYSLGAKAEEINKRAVEIARQ
FT                   AVDNYSTSDWPRFVAGAMGPTTKTLSVTGGITFDELEENFYVQAKALIEAGADVLLLET
FT                   SQDMLNVKAGTLGVTRAFEKTGKELPVMISGTIEPMGTTLAGQTIDAFYISIEHIQPLS
FT                   VGLNCATGPEFMTDHIRSLAELSTGYISCYPNAGLPDEEGCYHESPESLSQKLKGFAEK
FT                   GWLNIVGGCCGTTPAHIAAIREALKDEKPRQLPEKTHGHVVSGIEPLLYDDSMRPLFIG
FT                   ERTNVIGSRKFKNLIIDGKFEEAAEIARAQVKNGAHVIDICLANPDRDELADIRGFMQE
FT                   VVKKVKVPLVIDSTDEKVIEEALKFSQGKAIINSINLEDGEERFDAVLPLVKKYGASLV
FT                   VGTIDETGMAVDRHRKLEIAERSYQLLTEKWGIEPEDIIFDPLMFPVGTGDEQYIGSAL
FT                   ETIEGIRLIKEKMPRTLTVLGVSNISFGLPPVGREVLNAVYLYHCTQAGLDYAIVNTEK
FT                   LERYASIPEAEIKLANDLLFNTNDETLAVFTDFYRDKKKEKTEADIPKTVEGRLAYYIL
FT                   EGTKEGLIADLEAAREIFETPLDIINGPLMNGMAEVGRLFNDNQLIVAEVLQSAGVMKA
FT                   AVAHLEQYMEKNEESAGKGKMVLATVKGDVHDIGKNLVDIILSNNGYKVVDLGIKVTPA
FT                   QLIEAIRKEKPDFIGLSGLLVKSAQQMVTTAQDFKEAGIDVPILVGGAALSRRFTETKI
FT                   ADEYGGPVIYSKDAMQGLEQANLLMGEGTRENFLAEIAESRQKRLEADEKRAARPAKEV
FT                   TIKPARTVKEAPVFLPADLRRHVKKEYAVSHLYPYVNMRTLLGHHLGLKGQVQPLLDAG
FT                   DPRATELKDLVDDYLKSDLLKPSGLYQFFPAQADGDDVIIYDPADSKTEIERFTFPRQQ
FT                   IDPFLCLADFLRTVESGEMDYIALMVVTAGQGVMAKARQLKEDGKFLESHALQSTALEL
FT                   AEGFAERMHQEIRDQWGFPDVTDFTMRDRFAAKYQGQRFSFGYPACPNLEDQEKLFGLL
FT                   KPEDIGVHLTEGFMMEPEASVSAIVFAHPDARYFNV"
FT   gene            197163..197660
FT                   /locus_tag="Bsph_0177"
FT   CDS_pept        197163..197660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0177"
FT                   /product="Hypothetical acetyltransferase yncA"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37811"
FT                   /db_xref="GOA:B1HTS0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS0"
FT                   /protein_id="ACA37811.1"
FT                   /translation="MEEKDIPEVLEIYNDIILTSKAVYRYEIQSLDEKVKWFREQQALG
FT                   NPLLVFDDNGMVAGFATYSQFRPYPGYKYTMEHSVYVHKEHYQKGIATNLMLQLIEIAK
FT                   EQGVKTLVAGIDGENIGSIKAHEKLGFEYAGTIKNAGYKFEQWLDLVFYQLHLTGPIHK
FT                   RI"
FT   gene            197759..198790
FT                   /locus_tag="Bsph_0178"
FT   CDS_pept        197759..198790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0178"
FT                   /product="Fatty acid desaturase"
FT                   /EC_number="1.14.19.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37812"
FT                   /db_xref="GOA:B1HTS1"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS1"
FT                   /protein_id="ACA37812.1"
FT                   /translation="MATIKEKTKKLRQDVAPFAKSDTRKSVFQMINTIVPLIALWVAGY
FT                   LLVDVSPWLTVGLSVISAGFVVRTFIIFHDCTHGSFFKSKKANDWVGFFTGVLTSFPYE
FT                   KWKREHTIHHATSSNLDKRGIGDIDMMTVEEYMQASKGQRLWYRFYRNPFVMFGLGPLY
FT                   MVLVLNRFNRKDAKQKERTNTILTNIVIAGVCAALIFFMGWQAFLLVQGVTLFIAGALG
FT                   IWLFYIQHTYEDSYFEHDSEWDYVKAAVEGSSYYKLPKILQWVTGNIGFHHVHHLAPRV
FT                   PNYNLEKAHNETPPLHTATTITLRTSLESLRYKLYDEEQSKFVTFKEVELIIKRKAKGS
FT                   IAA"
FT   gene            199113..200063
FT                   /gene="desK"
FT                   /locus_tag="Bsph_0179"
FT   CDS_pept        199113..200063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="desK"
FT                   /locus_tag="Bsph_0179"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37813"
FT                   /db_xref="GOA:B1HTS2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS2"
FT                   /protein_id="ACA37813.1"
FT                   /translation="MWISFEMVINIVMTILYGYVYLSIFTAFFIGNIRRPVGFYIMYGL
FT                   HIGFTVISTGAGFFVELHLFLSQLPFVVLTILAVVLLPLTIYSKNKRENLEGQLETANE
FT                   RIAELIVFEERQRIARDLHDTLGQKLSMIGLKSDLASRLIERDPQQALVEIKDIRQTAS
FT                   IALKEVRELVSDMRTAKFEDELMRISQILKAAEMEFVFEGDKNALQVPPLVENVLSMCL
FT                   KEAVNNVVKHSGATKCEIAFHQNFKEVYLVVRDNGQGITKKQAWKTGNGLKGMRERLEF
FT                   INGSFKIESVDGTTLSVTIPVAITHQSVKENLKNI"
FT   gene            200092..200691
FT                   /locus_tag="Bsph_0180"
FT   CDS_pept        200092..200691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0180"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37814"
FT                   /db_xref="GOA:B1HTS3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS3"
FT                   /protein_id="ACA37814.1"
FT                   /translation="MIAEDQGMLLGALRSLLSMEDDMEVVGLAKNGEEAVMLVEEHQPD
FT                   ICVMDIEMPVKTGLDAAEEMHGSGSDCKVIILTTFARPGYFERARKASVRGYLLKDSPI
FT                   EELVSAIRTIMDGKRIYAPELVDFVYEDDSENPLTERESQVLTLVAEGKTTKEIAAELF
FT                   LSAGTVRNYISTILEKLNVGNRIEAIARFKEKGWNK"
FT   gene            complement(200736..201710)
FT                   /locus_tag="Bsph_0181"
FT   CDS_pept        complement(200736..201710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0181"
FT                   /product="proline oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37815"
FT                   /db_xref="GOA:B1HTS4"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS4"
FT                   /protein_id="ACA37815.1"
FT                   /translation="MLLRDFFIHLSENQLLNSAAKKYGLKLGAQSVVAGTNIEETIASI
FT                   KELNAHNISCTVDNLGEFVSSKEEATAAKDKILSVVEAIHENDVKAHISLKPSQLGLDI
FT                   DVDFCYDNLYEIVEKAAAYDIFVNFDMEDFGRLQTSFDMVEELSKTFSNVGTVIQSYFY
FT                   RAKDDIEKFKDYRLRIVKGAYKEPVEVAYQDKLDIDLNFIELIEYHLLHGKFTSIATHD
FT                   HNIIAHVKRFVADHNIPLDKFEFQMLYGFRTDMQKELAKEGYNFCVYVPFGEDWYGYFM
FT                   RRLAERPQNLNLVTKQVFTKKTNTVLAVAAGAFVLGRLTKRNK"
FT   gene            complement(201784..202536)
FT                   /gene="ybbM"
FT                   /locus_tag="Bsph_0182"
FT   CDS_pept        complement(201784..202536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="Bsph_0182"
FT                   /product="UPF0014 inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37816"
FT                   /db_xref="GOA:B1HTS5"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS5"
FT                   /protein_id="ACA37816.1"
FT                   /translation="MTYTSLSLTLIFVCIPLLLSKTLKLGLEKDTLIATLRSIVQLLAV
FT                   GYILKFVFDANSYMYIFLMVALMILVATFNARKKGEGIKGITWKIALTLVIIEIITQGV
FT                   LLGFNIVPATAQYIIPISGMLIGNSMVLSILFLNRFTAEITSHKDQMELILSLGGTPKQ
FT                   AVHRQLINAVKASMIPTIESQKTIGLVQLPGMMSGQIIGGADPIQAVQFQLLIIFALLT
FT                   TATLSSIMIGFLSYPALFNERMQILEMK"
FT   gene            complement(202533..203264)
FT                   /gene="pstB"
FT                   /locus_tag="Bsph_0183"
FT   CDS_pept        complement(202533..203264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="Bsph_0183"
FT                   /product="Phosphate import ATP-binding protein pstB 1"
FT                   /EC_number="3.6.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37817"
FT                   /db_xref="GOA:B1HTS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS6"
FT                   /protein_id="ACA37817.1"
FT                   /translation="MNTLYEPAIHFQQVQFSVNDKMILKSITGSFPKGQITTLVGPSGA
FT                   GKTTLLKLCNGLLSPTNGQILIDNEPISNYEPSALRRHVGIALQAAPMIAGTVKENIAL
FT                   PRTLQGKKLSQQEAIQYLEDVGLDESFLYQSTNELSGGQRQKVSIARTLINQSSILLLD
FT                   EITSALDRQSVKDIEKLIVTINQKYNVTMIWITHNLQQALTIGHYTWVMMNGELIETGK
FT                   SALLKAPTNPRVAEFVQGASI"
FT   gene            203364..203864
FT                   /gene="adaB"
FT                   /locus_tag="Bsph_0184"
FT   CDS_pept        203364..203864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adaB"
FT                   /locus_tag="Bsph_0184"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37818"
FT                   /db_xref="GOA:B1HTS7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS7"
FT                   /protein_id="ACA37818.1"
FT                   /translation="MEKLYFDTLTFAQGSMYIVASNNGLAYIGTPNASFDEVKEWAKKP
FT                   FKGYSFEENQEQLQPYKEQLTAYFNKELTEFDVPIHVKGTPFQLAVWDALKELPYGSTT
FT                   SYGSIAERIGNPKAVRAVGSAIGANPILAIIPCHRVIGKNGQLTGFRSGLDVKQFLLEL
FT                   EKA"
FT   gene            complement(203931..205232)
FT                   /locus_tag="Bsph_0185"
FT   CDS_pept        complement(203931..205232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0185"
FT                   /product="Putative ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37819"
FT                   /db_xref="GOA:B1HTS8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS8"
FT                   /protein_id="ACA37819.1"
FT                   /translation="MEEIILSVNLIWVMLGTILVFFMHAGFAMVEAGFTRSKNAVNIIM
FT                   KNFLTISLGGIVYFLCGYAIMFGDTVGGIFGISGFALNGVDDLSFFIFQAMFAATGATI
FT                   LSGAVAERTNIFAYIGIIILMSLVVYPVVGHWVWSGQGWLTDLGFVDFAGSTVVHLTGA
FT                   VAAFVAAVMVGPRLGKYENGRVNVITGHSIPLGALGVFLLWFGWFGFNGASTLAADPEL
FT                   VPNVIANTFFAAAAGVVATAFYTKFRYGHIDGSLTLNGALAGLVGITAGAANVSIIGSI
FT                   IIGLIAAPLLVEGVRFLEWKLKVDDPVGAIAVHGICGVWGTLAVGLFDSNGQGLFYGGG
FT                   LSLLGIQAVGVIATIAWVSVSVTAGIFIIKAFVPLRVTAEEEIAGLDVIEHGAPAYEFQ
FT                   DIFKSSAVRGETFAHRLTHFGKTQSNVQQEEQHI"
FT   gene            complement(205246..205587)
FT                   /locus_tag="Bsph_0186"
FT   CDS_pept        complement(205246..205587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0186"
FT                   /product="Nitrogen regulatory protein P-II (PII signal
FT                   transducing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37820"
FT                   /db_xref="GOA:B1HTS9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTS9"
FT                   /protein_id="ACA37820.1"
FT                   /translation="MKKIEVIIRPEVFGAVRDGLAQQGIAGLSVSEIAGCGRQLGRTGL
FT                   FRGNTYEIEFLPKLKLEMIVDDSKVDGIVEILLREAATGKVGDGKIFIYPVEQAIRIRT
FT                   KEVGSIAVE"
FT   gene            205960..207360
FT                   /locus_tag="Bsph_0187"
FT   CDS_pept        205960..207360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0187"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37821"
FT                   /db_xref="GOA:B1HTT0"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT0"
FT                   /protein_id="ACA37821.1"
FT                   /translation="MAESYWADGIHNKKAIFELYFRKLPFGNGYAIFAGLERMLDYLRN
FT                   FRFSESDITYLREEVGYKEDFIEYLKDIRFTGDMYSMVEGELVFANEPIVRIEAPLVEA
FT                   QLIETALLNIVNYQTLIATKASRIKQIIKNEVAMEFGTRRAQEMDAAIWGTRAAFIGGF
FT                   ASTSNVRAGKLFNIPVSGTHAHALVQAYKNDYDAFHSYAKRHRDCVFLVDTYNTLKSGV
FT                   PTAIKVAKELGDKINFIGIRLDSGDIAFLSKEARRMLDAAGFHDAKIIVSNDLDEYTIL
FT                   NLKAQGAKVDVWGIGTKLITAYDQPALGAVYKMVAIENSEGQLEDTIKISANAEKVTTP
FT                   GLKNVYRIIDKKNGKAEGDYIAMQDENPQEEERIKMFHPIHTFVSKFVTNFEAKNLHQH
FT                   VIHHGEINYTNPTLEEMRDYAAGNLELLWDEYKRAMNPEEYPVDLSQKCWDNKMRNIEE
FT                   VHNMVKQM"
FT   gene            207379..208203
FT                   /locus_tag="Bsph_0188"
FT   CDS_pept        207379..208203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0188"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37822"
FT                   /db_xref="GOA:B1HTT1"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTT1"
FT                   /protein_id="ACA37822.1"
FT                   /translation="MTLQQQIIEELRVQPTINAQEEIRKSIDFLKEYAKHYSFVKGFVL
FT                   GISGGQDSTLTGKLAQLAVDELNKEVGEMKYSFWAIRLPYGVQADEQDCQDAIDYIKPT
FT                   GSYTVNIKDAVDASVKALANAGVELNDFVKGNEKARERMKVQYSIAAMNGGVVLGTDHA
FT                   AEAITGFYTKFGDGGADLMPIFRLNKRQGKQLLAELNCPEHLYTKVPTADLEENRPSLP
FT                   DEVALGVSYDQIDDYLEGKEIPEEPRQLLEGYYLRSQHKRHMPITIFDVFWK"
FT   gene            208361..208681
FT                   /locus_tag="Bsph_0189"
FT   CDS_pept        208361..208681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37823"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT2"
FT                   /protein_id="ACA37823.1"
FT                   /translation="MRTSRVNATTSSVFRQENQYLHAGDISHNFGQNPQNLFKNSLQRN
FT                   KEKKRSSINTPNQQKQHQQTAPIHMDSTNDLQIRRELNETALKLSRLSRQKKLLNSYRS
FT                   SI"
FT   gene            208888..209526
FT                   /locus_tag="Bsph_0190"
FT   CDS_pept        208888..209526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37824"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT3"
FT                   /protein_id="ACA37824.1"
FT                   /translation="MKKLWLPALLLLLLAACNSEKPQVKEKGSEQDATEMETEVVDDSV
FT                   QVASLVDSRLQEPKEDTVCEMCNMKVYMKDHEMGVFSTQAIKEDGTIAFYDDIGCLLNA
FT                   EVANEEKNAKFVRDFVTKEWAKVEDVTIVKTELKSPMNWGYIYFVNKAEADTYIQENPN
FT                   AYVEELQKIKDDALERRKKMMEKKAKEESGDSSSMHSNEMNHGQEGHGH"
FT   gene            209562..210857
FT                   /locus_tag="Bsph_0191"
FT   CDS_pept        209562..210857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0191"
FT                   /product="Copper-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37825"
FT                   /db_xref="GOA:B1HTT4"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT4"
FT                   /protein_id="ACA37825.1"
FT                   /translation="MLNKVVNVMKRICLFVLFFLWASQTANAEFDLQLAIDQAKPGEIV
FT                   HIPAGRYQGNFIVKKPIKLLGEKGVELYSQNTEPALKIDHTANVSIENIMISAKNKGIV
FT                   VNETENLKLKAIEIKNIQVGIHIQRSKHIRIVENKIVGNQLHYAEKGNGVAVFKSEDIA
FT                   IEHNAIDLVQDGIYVEEAKQIDVRQNEVTNSRYGTHFMYSSDVKVDYNSYFQNVTGLMV
FT                   MMTTDLEIARNTVRNHNDFNSYGLLMYDTQQAKVRKNSFQNNRVGVALQKCSVIQIQEN
FT                   RFQMNQTALEGTKVDKHSIIKDNQFTGNILTARSDQQGLRLVRNFYDDYRGIDVAGDGF
FT                   GDVPYVAVSSFGQWMVRQPVYQFFVASPSVMILTSLDQQVNKTEQNLLVDNEPRLISHT
FT                   KEKGLSINILQFIIGLVVTMGGFWLWKRGMLV"
FT   gene            210896..211306
FT                   /locus_tag="Bsph_0192"
FT   CDS_pept        210896..211306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0192"
FT                   /product="hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37826"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT5"
FT                   /protein_id="ACA37826.1"
FT                   /translation="MGGCSGKVYNPRDIISETDICEICNMSIVHQEYAGQIVLTNGDYK
FT                   IFDDIGCLMDYLTLNGEGEIGAAYIKNKANNEWIDVYKATYVYNPGYWTPMNYGVLAFA
FT                   TEAEAQEWMTNEGEGQLLAYQDLLTFNWGIHK"
FT   gene            211306..212106
FT                   /locus_tag="Bsph_0193"
FT   CDS_pept        211306..212106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37827"
FT                   /db_xref="GOA:B1HTT6"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT6"
FT                   /protein_id="ACA37827.1"
FT                   /translation="MFVKIELKQILRSHWMQLVAFLFTFVFVAIIVIQRMALPDMEGFT
FT                   RQTASFLNVLLFLLPLFIITIGSMSLAGDIESGWFSLLKTYPMKIAQYIIGKYVAISLA
FT                   FLLVVLVAFGVVLALGGLLDGVQLPIILVILTLLCIFIFVSLGIVLGAMAKTRLFALAL
FT                   SLVVWSFFLLLISYALMALGAVVAGHVLQKLTIISIHINPVEWLRFGYFIFTHQASVLG
FT                   PAFYGVTKFYSSPEGHVMYVIVTLLWIILPLILATKFLKEDPKR"
FT   gene            212103..212783
FT                   /gene="srtF"
FT                   /locus_tag="Bsph_0194"
FT   CDS_pept        212103..212783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtF"
FT                   /locus_tag="Bsph_0194"
FT                   /product="Lantibiotic transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37828"
FT                   /db_xref="GOA:B1HTT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT7"
FT                   /protein_id="ACA37828.1"
FT                   /translation="MILLEAKNVANVYGNGRGLKEATFTLHSGKILALVGGNGAGKSTL
FT                   IRLLTGQEKKKSGEMIWHKPQVIRYMPDDVNFPIMLTAAEIFELLASLKQVDQDEQERI
FT                   LKRVSLWDVRNQPAKQFSKGMLQRLNLAQSLLGSGSLLILDEPTNGLDPFWIAQLKHVM
FT                   IEEKKKGNTVIFSTHLLSFAEEIADDVLVLHDGEIIISGPITEIFTQENSTSLEEIWLK
FT                   RLEL"
FT   gene            212976..213920
FT                   /locus_tag="Bsph_0195"
FT   CDS_pept        212976..213920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0195"
FT                   /product="methanol dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37829"
FT                   /db_xref="GOA:B1HTT8"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT8"
FT                   /protein_id="ACA37829.1"
FT                   /translation="MNSQIQNVLENIEKVMIGKREVAELSLVALLARGHVLLEDVPGVG
FT                   KTMMVRSLAKSFDAQFKRIQFTPDLLPSDVVGISIYNPKTLEFEFRPGPIMGDVILADE
FT                   INRTSPKTQSALLEGMEEASVTIDGKTLAINQPFFVMATQNPIEHEGTYPLPEAQLDRF
FT                   LLKIKMGYPTRGQEVEILRRAENGKAIEKIDAVLSVAQLIELQELVQGVYVEDSVKNYM
FT                   VELATQTRENSYVYLGVSPRATLALMKASQAYAFMKGRSYVIPDDVQYLVPFVFSHRLV
FT                   LKPDARYDNVTANEIIERIIAKTPVPTKRFAEQ"
FT   gene            213917..215098
FT                   /locus_tag="Bsph_0196"
FT   CDS_pept        213917..215098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0196"
FT                   /product="Hypothetical yeaD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37830"
FT                   /db_xref="GOA:B1HTT9"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTT9"
FT                   /protein_id="ACA37830.1"
FT                   /translation="MRQWKAFLEKSKHFLLVVFLMVVTFCYAMFQGGFVSWFVFFTVSP
FT                   FLVYALFFFVVRESILVVERKIEPSHIERGQSAKVTISVERKTRFPFAYMMMEELVDSE
FT                   GLVQAKLQSSAAIKFVGFRKKFNWHYELVNMPRGEHRYLGVTIAFYDFFGWAKKMVVAE
FT                   KEQTILVYPRLREMKYSALQTKYDVGPMMSPYSIVKDTTMSVGLREYVPGDRFSWIHWK
FT                   SFAKTQTLQSKEFEDRQSSELMLVLDAKKSTLFEDKIELVASMLNMIVQELGDISFIAA
FT                   GEMTKVFPVIQGEKQLDQVMYHLAAIKPTENVKFRFYDQQAFKQVATLLYVTNEVSDEF
FT                   LHTLANIVKSCICFVVTKQPPVQSEVTLRYKHIQMVYVDPTDFYHVFTGVMKP"
FT   gene            215095..217278
FT                   /locus_tag="Bsph_0197"
FT   CDS_pept        215095..217278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0197"
FT                   /product="transglutaminase-like enzyme, hypothetical
FT                   cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37831"
FT                   /db_xref="GOA:B1HTU0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU0"
FT                   /protein_id="ACA37831.1"
FT                   /translation="MKQSLGEFLELAVAYIIVFFILREWLMPIMQLTNTGGFHLFLVFI
FT                   GLSLALSLFRVHPVLSGIVKLGYIIWCIVFIYSESPVLSGKTISFLLAEWKGNMAAIIS
FT                   GDFGLVSDAFRTVLFLVLIWMLVYLIHHWVSVRKNIFYFFVMTVFFIATLDTFSEYNGK
FT                   TAIVKVVILGLMMTGVLFVKRLWLQAGTTSNAFGKWKIVIPMLVSVILFGSIAFFLPKT
FT                   GPTWADPVPFIQGVTGQDGNGAGMKSVGYSQDDSQLGGPFQGDNTLIFTASSRDRHYWR
FT                   VETKDTYTSKGWILSEGNFGKNVYESNAPIMTSLQVGLPENERQIQLDIAASMPFLIQT
FT                   YGLLSVSAQDSTLFIQDEQTERMTIEQQNDTSKSLSNYTLSYSEPVYSMEQLQLSLPAT
FT                   LETLDLSFDRFMQLPVELPQRVRDLALAITQDETTVYDQIKAVEGYFRTNGFRYDKTQA
FT                   AIPAENQDYVDQFLFDTKVGYCDNFSTSMVVLLRSIGIPARWVKGFAPGTAGPMTDGLR
FT                   EYRITNDNAHSWVEAYIPGTGWMEFEPTIGFSGNANIDYDIPLDTSEQEEILQPEQKPE
FT                   QPQQQEQVSNKEQSKSTFSLDMLWAWMKKFAYVWGIGLILLLISGIALYLQRKTWLPKM
FT                   HVRAYRKKTADWSTFDSSYHILLKQLSRIGLRMRDGETLHMFAERVDASLETDEMQKLT
FT                   AVYEQHVYGKDKQEVDFIKLKESWEYLINRTIG"
FT   gene            217528..219120
FT                   /locus_tag="Bsph_0198"
FT   CDS_pept        217528..219120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0198"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37832"
FT                   /db_xref="GOA:B1HTU1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU1"
FT                   /protein_id="ACA37832.1"
FT                   /translation="MNDPLIIVEEVEILTASPLLKEQEKIVVLDFGSQFNQLITRRIRE
FT                   FGVFSELHPHTVTAEEIKEMNAAGIIFSGGPNSVYDENAFHVDPAIFELGLPILGICYG
FT                   MQLMAHTNGGKVEGAETREYGKAEIKVTASNKLFGELPTEQIVWMSHGDHVTEVPAGFE
FT                   VIATSASCPIAAMANVERKLYAVQFHPEVRHSVYGNDLLRQFVFDVCEAKGDWSMANFI
FT                   ELEIAKIREIVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCMFVDHNLNRKGEVEQV
FT                   MKTFTEDFDMNLIKIDARKRFMDKLAGVSDPEKKRKIIGNEFIYVFDEEASKLEGMDFL
FT                   AQGTLYTDIIESGTSTAQTIKSHHNVGGLPEDMQFQLIEPLKTLFKDEVRALGLELGLD
FT                   EKIVWRQPFPGPGLGIRVLGEVTEEKLEIVRESDFILREEIANAGLDRDIWQYFTVLPD
FT                   IRSVGVMGDARTYDYAIGIRAVTSIDGMTSDWARIPWDVLEKISVRLVNEVKHVNRVVY
FT                   DITSKPPATIEWE"
FT   gene            219249..219962
FT                   /locus_tag="Bsph_0199"
FT   CDS_pept        219249..219962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0199"
FT                   /product="Protein yiiM"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37833"
FT                   /db_xref="GOA:B1HTU2"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU2"
FT                   /protein_id="ACA37833.1"
FT                   /translation="MNAKEMILFRLGGIQMEKNKPIIHTLAVGMPKELIDSKGRSMITG
FT                   IEKQKIQEVYLSAHGFDGDDVADKKHHGGPDRAVCLYPAEHYIQWEQELGKPLPTAAFG
FT                   ENLTVTNMLEADTCIGDIYKIGDAVIQITQGRVPCSTIDKYTESNTLLKRMIETGYTGF
FT                   LGRVLEEGTICASSNIELVEKHPAQVSVLYCNEVYFKNKDADAMKHIRAVDALAEDWKQ
FT                   KLEKRIQVLQSKVMN"
FT   gene            220438..221229
FT                   /locus_tag="Bsph_0200"
FT   CDS_pept        220438..221229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37834"
FT                   /db_xref="GOA:B1HTU3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU3"
FT                   /protein_id="ACA37834.1"
FT                   /translation="MFDELGTNYRREIIGGITTFLAMAYILAVNPGILENAGMDKGAVF
FT                   VATALAAAVGSLIMGIFAKFPISLAPGMGLNAFFAFTVVGAYGIPWQTGLTGVFFSGII
FT                   FIILSLTGIRETVINAIPVQLKYAVSAGIGLFITFVGLQGAGIVVDSPATLVTLGTFTG
FT                   STLLAVFGIVLSVILIIKLRSVGIFLGMVITAIIGMVTGIIEPPTAIVSAIPSVDSTFM
FT                   VALEPLGDIKSLFNVKFLVVVLTFLFVDFFDTAGTLMAVAT"
FT   gene            221278..221724
FT                   /locus_tag="Bsph_0201"
FT   CDS_pept        221278..221724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37835"
FT                   /db_xref="GOA:B1HTU4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU4"
FT                   /protein_id="ACA37835.1"
FT                   /translation="MADALATTIGSLFGTSTTTAYVESTSGVAAGARSGFSAVVTAVLF
FT                   LVALFFSPLLAVVTPAVTAPALVIVGVLMVSSLRLIDWDKFEIAVPAFFTVLMMPLGYS
FT                   IATGIAIGFVFYPITMLLAGRRKEIHPMMYGLFFVFLAYFIWVR"
FT   gene            222209..223753
FT                   /locus_tag="Bsph_rRNA0516S"
FT   rRNA            222209..223753
FT                   /locus_tag="Bsph_rRNA0516S"
FT                   /product="16S ribosomal RNA"
FT   gene            224077..226988
FT                   /locus_tag="Bsph_rRNA0523S"
FT   rRNA            224077..226988
FT                   /locus_tag="Bsph_rRNA0523S"
FT                   /product="23S ribosomal RNA"
FT   gene            227181..227287
FT                   /locus_tag="Bsph_rRNA055S"
FT   rRNA            227181..227287
FT                   /locus_tag="Bsph_rRNA055S"
FT                   /product="5S ribosomal RNA"
FT   gene            227603..227719
FT                   /locus_tag="Bsph_0205"
FT   CDS_pept        227603..227719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37836"
FT                   /db_xref="GOA:B1HTU5"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU5"
FT                   /protein_id="ACA37836.1"
FT                   /translation="MVSTFLGIKEYRFILVVLHSFLLLLILGIYIKALYGFY"
FT   gene            227869..228063
FT                   /locus_tag="Bsph_0206"
FT   CDS_pept        227869..228063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37837"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU6"
FT                   /protein_id="ACA37837.1"
FT                   /translation="MGKKQIWYEVQENESIEECLERMRNDGYMAIGRKEEPLFHLVDGE
FT                   PTLLRQKIQFKAILTQDME"
FT   gene            complement(228070..228273)
FT                   /locus_tag="Bsph_0207"
FT   CDS_pept        complement(228070..228273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37838"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU7"
FT                   /protein_id="ACA37838.1"
FT                   /translation="MDLLIKAKSAFPHSPAFTVPGRDTRANPLAYMWDLFVFPYHILTR
FT                   DRIIVNAKMRTFFYNLKKTFGF"
FT   gene            228463..228951
FT                   /locus_tag="Bsph_0208"
FT   CDS_pept        228463..228951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0208"
FT                   /product="Phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37839"
FT                   /db_xref="GOA:B1HTU8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU8"
FT                   /protein_id="ACA37839.1"
FT                   /translation="MNPKIGVIMGSSSDWETMKHACDILDELQVPYEKKVVSAHRTPDL
FT                   MFEYAEAARKRGIQVIIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALNGLDSLLSIVQ
FT                   MPGGVPVATVAIGKAGATNAGLLAAQILSTTDAELADKLDARREATKQQVLESTGDLV"
FT   gene            228948..230072
FT                   /locus_tag="Bsph_0209"
FT   CDS_pept        228948..230072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0209"
FT                   /product="Phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37840"
FT                   /db_xref="GOA:B1HTU9"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTU9"
FT                   /protein_id="ACA37840.1"
FT                   /translation="MTKIIYPGQTIGIIGGGQLGRMMALAAKESGFKIAVLEPAMDSPC
FT                   GQVADVRIVAPYDDEAALEELAEVSDVITYEFENIDYEGLKRLSQMAYVPQGAELVRIT
FT                   QNRITEKDAIVRAGCPVAPYIVAKTYEELVANIDSIGYPCIVKTARGGYDGKGQQLLTS
FT                   TEDLPLAKELFMHSPCIAEGFVPFVKEVSVIVQRNGSGESYCQPVGENIHVHHILHETI
FT                   VPARITESTAQAAEREALKIADYLHLVGTLAVEMFVLEDGGIVINELAPRPHNSGHYSI
FT                   EACNVSQFHQHIRAVCGWPLRKPELWAPSIMINVLGQHVVPLSNSIAKYPEWSIHLYGK
FT                   AEAKVNRKMGHVTIMTKNLEETLQQIESSGIWSE"
FT   gene            230086..231381
FT                   /locus_tag="Bsph_0210"
FT   CDS_pept        230086..231381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0210"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37841"
FT                   /db_xref="GOA:B1HTV0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTV0"
FT                   /protein_id="ACA37841.1"
FT                   /translation="MIERYTRPEMGAIWTEQNKYQAWLEVEILACEAWAEIGDIPKEDV
FT                   AKIRENASFDVNRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTALSY
FT                   LIKQANDILRKDIVNFIDIIAVKAKEHKHTVMMGRTHGVHAEPTTFGLKLGLWYEEMKR
FT                   NLERFEAAAKVIETGKMSGAVGTYANIDPRVEQYVCDQLGLAASPISTQTLQRDRHAQY
FT                   LGALALIATSIEKFATEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMVGMS
FT                   RLMRGYMVTAYENVALWHERDISHSSAERVILPDATITLNYMLNRFGNIVKNLTVFPEN
FT                   MKRNMTRTFGLIYSQRILLALIDKGLVREEAYDTVQPLAMQAWDEQVQFRTLVDASEKI
FT                   TSYLTKEELDECFDYNYHLQHVDMIFERLGLN"
FT   gene            231511..232221
FT                   /locus_tag="Bsph_0211"
FT   CDS_pept        231511..232221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0211"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37842"
FT                   /db_xref="GOA:B1HTV1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTV1"
FT                   /protein_id="ACA37842.1"
FT                   /translation="MTKGQLLYEGKAKKLYTTEEPNVLLVEYKDSATAFNGEKKEEIEG
FT                   KGILNNRITSLIFEKLQGNGIASHFVKQLSDTQQLVRKVDIIPIEVVVRNIVAGSLAKR
FT                   IGLEEGTPLKRPIVEFYYKDDELGDPFITTEHIDVLELATSAEVSAIYDKALAINKVLQ
FT                   PIFADVNVTLIDFKLEFGRDADGHVLLADEISPDTCRLWDATTKQKLDKDVFRRDLGNL
FT                   TEVYTIILSRLGGK"
FT   gene            232224..232472
FT                   /gene="yexA"
FT                   /locus_tag="Bsph_0212"
FT   CDS_pept        232224..232472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yexA"
FT                   /locus_tag="Bsph_0212"
FT                   /product="UPF0062 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37843"
FT                   /db_xref="GOA:B1HTV2"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTV2"
FT                   /protein_id="ACA37843.1"
FT                   /translation="MKKVKIYVTLRESILDPQGSAVQGSLAKMGYGEVEDLRIGKYLEL
FT                   SINDTERDIDTLVKEMCEKVLTNVVIEDYRYEVEEAN"
FT   gene            232475..233158
FT                   /locus_tag="Bsph_0213"
FT   CDS_pept        232475..233158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0213"
FT                   /product="Phosphoribosylformylglycinamidine synthase 1"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37844"
FT                   /db_xref="GOA:B1HTV3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTV3"
FT                   /protein_id="ACA37844.1"
FT                   /translation="MKFAVLVFPGSNCDIDMYHAIKDELGEEVEYVWHTATDLSGFDGV
FT                   LVPGGFSYGDYLRCGAMANQSNIMAEVKKVADAGKPVLGVCNGFQILTEAGLLPGALLR
FT                   NTNLKFMCRTVQLKVENNNTLFTNQYEQGQIIHIPIAHGEGNYYCDEETLQSLKDNNQI
FT                   VFTYSGDNPNGSLEDIAGIINERGNVLGMMPHPERAVDALVGGADGLAVFKSIVKQWRE
FT                   NHVNN"
FT   gene            233145..235379
FT                   /locus_tag="Bsph_0214"
FT   CDS_pept        233145..235379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0214"
FT                   /product="Phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37845"
FT                   /db_xref="GOA:B1HTV4"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTV4"
FT                   /protein_id="ACA37845.1"
FT                   /translation="MSTTKFEPTAQQIKDEKLYAGMGMSDEEFALVEGILERLPNWTET
FT                   GLFSVMWSEHCSYKNSKPVLRKFPTKGPQVLQGPGEGAGIVDIGDEQAVVFKMESHNHP
FT                   SAIEPYQGAATGVGGIIRDVFSMGARPIAMLNSLRFGELKSARGKYLFEEVVAGIAGYG
FT                   NCIGIPTVGGEIQFDPCYEGNPLVNAMCVGLIDHKDIQRGIAAGVGNTVMYVGAKTGRD
FT                   GIHGATFASEELTEESENQRPAVQVGDPFMEKLLLEACLEVVKSDALVGIQDMGAAGLT
FT                   SSSAEMASKAGSGVEMNLDLVPQRETGMTAYEMMLSESQERMLLVVKKGREDEIKAIFD
FT                   KYDLDAVAIGRVTDDKMLRLLHNGQIVAEVPADALAEDAPVYHKPSAEPAYYAQFQAIE
FT                   NTEPVVTDYKETLNALLKAPTIASKEWVYDQYDYQVRTSTVVKPGSDAAVICVRGTNKG
FT                   LAMTTDCNSRYIYLDPEVGGAIAVAEAARNIVATGGTPLAITDCLNFGNPEKPEIFWQI
FT                   EKSADGISAACTALNAPVIGGNVSLYNERSGEAVYPTPTIGMVGLIEDLAHVTTQEVKG
FT                   AGDIVFVIGETTTEFGGSELQKLLNNGVISGKAPAIDLEIEAARQQALLKAIKAGIVQS
FT                   AHDVAEGGLAVAIAEKTFSANGLGVEVTLTGSATTALFSESQSRFVVTVKEEHAATFVE
FT                   IIKDAHKIGVVTNDALVKINGDKGVLVEGTVEEFRSNWKGAIPCLLNSEA"
FT   gene            235355..236779
FT                   /locus_tag="Bsph_0215"
FT   CDS_pept        235355..236779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0215"
FT                   /product="Amidophosphoribosyltransferase precursor"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37846"
FT                   /db_xref="GOA:B1HTV5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTV5"
FT                   /protein_id="ACA37846.1"
FT                   /translation="MLAELRGLNEECGVFGIWGNPNPAHLSYYGLHALQHRGQEGAGIV
FT                   VSDGQHLRAVKGEGLVNDVFNEDKLKAVNGKAAIAHVRYTTAGGGGIENVQPLLFHSST
FT                   GSLSIAHNGNLVNATHLKQYLERQGSIFHSSSDTEVLAHLIKKSSHSPFRAKVKNALSL
FT                   LKGAYSCLIMTKDEMLVARDPHGLRPLSLGKLGEGWIVASETCAFDLIGAEFVRSVEPG
FT                   ELLIINDEGVKSDRFAEMEKRSMCAMEYVYLARPDSDIDGINVHMARKRMGKQLARECA
FT                   HIEADVVTGVPDSSISAAIGFAEESGIPYELGLIKNRYVGRTFIQPTQELRERGVKMKL
FT                   SPVVQVVKGKRVVMVDDSIVRGTTSRRIVKMLKDAGAAEVHVVISSPPMTNPCYYGIDT
FT                   STHEELIASSHNVDEIREVIGADSLTFLSVEGMVETIARPYEDENRGLCLACFTGKYPT
FT                   EIFPDTILPHEKELLR"
FT   gene            236873..237928
FT                   /locus_tag="Bsph_0216"
FT   CDS_pept        236873..237928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0216"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37847"
FT                   /db_xref="GOA:B1HTV6"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTV6"
FT                   /protein_id="ACA37847.1"
FT                   /translation="MSKAYEQAGVNIEAGYEAVKRMKSHVERTNRLGVMGTFGGFGGMF
FT                   DLSELNLKEPVLISGTDGVGTKLKLAFMVDKHDTIGVDCVAMCVNDIVAQGAEPLYFLD
FT                   YVALGKAEPAKIEQIVKGVADGCVQSGAALIGGETAEMPGLYEEDEYDLAGFAVGACEK
FT                   SAIVTGERIVEGDVLIGIASSGVHSNGYSLVRKIVFADRQYAVDAIVENYEDLGPIGEA
FT                   LLVPTKLYAKPVLAALKAADVHGCAHVTGGGFYENLPRMMPEGLATEIDLGSWPVLRIF
FT                   EFLKDKGQLEDKDLYNVFNMGIGFVIAAPAAEADKVMAAVEANGEKAYTIGRVIKGNGV
FT                   VFNGTHDGSLV"
FT   gene            237928..238497
FT                   /locus_tag="Bsph_0217"
FT   CDS_pept        237928..238497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0217"
FT                   /product="Phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37848"
FT                   /db_xref="GOA:B1HTV7"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTV7"
FT                   /protein_id="ACA37848.1"
FT                   /translation="MTAPTKIAVFASGSGSNFQAIQEAIERKELHAKIELVVTDKPGAY
FT                   VVTRAEHLGIPVLALNPKDFASKAAYEKVIVDALHECDVKWIVLAGYMRLISDVLLAAF
FT                   PQRIVNIHPSLLPAFPGKDAIGQALNHGVKITGVTVHFVDEGMDTGPIIAQAAVSVIEG
FT                   NREATEAAIHKQEHLLYTKALQQLLQ"
FT   gene            238603..240129
FT                   /gene="purH"
FT                   /locus_tag="Bsph_0218"
FT   CDS_pept        238603..240129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="Bsph_0218"
FT                   /product="Bifunctional purine biosynthesis protein purH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="Includes: Phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase (AICAR transformylase); IMP
FT                   cyclohydrolase (Inosinicase) (IMP synthetase) (ATIC)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37849"
FT                   /db_xref="GOA:B1HTV8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTV8"
FT                   /protein_id="ACA37849.1"
FT                   /translation="MTKRALISVSNKDGILEFAKELVALGYEILSTGGTKKMLQDNAVA
FT                   VTAVDEVTKFPEILDGRVKTLNPMIHGGLLGKFDDDSHQAQMNEHGIEPIEIVCVNLYP
FT                   FVETISKPNVTWDDAIENIDIGGPTMLRSAAKNHQYVTVIVDSNDYATVLEELKAGGAT
FT                   TIETRRKLAAKVFRHTAAYDSYISNYLTEEEFPESLTMTYELKQNLRYGENPHQKAAFY
FT                   QKRLGSDFSLAYATQLHGKELSYNNIQDGNAALQIVKEFEMPAAVAVKHMNPCGVGTGV
FT                   TLEEAFDKAYEADPTSIFGGIIALNMEVDAATAEKLSHIFLEIIIAPAFSQEALDILTK
FT                   KKNIRLLTIPFEQAKQDQFNVVSVEGGLLVQEPDRYGFANADIKVVTDREPTKQEWEAL
FT                   QLGWSVVKHVKSNAIVVTDSQMTLGVGAGQMNRVGAAKIAFEQAGEKAKGAALASDAFF
FT                   PMSDTVEAAAAAGITAIIQPGGSIKDQDSIDKANEYGITMIFTGVRHFKH"
FT   gene            240203..241462
FT                   /locus_tag="Bsph_0219"
FT   CDS_pept        240203..241462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0219"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37850"
FT                   /db_xref="GOA:B1HTV9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTV9"
FT                   /protein_id="ACA37850.1"
FT                   /translation="MNVLVIGSGGREHAIARQFNISPSVNQVFVAPGNDGMRGEVEVVS
FT                   IDTMDFAGLAQFAKENDITLTFVGPEQPLAEGIVDFFTARGLQIFGPTKMAAQLESSKS
FT                   YAKDVMSKYNIPTAAHKTFTDAEQAIAYIKEQGAPIVIKADGLAAGKGVVVAMTEQEAI
FT                   EAVQDMIGNQRFGESSSRVVIEEFLDGEEFSFMSFVHKGQIYPMVIAQDHKRAYDGDRG
FT                   PNTGGMGAYSPVPQISQEVVDIAYQTIVKPTVKGMEADGASFTGILYAGLILTKKGPKV
FT                   IEFNARFGDPETQVVLPRMASDFGAFMVALMNEQPFDLQWSEDAMLGVVIAAEGYPGDV
FT                   EKGKTLPNLAEISKSYAVFHAGTKLVDGQFVGNGGRVLLVGAKAPTLQEAQEKVYAGMT
FT                   KETWDHFFFRKDIGWRTFKK"
FT   gene            complement(241576..242022)
FT                   /locus_tag="Bsph_0220"
FT   CDS_pept        complement(241576..242022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37851"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTW0"
FT                   /protein_id="ACA37851.1"
FT                   /translation="MTKGGSNMMQQANLSEKNAFCRFAMGTSLTAFGIAKVSRNPNCTK
FT                   GRLMIALGAMKMAEGIFKYCPAKALMSTNMQNAMNTSMQSMFSGQNSMSSEQIDKLMKD
FT                   FSSAIAGNSSGSQDTASTQSDTSTSTQNSSTRSNSTSNTAQNPS"
FT   gene            242202..243923
FT                   /locus_tag="Bsph_0221"
FT   CDS_pept        242202..243923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0221"
FT                   /product="Putative adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37852"
FT                   /db_xref="GOA:B1HTW1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTW1"
FT                   /protein_id="ACA37852.1"
FT                   /translation="MDPVWKITKIRQQLAVIDGKKAPDIVLKNARYLHSMMKQWIVGNI
FT                   WILGDRIVYAGDRMPPLIEGTQVVDCTGKTVVPGYIEPHVHPFQLYHPQSFADFCGQLG
FT                   TTTFISDNLSFVLNLENKKAFSILDHLKKLPFSFYWWTRFDSQTELEQEEEVFSNTSIL
FT                   EWLERSDVLLGGELTGWPKLLHGDDQMLYRMQMAKGLGKKIEGHFPGASERTLARMKLL
FT                   GADGDHEAMTVEEVERRIMQGYAVTLRHSSIRPDLPHLLKGIVEKELPIFDHLMMTTDG
FT                   SPPSFHEDGVMDKCIQAALDAGVSPIDAYQMASYNVARYYNMSNLHGFIATGRFASLNI
FT                   LQDEYHPVPESVLSKGVWLKRDGDRVHRLAAIDYSAIPAFHLDFSLDAQDFQFSMPFGI
FT                   QLVNDVITKPYNSLITREGQLADHDECYLMLINRQGHWHVNTMIKGFATGVQGFASSYS
FT                   NTGDILLIGKNKEDMIKAFEEMKAMNGGIVLVEKGEVIADIPLSIGGLLYDGDVLTLAE
FT                   KEKALKQALAERGYHLGDAIYTLLFLQSTHLPYIRITPKGIFDVMKNKLLLPAVMR"
FT   gene            243976..245037
FT                   /locus_tag="Bsph_0222"
FT   CDS_pept        243976..245037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37853"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTW2"
FT                   /protein_id="ACA37853.1"
FT                   /translation="MLVFKTKKLWMTMAFSALVIGGCSKDTPKVKEDDERVTQEEKVVE
FT                   EQIQKPAFVAPLTGEAVQEEITQRPIVVTINNHPAARPQSGLAAADIIYEMLAEGNVTR
FT                   FLAVYQSELPENIGPVRSARSYFIDIAKGFNAFYVAHGYSPEAKTMLDNRVVDNINGMA
FT                   YDGILFKRSSERVAPHNSYITSEKIRKGAEMVGASMNYSEKVLQAFYEPDERGKIGIET
FT                   SQVDIYYGNNEDFHNSYVYDHQSNYYERQSAGVDTKDMLTGEALSLANVLFFEMDHQIV
FT                   DDIGRQTIDLTSGGNAYVFQNGYLREVKWANVNGIPTAVEQSGEPVKLVPGKSWVHFVP
FT                   SSPGLQAMVKTQP"
FT   gene            245053..245373
FT                   /locus_tag="Bsph_0223"
FT   CDS_pept        245053..245373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0223"
FT                   /product="Hypothetical yerC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37854"
FT                   /db_xref="GOA:B1HTW3"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTW3"
FT                   /protein_id="ACA37854.1"
FT                   /translation="MQIEKIRGHQTDQLFKAVLELKDIEECYKFFDDLCTISEIQSLAQ
FT                   RFEVAHLLRLKKTYESIKKETGASTATISRVRRCFDYGNDTYDEMLGRLYPDEKPFQAP
FT                   KE"
FT   gene            245606..246172
FT                   /locus_tag="Bsph_0224"
FT   CDS_pept        245606..246172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0224"
FT                   /product="PcrB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37855"
FT                   /db_xref="GOA:B1HTW4"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTW4"
FT                   /protein_id="ACA37855.1"
FT                   /translation="MTLDGVLDLLVRVRRFEVPIALEISTIDAITPGYDYYFIPTVLNS
FT                   DDPKWIKNLHHAAIKEFGDIMVWDELVAEGYCILNPDCKVAHVTGATTDLSIDDIVAYA
FT                   RMAENFFKLPVFYLEYSGIYGNPEVVSAVKNELKHTKLFYGGGITSAKQAEEMAQYADT
FT                   VVVGNIIYEDLKAALATVKAVKNTL"
FT   gene            246205..248454
FT                   /locus_tag="Bsph_0225"
FT   CDS_pept        246205..248454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0225"
FT                   /product="ATP-dependent DNA helicase pcrA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37856"
FT                   /db_xref="GOA:B1HTW5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTW5"
FT                   /protein_id="ACA37856.1"
FT                   /translation="MEQLTKNLLAGMNPEQERAVKTTEGPLLIMAGAGSGKTRVLTHRI
FT                   AYLIIEKEVYPSKVLAITFTNKAAREMRERIDGILGNGTGDSMWVSTFHSMCVRILRRN
FT                   IDQLGISRNFSILDSTDQLSVIKNVMKDENIDPKRFEPRAILNAISAAKNECITADDYA
FT                   GHMNDKNPYEQTVARVYKGYEKRLRRNQSLDFDDLIMTTITLFKRVPEVLEYYQNKFQY
FT                   IHVDEYQDTNKSQYLLVQLLAKKFKNICVVGDSDQSIYRWRGADIGNILSFEKDYPNAK
FT                   VIMLEQNYRSTKRILQAANDVIQNNTTRYPKELRTENAEGEKIALYKAYNEQEEAQFVV
FT                   QTIQQLMEKENRTFDDFAILYRTNAQSRVMEEVLVKSNMVYQIVGGTKFYDRKEIKDLL
FT                   AYLRLIANNDDDLSLARIINEPKRSIGATSFEKMARYAIEQDRSIFDAMNDLIFMGLSG
FT                   KAANSAEQFYAMIKGFTEMQEYLSVTEIVEQVIDKSGYRTMLQNEKTIEAESRLENIEE
FT                   FLSVTKAFEERSDDKSLIAFLTDLALIADIDALDKEDASKGNIILMTMHAAKGLEFPIV
FT                   FIIGMEENIFPHSRSLDDQDEMEEERRLMYVGVTRAEERLYLTCAQSRTIFGRSSFNNA
FT                   SRFLGEISEDITESISKAGAKTNVPFATSNRSSNYQKRTLGSVQQTQPATARLQSTGGD
FT                   QYGWKAGDKAVHKKWGTGMVVSVKGEGDSTELDIAFPQPIGIKRLLAQFAPIEKA"
FT   gene            248469..250472
FT                   /locus_tag="Bsph_0226"
FT   CDS_pept        248469..250472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0226"
FT                   /product="DNA ligase"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37857"
FT                   /db_xref="GOA:B1HTW6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTW6"
FT                   /protein_id="ACA37857.1"
FT                   /translation="MNEIEQRIAELNKLLHEYGYAYYVLDKPVVADSVYDQLLHELIAL
FT                   EEANPSLIFPDSPTQRVGGTVVEGFKKVTHDYPMLSLSNAFNEADLQEFDRKVRQAIGD
FT                   HFSYVCELKIDGLAISLKYENGVFVQGATRGDGVVGEEITANLKTIHAIPLRLKEPITI
FT                   EVRGEAYMPKKSFEKLNAQRADNGEELFANPRNAAAGSLRQLDPKIAASRQLSTFIYAI
FT                   GGDGEIYGIDGHAEMLDYLEDLGFPSNKERQRCSTIEEVMAFIEHWTENRPHLAYEIDG
FT                   IVIKVDRYAQQDELGYTAKSPRWAIAYKFPAEEVVTTLLDIDLTVGRTGVVTPTAILTP
FT                   VQVAGTTVQRASLHNEDLIRDKDIRLGDTVIIRKAGDIIPQVVGVLIEQRPENSVPFEM
FT                   PKNCPVCDSELIRIEGEVALRCVNPACFAQIAESIKYFVSRNAMNIDGLGDKVVEQLLR
FT                   ADLIHDVSDLYHLTIEQLVELERMGEKSATNLVNAIQASKENSMERLLIGLGIRHVGEK
FT                   AAKIVSEQFGSMEAVMAATEEQLVAIYEIGDKMASSLVEYFSNDDARAVIERLAEVGVN
FT                   MTFKGKKVEVVVGDNPFAGKTIVLTGKLEQLTRNEAKAKIEELGGTVTGSVSKKTDLVI
FT                   AGEDAGSKLAKAEQLGIEVWNEDNLIEQLNLI"
FT   gene            250558..251721
FT                   /locus_tag="Bsph_0227"
FT   CDS_pept        250558..251721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37858"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTW7"
FT                   /protein_id="ACA37858.1"
FT                   /translation="MSKGALNIMKSFRLIPALVAAAMLVGCVPSNEGGTELTQETQQNE
FT                   KTETTIIPSIQIDDSYYKTLIPYKESASRGLVVSNIFTKYDMKEVEAGLMRLSHNEFDT
FT                   ENYYFQEGQYLAESTVSSWLARSSQTEDGLNPPTTDTMTPEERATKAPIYLSHIVEQNY
FT                   LTKTKDNKVKLGGISIGLALNSIYYYQKEQYGEYYEKPISESELVEQGKKMAAEIVSRL
FT                   RTRDELKDIPIVVGLFKQQPRNQIIPGAYFSYGVAKAGQNNIADWEGIDENYVLFPTDD
FT                   SQDVYRDVSKNFKIFKQDVDKYFSNYTSVIGTGFYRNKEIQKLTIEIPIQFFGKAEIIG
FT                   FTQYLTGILINRFNNIHVEVSITSVNGPEALINKKANDTDPYVHVYE"
FT   gene            251954..252241
FT                   /locus_tag="Bsph_0228"
FT   CDS_pept        251954..252241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0228"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37859"
FT                   /db_xref="GOA:B1HTW8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTW8"
FT                   /protein_id="ACA37859.1"
FT                   /translation="MAKLTKEEVKHVANLARLAITEEEAEKFAEQLGKITDFAEQLNEL
FT                   DTANVEPTTHVLPLVNVMREDVAVKGLDREVMMLNVREQEDGQVKVPAIM"
FT   gene            252266..253729
FT                   /locus_tag="Bsph_0229"
FT   CDS_pept        252266..253729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0229"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37860"
FT                   /db_xref="GOA:B1HTW9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTW9"
FT                   /protein_id="ACA37860.1"
FT                   /translation="MTLFERSAKELQAEIKAGNLSIADLTKEAYERIAKLDGDVQAFLA
FT                   SNEEKATAQAAEMDKVPFEERGPLFGLPIGVKDNIVTEGLETTCASKILEGFMPIYDAT
FT                   VVNKLREAGMITVGKLNMDEFAMGSSNENSYYKTTKNPWNLNHVPGGSSGASAASVAAG
FT                   EVPFSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPITRNVEDNA
FT                   LLLEAIAGLDPNDSTSADVEVPNYAAALTGDVKGLRIAVPKEFLGEGVGEAARQSVLAA
FT                   LEVLKGLGATVEEVSLPHSKYALAAYYILSSSEASSNLSRFDGIRYGFRAENVTNLMDL
FT                   YKETRAQGFGDEVKRRIMLGTYSLSAGTYDAYYKKAQQARTLIKADYDKVFEDFDVIIG
FT                   PTSPTPAFKIGENVDDPMTMYANDILTIPMNLAGVPAISIPCGFDNGLPLGLQIIGKYF
FT                   DEATIYRVAHAFEQATEFHKQVPQMWEGK"
FT   gene            253731..255158
FT                   /locus_tag="Bsph_0230"
FT   CDS_pept        253731..255158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0230"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37861"
FT                   /db_xref="GOA:B1HTX0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HTX0"
FT                   /protein_id="ACA37861.1"
FT                   /translation="MNFETVIGLEVHVELKTNSKIFSPAPAHFGAEPNTNTTVIDLGYP
FT                   GVLPVLNKNVVDFAMRAALALNMEIEQETKFDRKNYFYPDNPKAYQISQFDKPIGKNGW
FT                   IDIEVDGYTKRIGITRLHMEEDAGKLSHAGDHSLVDFNRQGTPLVEIVSEPDIRTPNEA
FT                   YAYLEKLKSIIQYTDVSDCKMEEGSLRCDANISIRPYGQEEFGTKTELKNLNSFNYVRR
FT                   GLEHEELRQADVLLSGGVIEQETRRFDEKTGKTILMRVKEGTDDYRYFPEPDLVRLSID
FT                   DAWLERVKSEIPELPDARKKRYVEELGLTPYDAGVLVISKEISDFFESMIVNGADAKLS
FT                   ANWLMGDVSAYLNAEQKDLKDTALTPENLAEMVKLITDGTISSKIGKKVFAELVENGGS
FT                   AQEIVKAKGLVQISDEGALLAIVTEVLDNNAQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPMVNKLLQQEIAKR"
FT   gene            255319..255882
FT                   /locus_tag="Bsph_0231"
FT   CDS_pept        255319..255882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37862"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX1"
FT                   /protein_id="ACA37862.1"
FT                   /translation="MKSEQQYFNEAISIQQYMDNMTTLKEESFRIYDSYVVPTNDGFIE
FT                   LLKDKKPKILTITEDWCGDAMLNNPIVRRVAEAAELDMRTVFRDADTDLIDRYLTNGGR
FT                   AIPIYLLLDSTGEVIGKWGPRAPELQELVVTKRASLPDKEDPTFEEAQKALYAEIREEN
FT                   ITNPTYWTYVYDDFKKQVSNALQK"
FT   gene            255916..256869
FT                   /locus_tag="Bsph_0232"
FT   CDS_pept        255916..256869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37863"
FT                   /db_xref="GOA:B1HTX2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX2"
FT                   /protein_id="ACA37863.1"
FT                   /translation="MNEIESYEAGRYVMKRARIIYNPTSGREAFKKHLPEVLEKLEVAG
FT                   YETSCHATTGEGDATLAAKDAVDRGFDIIIAVGGDGTLNEVVSGVSPFENRPKVGLIPM
FT                   GTTNDFARAVHIPRNIDEAVDIIIQGDTLPVDVGLLNGERYFINIAAGGRITELTYEVP
FT                   SKMKTMLGQLAYYLKAVEMIPSIKASHMRIEYDGEVFDGDAMMFLCGLTNSVGGFEKLA
FT                   PDASINDGYFTLLVLKKVSLPEFIQLAAMALRGEHLNDDRVIYKKASVVKVTTENEVHL
FT                   NLDGEYGGDAPATFENLKRHIEIFVPLADIREEDRI"
FT   gene            257186..257308
FT                   /locus_tag="Bsph_0233"
FT   CDS_pept        257186..257308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37864"
FT                   /db_xref="GOA:B1HTX3"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX3"
FT                   /protein_id="ACA37864.1"
FT                   /translation="MDKGKEVLLLYKSQEKKLIWLSFGVAIIMLLSILGRIFGS"
FT   gene            257320..258666
FT                   /locus_tag="Bsph_0234"
FT   CDS_pept        257320..258666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0234"
FT                   /product="Cytochrome d ubiquinol oxidase subunit 1"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37865"
FT                   /db_xref="GOA:B1HTX4"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX4"
FT                   /protein_id="ACA37865.1"
FT                   /translation="MINESAVYWSRALTELTLSFHIIYATIGVGVPLMIMIAQWTGYKK
FT                   NDEHYILMARRWARGFVITVAVGVVTGTAIGLQLSLLWPNFMQLAGQTIALPLFLETFA
FT                   FFFEAIFLGIYLYTWDRFDSQKKHMLLLIPVAVGASMSAVFITIVNAFMNAPRGFDIVD
FT                   GELVNIQPFLAMFNPAMPTKVAHVLVTAYMTSAFVLAAIAGYRMLKGSKHVYHKKSLLL
FT                   LMKIGLIFSIAAAVIGDFSGKYLAEYQPEKLAAAEWHFETEGKASLVLFGVLDGEEVKY
FT                   AIKIPYALSVLAHFNPNEEVIGLDQFEEEDLPPLYIHYLFDIMVSIGMFMVLVSLLYVV
FT                   GKARGWQFIHSRWYRWIIVAGGPLSIIAIEAGWWLAEVGRQPWILYGLMRTPEGATTSD
FT                   HVDLMLLLFAGVYAVLAVGSIVVLVRMFKKNPIEREIEDRHSEKGGDIL"
FT   gene            258663..259688
FT                   /locus_tag="Bsph_0235"
FT   CDS_pept        258663..259688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0235"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37866"
FT                   /db_xref="GOA:B1HTX5"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX5"
FT                   /protein_id="ACA37866.1"
FT                   /translation="MTLEILGISVLWIFLFGYVIVASIDFGAGFFNAYSLLIGKNHILT
FT                   NIIKRYLSPVWEVTNVFLVFFFVGIVGFFPQTAFYYGTILLIPVSISLVLLAIRGSYYA
FT                   FESYGTRGHIGYTLTYGVAGLLIPASLSVVFAIAGGGYVDLVNGQPVLNYWTLYTSPFA
FT                   WSIVVLSIAAVLYISAVFLTWYAHKANDKEATKLMRKYALLWAAPLMVSALGIMYEMKS
FT                   INPESYGHMVNLWWMFAISAILFMITVLLLALRKKYGLAVALLIAQFAVAFFAYGIAQY
FT                   PYLLYPYLTIYDGFTSTQMAIALIIAFILGLCLLLPSLYLLMKLFLFNKNYVTGKEDNH
FT                   A"
FT   gene            259703..259825
FT                   /locus_tag="Bsph_0236"
FT   CDS_pept        259703..259825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37867"
FT                   /db_xref="GOA:B1HTX6"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX6"
FT                   /protein_id="ACA37867.1"
FT                   /translation="MQSFLIFYAPFIVVILGILCAFWWAPRDYHITKEQGKSRE"
FT   gene            259920..261299
FT                   /locus_tag="Bsph_0237"
FT   CDS_pept        259920..261299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0237"
FT                   /product="Hypothetical RNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37868"
FT                   /db_xref="GOA:B1HTX7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX7"
FT                   /protein_id="ACA37868.1"
FT                   /translation="MEDVRMSAPVKKNERLSVYIEDLTHDGNGVAKVDGYPLFIQGALP
FT                   NETAEIHVMKTLKNYGFAKVVDIIKPSPDRVEAPCDYFKQCGGCQLQHLSYEGQLKWKE
FT                   NMVRNVMQRIGKIDAPVLPVKGMKEPWHYRNKAQIPFSENEAGQAIAGFYKTKTHSIVD
FT                   MERCLIQTGEADAILVGLKKELVAIGMRPYNELSHEGMLRHVVIRKARATGEVMVVLVT
FT                   KKKKFPQKEAAIAVIQKLVPNVTSIMQNVNHEKTNVIFGDDTLNLWGKDVIIDTIGDVR
FT                   FEISARSFYQVNPEQTEVLYKQALDYANLQGDERVIDAYCGIGTISLFLAQKARAVMGV
FT                   EIVPQAIEDAKRNAVLNGFTNTYFEAGPAEEVIPRWYKEGKEADVLVVDPPRKGCDEAL
FT                   LTTILEQRPKRVVYVSCNPATLARDLRILENGGYQTQEIQPVDMFPHSTHCEAVAWLEL
FT                   V"
FT   gene            261416..262384
FT                   /locus_tag="Bsph_0238"
FT   CDS_pept        261416..262384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37869"
FT                   /db_xref="GOA:B1HTX8"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX8"
FT                   /protein_id="ACA37869.1"
FT                   /translation="MIDNFWRDLPRPFFVLAPMEDVTDVVFRQVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGQKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSRGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGYKDVEEWEEWLTHIFK
FT                   QDIANLSIHLRTRKEMSQVDAHWELIPEIKKLRDCIAPNTLLTINGDIPDRQTGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPKEHSSKEYLDLLRLQLDLQDQYEEVLPRSITGLHR
FT                   FFKIYVKGFRGASELRSQLMNTKSTDEVRALLDRFEANHVE"
FT   gene            262577..264223
FT                   /locus_tag="Bsph_0239"
FT   CDS_pept        262577..264223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0239"
FT                   /product="Aerobic glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37870"
FT                   /db_xref="GOA:B1HTX9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTX9"
FT                   /protein_id="ACA37870.1"
FT                   /translation="MMSTASALQRQQTIEELQDREYDLLVIGGGITGCGIALDAIARGL
FT                   SVALVEMQDFAAGTSSRSTKLVHGGLRYLKQFEIKEVAELGKERAIVYENGPHVTTPVW
FT                   MLLPFHKGGTFGKYSTNLGLRVYDFLAGVKRAERRYMLSTGQTIEKEPLVKTEGLLGGG
FT                   MYVEYRTDDARLTIEVAKAAIERGATLLNYIKAENFLYNEQQKIRGIVATDLLTNHPIE
FT                   IRAKAVVNAAGPWVDDVRTIEGKQAGKHLILSKGVHIVFDESKFPLKQAVYFDTPDGRM
FT                   VFAIPRQGKTYVGTTDTFYEGDARNMDIYQEDRNYIMKAIHYMFPNVKVEDADIESSWA
FT                   GVRPLIHEDGKNPSEISRKDEVWISPSGLVTIAGGKLTGYRKMAETVLNTIAQELDQQF
FT                   GIKSSPCTTKNIPISGGHMGGSNKFYAFLYDHTRLGKKIGLSEEEAKFLSQHYGSNVEI
FT                   VFNYVKEGHSILPSWLYAQLMYGIHHEMVVHPNDFLVRRTGYMFFQMATVQQYEEAILD
FT                   EMAKQLNWTTQQRTQYEEDVKKEIKRATTAL"
FT   gene            264295..264852
FT                   /locus_tag="Bsph_0240"
FT   CDS_pept        264295..264852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0240"
FT                   /product="Glycerol uptake operon antiterminator regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37871"
FT                   /db_xref="GOA:B1HTY0"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY0"
FT                   /protein_id="ACA37871.1"
FT                   /translation="MHFDNQQVIPAARTVKQFDEIIASPFDYIVLLEVHISLLMSLKRE
FT                   AYRHGKKLIIHADLIHGLKTDNFAADFLCNDIRPAGIISTRSNMLMKAKARGIMAIQRV
FT                   FLIDTIALEKSYSMIETAQPDYIELLPGIIPSMIQEIYERTQIPVITGGLVRTVDNIEE
FT                   ALAGGAIAVTTSNRQLWENFKK"
FT   gene            265015..265818
FT                   /locus_tag="Bsph_0241"
FT   CDS_pept        265015..265818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0241"
FT                   /product="Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37872"
FT                   /db_xref="GOA:B1HTY1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY1"
FT                   /protein_id="ACA37872.1"
FT                   /translation="MSTFTAELVGTMILILFGGGVVAGAVLNKSKGFGGGWIVITFAWG
FT                   LGVAMAAYAVGGISGAHLNPALTIALATIGNFPWADVPSYIAAQMIGAFLGATLVYFMY
FT                   LPHWQATADADVKLAPFSTMPAIKHPLSNLLSEMIGTFILVLGILALGTNTITDGLNPF
FT                   LVGLLIIVIGMALGGPTGYAINPARDLGPRIAHFILPIAGKGDSGWSYAWIPVVGPIIG
FT                   GTFGALFFQQIFEGKNSLAFWIVAVIVIAIFIGAQLTVKNVQVED"
FT   gene            265838..267334
FT                   /gene="glpK"
FT                   /locus_tag="Bsph_0242"
FT   CDS_pept        265838..267334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="Bsph_0242"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37873"
FT                   /db_xref="GOA:B1HTY2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY2"
FT                   /protein_id="ACA37873.1"
FT                   /translation="MSEKKYILALDQGTTSSRAILFDETGKIVHTAQQEFQQHFPQAGW
FT                   VEHHAEEIWSSILSCIATVLSEKGVSSSQIAGIGITNQRETTVVWDKHTGKPVYNAIVW
FT                   QSRQTNDICERLKESGYNDLFREKTGLLIDAYFSGTKVKWILDHVEGAREKAEAGELLF
FT                   GTIDTWLIWKLSGGKVHVTDYSNASRTLMYNIHDLKWDEELLEILTVPASMLPEVRPSS
FT                   EVYGYTEEALFFGSAVPIAGAAGDQQAALFGQACFEEGMVKNTYGTGCFMLMNTGEKAV
FT                   KSNNGLLTTLAWGLDGKVTYALEGSIFVAGSAIQWLRDGLRMFRSASESEQYATRVEST
FT                   DGVYVVPAFVGLGTPYWDSDVRGAIFGLTRGTAKEHFVRATLESLAYQTKDVLAAMEAD
FT                   ANIPLAKLRVDGGAVANDFLMQFQADLLDVPVDRPIINETTALGAAYLAGLAVDYWHST
FT                   EEISKYWNLDRQFTPNMSNDHRDKIYGGWKKAVAAAQVFK"
FT   gene            267534..267752
FT                   /locus_tag="Bsph_0243"
FT   CDS_pept        267534..267752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37874"
FT                   /db_xref="GOA:B1HTY3"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY3"
FT                   /protein_id="ACA37874.1"
FT                   /translation="MPFALAIGALATDADGGVLVGMHGFLFIQGLPFVILLIFLFEEGE
FT                   ESVQFFIELCIFVVRNRGFREMSENCI"
FT   gene            267796..269157
FT                   /locus_tag="Bsph_0244"
FT   CDS_pept        267796..269157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0244"
FT                   /product="Probable periplasmic serine protease DO-like
FT                   precursor"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37875"
FT                   /db_xref="GOA:B1HTY4"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY4"
FT                   /protein_id="ACA37875.1"
FT                   /translation="MVVTMRPLKIKYKKLANPFQEFMQISPNNNALTKEVVFLRYIGIP
FT                   DSVDLYKEDILKMDEYFTKQSVFYLRLHRLEVINNKKDADRLSELWGEWQAAADSIQLL
FT                   YETSLCGKLANNQLEWTKKLSFKNILHLFKEQQPHANDTLLKNFAVKFLYWMDYYLPQI
FT                   FSKENQASPKIVFIGDITQHESLFLYFLSTLGCDICYMNPKGDITNLYPIIAAASNLQS
FT                   CSDYYEKEFIIPEMLSMKSIPPQQPTILPTPSSRMVTREECSYEQLASLATSVVMIKTF
FT                   GVDHKVICFGSGVVLHQEGYILTNLHVVSGGEYYSVLYENDSNEYTTHQFVKYHDIHDL
FT                   AILKVARTSQPLPVKMDGHLVRGQKIVAIGSPLGLFNSISDGIVAGFRDIRKMSMVQFT
FT                   AAISNGSSGGALLDMQGRLVGLITAGFDDGQNLNLAVPAHVIYQFAQNFIELPS"
FT   gene            269471..270667
FT                   /locus_tag="Bsph_0245"
FT   CDS_pept        269471..270667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0245"
FT                   /product="Hypothetical metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37876"
FT                   /db_xref="GOA:B1HTY5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY5"
FT                   /protein_id="ACA37876.1"
FT                   /translation="MDYRKKTVVASVAGLTLEGMDIMFISFAMTMIIAEFNIDLATGGL
FT                   ISSITNIGMLLGGIIFGVLADKYGRVKVFTYTIILFAIGTALTGVATSIEQVYVYRFIA
FT                   GLGAGGEYGIGMALVAEAWPKNKQGRASSYVSVGAQYGVILAALLSAVILPTLGWRALF
FT                   FIGVLPVIFAFIVRKNLHESPEWLASQKNESNMQKKGKLAQLFVTPRVTMTTLSLILMA
FT                   TVQIAGYNGLMIWLPSMLQKSQGLSVSSSALWTISTAVGMIIGMLTFGRFMDRFGAKRA
FT                   FGIFLLASACAVFLYSFATGAVAILMGGAIVGFFSNGMFAGYGALISSFYPVQIRSTAT
FT                   NTIFNFGRAIGGFSPIFVGYILQSYDMTVVMIYLAALYGISFMVMLTLKGSTEALQTA"
FT   gene            complement(270745..270948)
FT                   /locus_tag="Bsph_0246"
FT   CDS_pept        complement(270745..270948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0246"
FT                   /product="small acid-soluble spore protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37877"
FT                   /db_xref="GOA:B1HTY6"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY6"
FT                   /protein_id="ACA37877.1"
FT                   /translation="MANNNRSSNKLLVPGVQEAVNQMKYEIAQEFGVQLGPEASSRANG
FT                   SVGGEITKRLVEIAEKRSKGLL"
FT   gene            271136..271631
FT                   /pseudo
FT                   /locus_tag="Bsph_0247"
FT                   /note="This region contains a gene with one or more
FT                   premature stops or frameshifts, and is not the result of a
FT                   sequencing artifact; conserved hypothetical protein;
FT                   identified by sequence similarity; putative"
FT   gene            271779..271973
FT                   /locus_tag="Bsph_0249"
FT   CDS_pept        271779..271973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37878"
FT                   /db_xref="GOA:B1HTY7"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY7"
FT                   /protein_id="ACA37878.1"
FT                   /translation="MIYFDILLVAIACVTMPFIVAVMLDIFYAERKKVRFSLRRTSLWY
FT                   MAMFALSFIPSVLLMTQNV"
FT   gene            272275..272436
FT                   /locus_tag="Bsph_0250"
FT   CDS_pept        272275..272436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37879"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY8"
FT                   /protein_id="ACA37879.1"
FT                   /translation="MPISFGIGFLFAKTYKEEESHEVMEKHLIKKQTFTDGFHCCVIAY
FT                   SRHYYTKY"
FT   gene            272396..274087
FT                   /gene="tlpC"
FT                   /locus_tag="Bsph_0251"
FT   CDS_pept        272396..274087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlpC"
FT                   /locus_tag="Bsph_0251"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37880"
FT                   /db_xref="GOA:B1HTY9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTY9"
FT                   /protein_id="ACA37880.1"
FT                   /translation="MLLLIAVITTQSIKELNNRMTVDLEQELTSVGLLTAMNLDSDEVK
FT                   DLLSEKGETNAKFTKVQKQLDLIQEQQGIMSWSYIWDVQDEGGVNPIGYTSNLNEVYEA
FT                   GEIFTDLANEHVETAKLAIQNNSTEVTDIFEDPFGSWRTVFSPIHDDNGQLIALLGIDY
FT                   SADYINTIIKASVIKQIVIAIIGILILLVLVYIIIDRLLKPLQKVVNVANQVANGELIN
FT                   VDLDITKDEIGNLSASIQTMVANLQHIILNIRNTSNHVSSAATQLTVNAGETYNSSTNI
FT                   ANDVKQITQNAEASMTMTEETAAAMEETATGIQQIADSANTATESSISASQASERGNQV
FT                   VHQVIAQMELINESVEQIGTTINGLHVNTKKISDIVSLITAIADQTNLLALNAAIEAAR
FT                   AGEHGKGFAVVADEVRRLAEQSSQSATEIYNLISSIQADSNASLTVMEKGKEDVKVGMT
FT                   FTNEVGEIFKEILTSSEEVANQIREISAASQQISASSEEVAASVNNIKQSAELSADFSS
FT                   NVSKSTQEQLTTMQEVKDASSALGQTAEELQALVTKFKLENDQDEH"
FT   gene            274077..274829
FT                   /locus_tag="Bsph_0252"
FT   CDS_pept        274077..274829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0252"
FT                   /product="3-oxoacyl-reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37881"
FT                   /db_xref="GOA:B1HTZ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ0"
FT                   /protein_id="ACA37881.1"
FT                   /translation="MNIDFTGKNVLITGSSKGIGKAIALGFAQHGANIVINYIGDKPEA
FT                   EAVRMEAEKFGIKALTFHADVSKSEEVQDMYQYMDKHLGKIDILVNNAGFAQASSITDL
FT                   TDEQWDRMIKVHLYGCFYNCREAAKRMKERDTGKIINISSDIGSLGCEEFTHYSAAKGA
FT                   INAFTKALARELAPTILVNAVAPSGTFTDILKEFGDNYVEEESAKYPLKRLAQPEEIAK
FT                   SVLFLASQHADFYTGQILTPNGGVVMNG"
FT   gene            274851..276341
FT                   /locus_tag="Bsph_0253"
FT   CDS_pept        274851..276341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0253"
FT                   /product="Sodium/proline symporter (Proline permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37882"
FT                   /db_xref="GOA:B1HTZ1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ1"
FT                   /protein_id="ACA37882.1"
FT                   /translation="MLNIIIFSLYLVFIYYIGYKGYKRVNTAEDLIVAGWSMPLSVVTG
FT                   SLVAALLAAPFFFAAVGSGYTSGGFEGSATMGGLGTCMILGALIWTKPLRRLKGWTLAD
FT                   YYGLRYGSKKLGAYTGVVMAIAFGVFNAAALTVGGTYIIQQLLQIDFIPAALLFVSLTA
FT                   IYSVIGGLWAVAYTEIVQGALAIAGILGITIFILFYYPDVTFNPEWWNIHTLFDKAGAE
FT                   FWTLYLVLALGDIPAVDLGQRVAAAKSPKVAQRSMIIAGTIVIAISWIPGMLGEAFKSI
FT                   YPNSTNPETLMLTFAQGYFPPLLAAIFLTAMAAMGMSTVAACYVATSGIVTKNIYLDFI
FT                   NRNPDPKKLLRFSRSVILSSALLGLVLAISFQKVIDLAYLAWDVIFVTIFWPIVLGPFW
FT                   KRVSTPAVWASISVGLIYYIVTSLTFVPSLTIQSEGFLGLLNELWQAPVFSGVVITGIT
FT                   IVVVSLLVPPSQHVLEMHKIEKDKTLDDVGSKEELVGR"
FT   gene            276487..277170
FT                   /locus_tag="Bsph_0254"
FT   CDS_pept        276487..277170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37883"
FT                   /db_xref="GOA:B1HTZ2"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ2"
FT                   /protein_id="ACA37883.1"
FT                   /translation="MNIIFFILLGIIYFFLANAIEVAIIKQLFFLIGLTLVSIGIIRYI
FT                   KERYIESQNYAEMKEASEEEMKAIPHTQCLISQDALKGLLLNEHTNMLIFAHREELEEE
FT                   LKIIEIPFSKIYEVAMMEDEMFVLRTKNYLMSGSLLGEEENVAEEEEEVEEDDTVSQLS
FT                   LKFVVDHLSEPILEYMFMDQGEHPIARDEEEYEEAMELCEKWFQKISVIIKRHELERVP
FT                   IRHWQ"
FT   gene            complement(277229..278923)
FT                   /locus_tag="Bsph_0255"
FT   CDS_pept        complement(277229..278923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0255"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37884"
FT                   /db_xref="GOA:B1HTZ3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ3"
FT                   /protein_id="ACA37884.1"
FT                   /translation="MKGIFQFKTLKAKILSAFILLLVLVVSFTAYTYTSNTAMEKQAKA
FT                   LVKEDLVVLNASNNLALSMSVRLSAALNYVLTGDEKYKETFNEYRQIAEDNNALLDKYD
FT                   TSEERTKTVELARDWSQIVKTEVFDVYQQGNKELALENLMDTQNLVSSVRNGYEQLAND
FT                   REEAITAVGNDVVTTSSTNRTIGIIVSSILTIIGILIAIVTASTISKPIKVVANRMKEL
FT                   ADGNLQLDPLTVKTRDEIGTLMSAANDMNDQLKQTIQSIYTVSETVAASSEELAQSSNE
FT                   VQAGTEQITVTMQELASGTETQASTTGDLAETMTAFKRSIQETTQEGTELKDHSSQVQD
FT                   LTISGKNLMIQSTQQMAAINEIMLDSVKKVENLNDQSAEISKLVSVIDDISNQTNLLAL
FT                   NAAIEAARAGEHGKGFAVVADEVRKLAEQVQFSVTDISTIVNRIQGETGTVTTALQTGY
FT                   EEVKRGTAQLDQTSETFEQISSAVEDMIDNITTISNNLNQLADGSETINASIDEMASIS
FT                   QESAAGVEQTTATVEETAATMDEIARSANLLAGLAEELNGQLKQFKI"
FT   gene            complement(279188..280183)
FT                   /locus_tag="Bsph_0256"
FT   CDS_pept        complement(279188..280183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0256"
FT                   /product="L-Ala--D-Glu endopeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37885"
FT                   /db_xref="GOA:B1HTZ4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ4"
FT                   /protein_id="ACA37885.1"
FT                   /translation="MHRHFIFLLTFILLGITLCPADSFAKEEATEEEIVQQRMSYYVQF
FT                   DELLIPWHFLAAIDQYERNLQSVRKDIPKRDGYLSIQFSDEYWSGALNPIKEDSKPETI
FT                   SYFGGMGLDGNNDGIASPKDDEDVIFSMASYLAKYGTTDEDFKLALWEYYGSEEAVNQI
FT                   FTISTLYRHYKTIELDAHTFPLNISSTYSYKGTWGANRGWGGRRIHEGTDIFANYGTPV
FT                   LSTSYGVVEVKGWNQFGGWRIGIRDNHNSYHYYAHLGSYHKDIEVGTIVEPGTVLGYVG
FT                   SSGYGKEGTSGKFPPHLHYGIYKFNGRTEWAFDPYPSLLQWERQAKSKKQ"
FT   gene            280345..282294
FT                   /locus_tag="Bsph_0257"
FT   CDS_pept        280345..282294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0257"
FT                   /product="Protein prkA"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37886"
FT                   /db_xref="GOA:B1HTZ5"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ5"
FT                   /protein_id="ACA37886.1"
FT                   /translation="MSFTSYYVINQALNGGKAINILDKVKSYREEENRLKWEGTFADYL
FT                   NIVRERPEVAQTAHSRVYNMIKSAGVEERDGQKMYKFFGHEIFGLETAIERLVEEYFHP
FT                   AARRLDVRKRILLLMGPVSGGKSTIVTLLKRGLEQYSRTDEGAVYAIKGCPMHEDPLHL
FT                   IPHHLRNDFFEEYGIRIEGSLSPLNTMRLEKEYDGRIENVMIERISFSEDKRVGIGTFT
FT                   PSDPKSQDIADLTGSIDFSTIGEFGSESDPRAYRFDGELNKANRGMMEFQEMLKLDEKF
FT                   LWNLLSLTQEGNFKAGRFALISADELIVAHTNETEYRSFISNKKNEALHSRIIVMPIPY
FT                   NLKVSQEEHIYEKMIKESDMSHVHIAPHALKAAAIFSVLTRLEVPKKQGVDLIKKMRLY
FT                   DGENVEGFNSVDLEELKKEFPNEGMNGIDPRYIINRISSAIIRKEVPSINALDVLRALK
FT                   DGLDQHASISQEDREKYMNYIAVARKEYDEIAKNEVQKAFVYSYEESAKTLMNNYLDNV
FT                   EAFCNKNKLFDPLTGEEMNPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKR
FT                   FDYNSHERLREAIQKKLFADLKDVVKITTSSKMPDESQLKKINEVVARLVDEHGYNTTS
FT                   ANELLQYVGSLLNR"
FT   gene            282471..283628
FT                   /locus_tag="Bsph_0258"
FT   CDS_pept        282471..283628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0258"
FT                   /product="UPF0229 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37887"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ6"
FT                   /protein_id="ACA37887.1"
FT                   /translation="MTEHENKGFVISQENWSLHRKGHQDQQRHMEKVKDAIKNNLPDLV
FT                   SEESIVMSNGREVIKIPIRSLDEFKIRYNYDNSKHVGQGQGDSNIGDVVARDGSKANQA
FT                   QGKGKEAGDKPGQDYYEAEVSIEEIQNVLFRELELPNLQQKEKAEIVTEKIDFNDIRKK
FT                   GLMGNVDKKRTILNALKRNAMQGKAEITPIHNDDLRFKTWDEVVKPESKAVVLAMMDTS
FT                   GSMGAFEKYCARSFFFWMTKFLRSKYGTVEIEFIAHHTEAKVVTEEEFFTKGESGGTIC
FT                   SSAYKKALELIEEKYSPSRYNIYPVHFSDGENISMDNEKCLKLVAELMNVSSMFGYGEV
FT                   NQHNRFSTLMYTYKKIDDPKFRHHILRKKGDVYDALKSFFKKNEE"
FT   gene            283674..285077
FT                   /locus_tag="Bsph_0259"
FT   CDS_pept        283674..285077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0259"
FT                   /product="Stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37888"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ7"
FT                   /protein_id="ACA37888.1"
FT                   /translation="MDTKELHRAIDEITEIASGFGLDFYPMRYEICPADIIYTFGAYGM
FT                   PTRFSHWSFGKQFHKMKLQYDLGLSQIYELVINSNPCYAFLLDTNTLTQNKLIIAHVLA
FT                   HCDFFKNNVRFSNTRRDMVESMTATAERIAGYEREYGKDEVEQFLDAVLAIQEHIDPSI
FT                   LRPKLSWSEEDELEEEKAPIKSPYDDLWSLEEKDKVYKPIRRRLKQFPPKPEKDLLLFL
FT                   EEHSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWASFWHQRIMRELNLTTPETIE
FT                   YAKLNAGVVQPSKTSINPYYLGIKIFEDIENRYNNPTEEMKRLGVQPNTGREKIFEVRE
FT                   VESDISFIRNYLSKDLAKREDLYLFQKKGNEYRITDKDYEMVRDQLVSMRVNGGFPYIL
FT                   VKNGDYLRNGELYLMHGYEGMELDPHYLENVLPYIYQLWGRPVHLETYVDGKPMLYSYD
FT                   GTKNYKRNV"
FT   gene            complement(285131..285565)
FT                   /locus_tag="Bsph_0260"
FT   CDS_pept        complement(285131..285565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37889"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ8"
FT                   /protein_id="ACA37889.1"
FT                   /translation="MKGGQTMQSFNSRKFNDPEEPENNSTEKHARNHITFNFTFNIGNT
FT                   DFHFEQRAEGGGQINEDVGTNANQGGQNASDGSHTRNVNSQFADGNGRSGIAGNNNDEA
FT                   GGQQGIKVRDSLVIDSDIHSSSNHSESHEEDNDLTEETEE"
FT   gene            285686..286603
FT                   /locus_tag="Bsph_0261"
FT   CDS_pept        285686..286603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37890"
FT                   /db_xref="GOA:B1HTZ9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:B1HTZ9"
FT                   /protein_id="ACA37890.1"
FT                   /translation="MGFEYLGNWNGEGKLKTFKKVYIEITSVCNLACSFCPPTARAKGL
FT                   IKVEQFNKILDEIRPHTKYIYLHVKGEPLLHPRIDQLLDAAHAKGFKVNITTNGTLIKK
FT                   NREKILGKPALRQINFSLHSFDGHEGSENREKYLGDILDFVRESREYKTIISYRLWNLQ
FT                   KDHVSDVAARRNRETLEILENEYNLDFRIEEKVEPGKGVKIGPNIYLNQDHEFRWPSLL
FT                   EPEDEGKGFCHALRSQAAILVDGTVVPCCLDGEGVINLGNVHEKSFAEIVDGERATNII
FT                   DGFSRREAVEELCRKCGYRQKFGM"
FT   gene            complement(286634..287032)
FT                   /locus_tag="Bsph_0262"
FT   CDS_pept        complement(286634..287032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0262"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37891"
FT                   /db_xref="GOA:B1HU00"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU00"
FT                   /protein_id="ACA37891.1"
FT                   /translation="MNHMSDFLKLVGEQLRIIRLSKGLSQEEVAERTGKLGFSKGRVSN
FT                   IEHGQSNITLSTLETLMKALDIPPEELFNFQKLSGVTDIEEKNLMLDIHRSLLRERNLD
FT                   EVKYVVRITKDFLDTIDSQSKKNSPNGQ"
FT   gene            287224..287910
FT                   /locus_tag="Bsph_0263"
FT   CDS_pept        287224..287910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37892"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU01"
FT                   /protein_id="ACA37892.1"
FT                   /translation="MEDESKVKYLLEEIAKIKIGKVVTSKKRFAMDGIPYITEEVLRKL
FT                   SLEDNTSLLPKVDSTLKEPFSFSLVPAQSILLNKMNLKEAYIYQCKTDVCISHDIMAII
FT                   PKESILIGDYLFHFMKWYQNNKERCNVYSLMIDLPSIAIQHNVVQLINAVEQLLKNKGS
FT                   LVTAVNELPKYFDNISRQVKQHSDSLHEGFEQLNDQYIAMLDHIFNGDFLNDFQEYHVF
FT                   QSICSE"
FT   gene            complement(287960..289630)
FT                   /locus_tag="Bsph_0264"
FT   CDS_pept        complement(287960..289630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0264"
FT                   /product="Zn-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37893"
FT                   /db_xref="GOA:B1HU02"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU02"
FT                   /protein_id="ACA37893.1"
FT                   /translation="MSTKKQLLSIFALGGINEIGKNMYVVQYADDMILIDCGAKFPDET
FT                   LLGIDLIIPDITYLLENKEKVKALIVTHGHEDHIGGIPYLLKKLNVPVYATRFTLGLIE
FT                   LKLKEHKLLRETDLIEIHADSALHLGEIDVSFFRTNHSIPDCLGIVLATPEGNVVHTGD
FT                   FKFDLTPVNNQFADIHKMAEIGSKGVLVLISESTNAERPGLTPSEQLVGHHIEEAFFHA
FT                   ERKIIISTFASNVNRIQQIVHATIAANRKLALLGRSMVNVVDVAIERGYLFVPDDLLID
FT                   AREVKYLPPEEVVVLCTGSQGEPLAALARLANGNHREVKVLPDDMVILAASPIPGNEKG
FT                   VSRIVDHLFQLGAKVIYGSSSHTGMHVSGHGYQEDLKLMLTFMKPQFFIPIHGEFRMLH
FT                   QHRLLAEAVGVQKGHTFIMKNGDVVDIENAVARQTRKVPSGDTYVDGIGIGEVEGIVLR
FT                   DRKQLSEDGMLVIVLTLSKADGAIISEPDTISRGFVYAKDFEELLNKVNVLTKEIIMEL
FT                   QQESRQIHVLRREIKKAVGQYLFTKTKRKPMILPIIIEI"
FT   gene            289840..290604
FT                   /locus_tag="Bsph_0265"
FT   CDS_pept        289840..290604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37894"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU03"
FT                   /protein_id="ACA37894.1"
FT                   /translation="MSDFVQHAIFEHRFWLEIMQNHAQFIHDALYPSEQDDIQRANSFI
FT                   QQFSRLLTYVSSIDATNAVAFTITVDDNVEQFKQFKLHLLRHQLSGDIGIHLTPTFVNH
FT                   MVNELEEYQNVLSYLRKGEVPPIFHELHHHLIWLLDASGHAGIIQDNLDGVEKRLKQKS
FT                   HEFAKHFEQFYLKAVELTGYLRTNMHSFPALSRFNKDVELEMTLFKTFLKELEEMELSA
FT                   EVLGTFTAPMADHMWREEQYYLMKLVQSRGEG"
FT   gene            complement(290643..291137)
FT                   /gene="ykuD"
FT                   /locus_tag="Bsph_0266"
FT   CDS_pept        complement(290643..291137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykuD"
FT                   /locus_tag="Bsph_0266"
FT                   /product="Spore protein ykuD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37895"
FT                   /db_xref="GOA:B1HU04"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU04"
FT                   /protein_id="ACA37895.1"
FT                   /translation="MIHTVKPGETLIQISRDYRTPVASIIAANPGIQSGTLYVDQPIII
FT                   PGFPDPETIPYRIEISTENRWLRLYRNSILQKQYPIAVGRMLHETPVGSFIIINKDPNP
FT                   GGPFGTMWMSLSKEHYGIHGTNDPSSIGHAVSHGCIRMQNPDVEELASIVPIGTEVVIH
FT                   P"
FT   gene            291261..291494
FT                   /locus_tag="Bsph_0267"
FT   CDS_pept        291261..291494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37896"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU05"
FT                   /protein_id="ACA37896.1"
FT                   /translation="MKEFKITYFFDEIHYVRRFIFIESQQEAEKLVKSERDQYISFTDS
FT                   RGIYHELHTRHVRVIQISEYHRIDKSAKRNDT"
FT   gene            291537..291749
FT                   /locus_tag="Bsph_0268"
FT   CDS_pept        291537..291749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37897"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU06"
FT                   /protein_id="ACA37897.1"
FT                   /translation="MMDKEQIPHEKKIFMNLNSKDKPDMVESDTISLFDLHEDMQTVDA
FT                   IPVEELNKRVEREGDELIELQPDEL"
FT   gene            291762..291959
FT                   /locus_tag="Bsph_0269"
FT   CDS_pept        291762..291959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37898"
FT                   /db_xref="GOA:B1HU07"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU07"
FT                   /protein_id="ACA37898.1"
FT                   /translation="MNRENGDAQFSVSGTNIDEVKQKNAESGLSYNEVKALLAKQGGHG
FT                   TAVFSDTNVDEVKQEIHKHQ"
FT   gene            292320..292904
FT                   /locus_tag="Bsph_0270"
FT   CDS_pept        292320..292904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37899"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU08"
FT                   /protein_id="ACA37899.1"
FT                   /translation="MARPIELSNVTQIYLEEYQRILKKMMQGMTYVTITCSISENFIKQ
FT                   IIPYQIAAIQMSENVLRFTTNIPVQNLALEIIRTHTEMLESIEALQNRCCVVQNSEYEL
FT                   YEYMCAYKEITEAMFNAMCAPPVSNSININYLREMIVHHQGGIRLAQNVLRFCICQELI
FT                   PILKCMIQTLCEQLEAMEKLLDSLQNCDCEC"
FT   gene            292949..293074
FT                   /locus_tag="Bsph_0271"
FT   CDS_pept        292949..293074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37900"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU09"
FT                   /protein_id="ACA37900.1"
FT                   /translation="MVLALFLHENSLSKNNEEMSIKARLKIHVLVSGIMALAKSY"
FT   gene            293142..293282
FT                   /locus_tag="Bsph_0272"
FT   CDS_pept        293142..293282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37901"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU10"
FT                   /protein_id="ACA37901.1"
FT                   /translation="MWEYYTGRKNEAEKYLQEISEKYFVVIEKLKALNEILLDGKKQYI
FT                   H"
FT   gene            complement(293328..293933)
FT                   /locus_tag="Bsph_0273"
FT   CDS_pept        complement(293328..293933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37902"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU11"
FT                   /protein_id="ACA37902.1"
FT                   /translation="MLYALLGDLHSNIEDTKAVLTHIQQTAKEAKIIGLGDLYECTISK
FT                   KKAQTMSGLSLQRAAIVESKFEELLTFPSIRGNQEERITQVTGIERFRALPEIMEIDGA
FT                   TLMHGHQFKWSVSWQPTFPSFQKPLFFFGHSHESGLYHQQKKLPIRIRYGQPIVLQDKQ
FT                   YGVNVGSVVDHREWCLYDSEKRTVTFMCVPSVDKGTMS"
FT   gene            294179..295675
FT                   /locus_tag="Bsph_0274"
FT   CDS_pept        294179..295675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0274"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37903"
FT                   /db_xref="GOA:B1HU12"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU12"
FT                   /protein_id="ACA37903.1"
FT                   /translation="MTMYMTDILEKYAVQQPSKIATLYNGNKLSYREFYKHVERFAAYL
FT                   QEQNYKKEDVIALYTLNTDLFLIAYLGVQLAGYVAMPINTKLAAPEVEFIFNHSQAKGL
FT                   IYDERLAETLENVSYSFQHIIGFQDMNHILTNTNLVRAVVPLEAHDTAVVMYTSGTTGK
FT                   PKGVMLTHQNIVATADIWSSSMNMLNTDKMFICTPLFHCAGLHVFAMPMFYQGGTVLIE
FT                   EAFSPTKTLEQIAVTEATIFFGVPSMYTIILNTPGFKEHSFNHLRLLCYGAAPMPYELV
FT                   KQVKEAFSNVKVQNLYGQTENTPAATSLLDTDALTKIGSVGKPLEQTEVRVVDSEGKLV
FT                   PAGEVGEICVRGPQVMKGYLRNPEETARTIIDGWLYSGDLGRFDEEGYLYIVDRKKDMI
FT                   IRGGENIYPIEVEEVLYQLPEILEAAVVGLPHEVYGEVPKAFVVFKEGKYLDEEIILSY
FT                   CQSRLAKYKVPYEIECLTELPRNASGKVLKHTLRPKVRTI"
FT   gene            295901..296842
FT                   /locus_tag="Bsph_0275"
FT   CDS_pept        295901..296842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37904"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU13"
FT                   /protein_id="ACA37904.1"
FT                   /translation="MLLSSCQPFSQQDAENKNQLTVLTVEFNSGAPIANLYITVTDVQN
FT                   GNVVEEAIGSEEGEAIFSKLKEGREYAIAATTLENSATNDGYTTIENFTYDTTKPYFRL
FT                   QTHFTRDEQELDVPVVMQNPELPHGCEITSLTAVLNYYGMNVSKLEMADNYLPKEEIRT
FT                   IGNQRFGPNPNEAFAGNPRDKARGMYVFAAPIVKAAEAAIAEKQADLRVTDMRNASQAD
FT                   ILQLVREGVPVVTWVTLDLSKPKKNANRGWIYKGATTSQDAFMNLHAVVLTGHLGDKVV
FT                   VMDPLKGYVTYNVDQFFKSYHELGEQAVAVHK"
FT   gene            296900..298132
FT                   /locus_tag="Bsph_0276"
FT   CDS_pept        296900..298132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37905"
FT                   /db_xref="GOA:B1HU14"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU14"
FT                   /protein_id="ACA37905.1"
FT                   /translation="MAIEHAFLPVLLGDEMNAYGMARAFYEAYGVKPLALNHTNMEKIQ
FT                   QSDLLTFREVPRLHIEERFVTALKAIAQEFTEKKLLLLACDEFYVKKIVEHKDELIEDF
FT                   LVPYVNTSLAHQLLTRESMYELCAQFGFQYPAMHVCTVNDYEDYEMSLDYPIVIKPMNM
FT                   TKYATCIFPGKKKVYIAHDKEEKDSIFHAIYKESAYRDDLMIQQYIPGEDANMRVVNAY
FT                   VGQDGKTKLLAVGNPILEEHSPEGIGRYVAIMTAYNPALMENVKLFLEAIQFQGFATFD
FT                   MKYDERDGHYKLLSIELHNELSNYYVTASGYNLMQYVADDYVRGSKQPLTYVQNKHLWT
FT                   IVPNGVLFKYVQNEQLIIEAKSLIRQGMATDSIFNYKDMNAKRWLNVTVDNLNFYRKYK
FT                   KYFNNKGLSNS"
FT   gene            298129..298830
FT                   /locus_tag="Bsph_0277"
FT   CDS_pept        298129..298830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0277"
FT                   /product="Aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37906"
FT                   /db_xref="GOA:B1HU15"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B1HU15"
FT                   /protein_id="ACA37906.1"
FT                   /translation="MKKQTLGIIGGVGPLATMFIGEMIVRRTKAQKDQEHLHTIIDNDT
FT                   NIPDRTAFILDNTKENPVPVIMEDAKKLASVGADMIAIPCNTAHTFYDEIQAGSPIPVL
FT                   HMIRETAKRASELGAERVGILATTGTLTSRMYQEALEEYGITPVVPDNEMRAHVMTIIY
FT                   DFVKAGKDVTQDDWQPIEDAMLALNCDRIVLGCTELSIVNRDLKLSNVYIDSLIVLAEC
FT                   AILACGYELID"
FT   gene            299049..300197
FT                   /gene="yfmL"
FT                   /locus_tag="Bsph_0278"
FT   CDS_pept        299049..300197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfmL"
FT                   /locus_tag="Bsph_0278"
FT                   /product="RNA helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37907"
FT                   /db_xref="GOA:B1HUM7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUM7"
FT                   /protein_id="ACA37907.1"
FT                   /translation="MSVISLLKEELQAKWNFEATMKIQEEMIPAMLEGKDIVAESPTGS
FT                   GKTLAYVLPLLNKVNGAKKQTQGLIVAPSQELAMQIVEVIREWTAGTDITVQQLIGGAN
FT                   SARQIEKLKKKPTIVVGTPGRLNELARAGKLKLKEIETVVLDECDQLLSREYRVVIKSF
FT                   IEGSAFGRQVVVVSATITEEIELVASRMMFEPVRFKIKPEDMLKVGKVTHSFVKVEERD
FT                   KTEFLRRLSHTEGLRALAFVNNIDQLLMKETKLQYRSAPIVTLHSDMKKEERKKALDAF
FT                   RKGDARILIATDIAARGLDIAGLTHVIHVDVPRTIEQYLHRSGRTGRAGADGEVLTLLS
FT                   YRDEKTYKKWTREIPGKPVQKIWHDGKLKEGNSKTIGQKGGK"
FT   gene            300199..301428
FT                   /locus_tag="Bsph_0279"
FT   CDS_pept        300199..301428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0279"
FT                   /product="aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37908"
FT                   /db_xref="GOA:B1HUM8"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUM8"
FT                   /protein_id="ACA37908.1"
FT                   /translation="MTFEEKLQAYAELAVKVGVNIQPGQYLLVNTSVEALDFARLVVKE
FT                   AYKAGAGRVHVNFSDDEMDRAYFEHASDEEFNRFPEWVVQMRDELIERKGALLWIDAAD
FT                   PDKLTGISADRLATHQKVSGAALKNYRNAVMKDLIAWSIIAVPSPKWAAKVFPQLTADE
FT                   QVPALWEAIFKTVHIGEGNAVENWHQHVTNLESRAELLNNKKYAKLHYTAPGTDLTIAL
FT                   APQHKWVTGGSKTPEGHVFIANMPTEEVYTLPMKQGVDGYVSNSKPLVYQGNIIDGFKL
FT                   TFKEGKIIKAEAEVGQDLLQELIQVDEGSSYLGEVALVPHESPISASGILYFNTLFDEN
FT                   ASNHLAIGEAYPTCLEGGRDLENGQLEALGANISVTHEDFMVGNGEMDIDGILPDGTIE
FT                   PIFRKGSWAF"
FT   gene            301440..302372
FT                   /locus_tag="Bsph_0280"
FT   CDS_pept        301440..302372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0280"
FT                   /product="YcsK"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37909"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUM9"
FT                   /protein_id="ACA37909.1"
FT                   /translation="MENGGEQMKHIGSLIGMIILLLTGWSSSAFAQTENYIAIGDSLAA
FT                   GQTPFQQIDAGYSDLIAMRLQSMNQLKFYTKELAFPGYTTAHVLEKIKTEEARDLLANA
FT                   TLVTVSAGANDLLSLIRLNPMAGTLTFSQLQTDYALNTVRKNIIAILNELAERAPKAQV
FT                   YVVGYYFAYPAVHLTQKEGTNAQLVKLNKILQQQAELAGAGYVNVYDSFGLNATNYLPN
FT                   YTDVHPNMEGYRQMANAFLKAYSGSDALSIAPSQLPKPNPVSFEEILQERASAQPKQQK
FT                   VTSSQSVRSVRSIQGFHGYTAFMEKLEKR"
FT   gene            302482..303639
FT                   /locus_tag="Bsph_0281"
FT   CDS_pept        302482..303639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0281"
FT                   /product="Exonuclease sbcD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37910"
FT                   /db_xref="GOA:B1HUN0"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN0"
FT                   /protein_id="ACA37910.1"
FT                   /translation="MKIFHTADWHLGKLVQGVYMTEDQQYILQQFIQAIDEEKPDVIII
FT                   AGDLYDRSMPPIEAVNLLNDTLAKIVLEKKIPILAVAGNHDSAGRLNFGSRLMRDSGLY
FT                   IKGQFTKDHAPIIINDQYGEVHFHLVPFADPASIRSIFEEEAIRSHQDAMQKIIEHITA
FT                   GMDTSKRNIFVGHAFVTKYGEEEANTSDSERPLSIGGSDCVNAALFKPFHYTALGHLHK
FT                   AHFVLNETIRYAGSPLKYSLSEHLHEKGFLIIDLDEHGNSTVTKRKLMPRRDLRVVEGE
FT                   LEELLMLPPSDDYVFVRLTDATSVSSPMERIRTVFPHALHVERKILRQEKPSELQVVEA
FT                   EKLEDIDLFRSFFTDIIGIQPDEDTERLFTEMLQELLDKERETVK"
FT   gene            303636..306716
FT                   /locus_tag="Bsph_0282"
FT   CDS_pept        303636..306716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0282"
FT                   /product="Nuclease sbcCD subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37911"
FT                   /db_xref="GOA:B1HUN1"
FT                   /db_xref="InterPro:IPR027050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN1"
FT                   /protein_id="ACA37911.1"
FT                   /translation="MKPLKLTITAFGPYKNTEIIDFQQLGEHRLFAISGKTGAGKTTIF
FT                   DAICYALYGAGSGEDRQDTALLRSGFADDDVYTAVELIFEMHGRVYQILRQPGHIKGKN
FT                   KTATGKKVELAEVREGMLDYNIVEKQQTLEVDKKIQEIIGLTKDQFSQIVMLPQGEFRK
FT                   LLTSDSTNKEVILRKIFKTDRFGAMTKLLDAKRKEAESDLERAKQLKEHLLGQIVGALP
FT                   QRSSPLFKQIADNTENMFQLKQALEEELTYYKKCFEDIQRQYEEAYNHHQKEQEFYRLA
FT                   KTLNEQFEEQSKRQERLQMLLDEQDKYHAKEREIALAEQAERLLLLEQQCMDLRAEQNL
FT                   KEQAYQQAQSSQLQTKELLQRAQEKYEAEEAKESERQLLLQQEMQLQALLPKFEAYDSH
FT                   VQQLQIAEQYVKTAKQGAADNIVLIEKESAQLEQLSQSIEHYEKQMEPYEGYLEKLPKL
FT                   QEQVTLLMQMENYTKTVEIAKQDVIATKARYQDSRLELQQLEQRWLTSQASVLAQQLKE
FT                   GQPCPVCGSTAHQQTHNEKLEIVELAQVETLRVKVSSDERLYLEKEAMLRSAQQLQQET
FT                   LKQLDAHSIKQQDQAQIIASLEKMEKEITSLRVINQQLAQTRKNQKEQRLTIEQLQNKQ
FT                   LKLEEYLSEQMKSWTRLQAIVEEQHKQMPTNIPTLPQLKQTLTDVSQQKMDFQKLWQES
FT                   QHHLHAMKEADSNAKLAVEIAKQNFEELKLKMNDKREQFSTSMQEAGFVSYEDYAAAKR
FT                   SATQLEELRRACSDYTLQVHTLKIQISEGEKHLQGKEEQDLALMEATVKSLRIAYEDAF
FT                   KQLQQIDGFVKSCQSFMNKVEETERELRLLESEAGRVKELYGLLNGQNSKKLSFERYIQ
FT                   INYLDQITEAANIRLNHLSNGQFELRRSDRLEKHAKQSGLGLDVYDAYTDQLRDVKTLS
FT                   GGEKFNASLSLALGMADVIQSFQGNIHIETMFIDEGFGSLDEESLNKAIDTLIDLQDSG
FT                   RMIGVISHVPELKSAMPAVLHVEKTLNGHSQTHFEIK"
FT   gene            complement(306757..306888)
FT                   /locus_tag="Bsph_0283"
FT   CDS_pept        complement(306757..306888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37912"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN2"
FT                   /protein_id="ACA37912.1"
FT                   /translation="MFLMKVSKVVKTAVKLAPIVIPIVKKVMAAKKGTTSTVSPRKK"
FT   gene            307003..307125
FT                   /locus_tag="Bsph_0284"
FT   CDS_pept        307003..307125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37913"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN3"
FT                   /protein_id="ACA37913.1"
FT                   /translation="MANEMNQTIITVLLLEVGSKLKVENTKTMKNNIPNTKGIK"
FT   gene            307629..308189
FT                   /locus_tag="Bsph_0285"
FT   CDS_pept        307629..308189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37914"
FT                   /db_xref="GOA:B1HUN4"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN4"
FT                   /protein_id="ACA37914.1"
FT                   /translation="MDKKRLLMLVEIAIFAAIGLVLDQVSFKVWAQGGSVSLVMVPIML
FT                   IAIRWGLVAGLTTGLLVGVMQTMFGAYIVHWLQGLLDYGVAFTVVGLAAIVRRPLLEAA
FT                   SQLNKTKMALYIILGTVFAGFLRYVAHTTAGAVFFAEYAGDQNAWIYSIIYNGTYMLPA
FT                   KVLTAIVGVLLFTAAPQLMQRKA"
FT   gene            308361..309116
FT                   /locus_tag="Bsph_0286"
FT   CDS_pept        308361..309116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0286"
FT                   /product="Methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37915"
FT                   /db_xref="GOA:B1HUN5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN5"
FT                   /protein_id="ACA37915.1"
FT                   /translation="MIVKTQEEIEAFKKIGRICAEIRETMKSATKPGVTTLELDEIAGR
FT                   MFAEAGAISGPKGEYDFPGYTCISVNEEVAHGIPGKRVIQEGDIVNIDVSGSLDGYFAD
FT                   TGISFVVGDGYEDKEKLCRVAKDAFDRAMTKVKAGSKLNQIGKAVEREANANGLTVIMN
FT                   LTGHGLGRSLHDEPNHILNYYDAWDSTIMKEGMVLAVEPFISAKAEHIVEAGDGWTFIT
FT                   PDKSLVAQIEHSVIVTKDKPIILTSLDED"
FT   gene            complement(309145..309924)
FT                   /locus_tag="Bsph_0287"
FT   CDS_pept        complement(309145..309924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37916"
FT                   /db_xref="GOA:B1HUN6"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN6"
FT                   /protein_id="ACA37916.1"
FT                   /translation="MSDSTILICLFPIQFNTKGEESMPRFLLMTISYIVSLILTFSSFF
FT                   MKLNGQSSLEISNRFSVVFAPVDGSHLIWIVIYLFIGYWLVMNIKKTSMKQSALFSCIN
FT                   ILQALMIYVWHHELFIVSLGITLLLVLYLFMLYNTYPLHDKSLSGRIPFAIYLAWMTFI
FT                   FITNISFTLTAYGWNGFGLSTPLWAVILLTLGGVIALHIRFHHFDIMYPSVFIWAYIGI
FT                   ALHNGFDELLVTTAALFLCGVLFVGILFIKKNPAYQK"
FT   gene            310058..310867
FT                   /locus_tag="Bsph_0288"
FT   CDS_pept        310058..310867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37917"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN7"
FT                   /protein_id="ACA37917.1"
FT                   /translation="MTQNLKNLDLSIELDKKMYKKKLKVLQYEMLNAQQFLLKNKIGLI
FT                   LVFEGMDAAGKGGAIKRLIERVDPRGYVVHPISAPQPHELRYNYLQRFWRKLPQHGQIA
FT                   VFDRSWYGRVLVERIEGFATKEEWSRAYEEINNFEKILTEGDYIIIKFWLHVSDEEQLK
FT                   RFKEREQNPYKSWKLTEEDWRNREKSPQYIEAANEMFDKTDKKNAPWILVAGNDKKYAR
FT                   VQVLQETLAHIEREALKRGLHLTNVLDNPLLEDADSSSLNTLNEKKK"
FT   gene            311043..311630
FT                   /gene="yjcK"
FT                   /locus_tag="Bsph_0289"
FT   CDS_pept        311043..311630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjcK"
FT                   /locus_tag="Bsph_0289"
FT                   /product="Ribosomal-protein-alanine
FT                   N-acetyltransferase-like protein"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37918"
FT                   /db_xref="GOA:B1HUN8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN8"
FT                   /protein_id="ACA37918.1"
FT                   /translation="MVLKIWNLLRKKGGNVVTIKGEKCYIRTFQENDARSLTGLVSRNK
FT                   YFWSTYEPLQRPEYYTIDAQYKKIQESLYLMDSKREFTFGIFEHGTNNLIGHIALYAVK
FT                   RLPYSSAFVGYAMDEIYVGKGIVTEAVNMVVRFAFDQIGLHRVEAYVSTQNNPSMRVLE
FT                   KAGFQQEGLLRKLLYINGHWVDHYMYARLEDE"
FT   gene            complement(311701..312264)
FT                   /gene="ytiB"
FT                   /locus_tag="Bsph_0290"
FT   CDS_pept        complement(311701..312264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytiB"
FT                   /locus_tag="Bsph_0290"
FT                   /product="carbonic anhydrase-like protein"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37919"
FT                   /db_xref="GOA:B1HUN9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUN9"
FT                   /protein_id="ACA37919.1"
FT                   /translation="MTMLQDILGFNKEFVQEKKYEPFITTKYPDKRIVVLSCMDTRLVE
FT                   LLPKAMNLRNGDVKIVKSAGALVSHPFGAVMRSLLVAVYGLQADEVYVVGHYDCGMSAV
FT                   DPDAMLSEMVKRGINPETIKMLEYSGFDLKEFLRGFGDVATSVKKSVDTIRNHPLMVKD
FT                   VPVHGLIIDPNTGHLDLIEDGNHQ"
FT   gene            312263..312388
FT                   /locus_tag="Bsph_0291"
FT   CDS_pept        312263..312388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37920"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP0"
FT                   /protein_id="ACA37920.1"
FT                   /translation="MKIAPFLTKNILEQNFNYANNKDFFQTIFTIKKQTSYTLAA"
FT   gene            complement(312441..312575)
FT                   /locus_tag="Bsph_0292"
FT   CDS_pept        complement(312441..312575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37921"
FT                   /db_xref="GOA:B1HUP1"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP1"
FT                   /protein_id="ACA37921.1"
FT                   /translation="MFITTVLGFSAVLLISTGFFIHYLQVGLDSKSSVTVDPKPNEKF"
FT   gene            complement(312714..313955)
FT                   /locus_tag="Bsph_0293"
FT   CDS_pept        complement(312714..313955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0293"
FT                   /product="Aminopeptidase ampS"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37922"
FT                   /db_xref="GOA:B1HUP2"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP2"
FT                   /protein_id="ACA37922.1"
FT                   /translation="MNLLLSFNTKLLKYAELAIKVGVNIQKDQYLYISCSTDNLKLAQI
FT                   ITKLAYKNGAKQVFVDLSDDELVRARYEGAPKDSFDFFPPWKVQEREWLAENGAAFLSI
FT                   SSQNPDLLKGIERDRIMAFQKASGQALANYYQLLQSDKFSWSVIAAPSKAWAAKVFPDL
FT                   PEDQQMDALWEAIFAATRIDLEHSVEAWLAHDKELHDKAEYLNSKQYKSLHYTAPGTDL
FT                   TIELPAHHIWTGGSSVNEQGQTFMANIPTEEIFTAPLKTGINGFVSSTKPLSYGGNIIN
FT                   NFTLTFKDGRIIDVKAEEGQEILASLIETDEGAHYLGEIALVPHHSPISQSNLLFYNTL
FT                   FDENASNHLAIGSAYAFCIEGGKDMSSDELAAHGINQSLTHVDFMIGSNKMNIDGITHD
FT                   NQKEPIFRDGNWAF"
FT   gene            314203..314949
FT                   /gene="motA"
FT                   /locus_tag="Bsph_0294"
FT   CDS_pept        314203..314949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="Bsph_0294"
FT                   /product="Chemotaxis protein motA (Motility protein A)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37923"
FT                   /db_xref="GOA:B1HUP3"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP3"
FT                   /protein_id="ACA37923.1"
FT                   /translation="MVMKGVSLTAFYNPAAILIIIFGTISAVTIAFPMQELKRVPKLFK
FT                   ILFKETKLANDIEIIKMFSQWADLARREGLLALESKASEIEDPFLKNGLTLAIDGQNAD
FT                   YIRDVLTEEVEAMEERHASGSAIFTQAGTYAPTLGVLGAVVGLIAALADMNDIEKLGHA
FT                   ISAAFMATLLGIFTGYVLWHPFANKLKRKSALEVKQKRMMIEGILSVLEGEAPRVIEQK
FT                   LSSYLTMEERRQISGESGAGGLGKES"
FT   gene            314990..315697
FT                   /gene="motB"
FT                   /locus_tag="Bsph_0295"
FT   CDS_pept        314990..315697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="Bsph_0295"
FT                   /product="Chemotaxis protein motB (Motility protein B)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37924"
FT                   /db_xref="GOA:B1HUP4"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP4"
FT                   /protein_id="ACA37924.1"
FT                   /translation="MPYADILTLLLAVFIILFASSSVDQEKLERMSAVFSQVFDGGTSF
FT                   LEQPAPVPSPNADSDQTPQQNSAYLKDQQELAEIKDSVDNFIAVNEMEGQFATEMTDEG
FT                   LLVTIRDSILFDPGQATIKPEYIPIAKELADVLVSNPPRNIVITGHTDNVPAGPNFSSN
FT                   LELSLMRASNFYMVLLDSNSQLKSENFSAKGYGENRAIAPNDTAEGRAKNRRVEVLIQP
FT                   LVTEDGSEAKNTQ"
FT   gene            complement(315753..315935)
FT                   /locus_tag="Bsph_0296"
FT   CDS_pept        complement(315753..315935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37925"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP5"
FT                   /protein_id="ACA37925.1"
FT                   /translation="MIDQMKDKLRMVNVDAMKSEHFDEANYENLTYLYEMVMKRESFSP
FT                   SEMQAIVAELGALRK"
FT   gene            316153..316479
FT                   /locus_tag="Bsph_0297"
FT   CDS_pept        316153..316479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0297"
FT                   /product="YfkI"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37926"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP6"
FT                   /protein_id="ACA37926.1"
FT                   /translation="MGQSKLLVSIVAGAAIGAALSMLDRTTREKTIDTTKKMKEAVTYY
FT                   ATNREELQVLVEEKVLAAKVLCENVSDNVNTIAEKVEEFKELPTTIQSMIDDTKSAFTL
FT                   PHKE"
FT   gene            316502..317419
FT                   /locus_tag="Bsph_0298"
FT   CDS_pept        316502..317419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0298"
FT                   /product="possible transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37927"
FT                   /db_xref="GOA:B1HUP7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP7"
FT                   /protein_id="ACA37927.1"
FT                   /translation="MEKKKATMQNAFGFVKSFVSPEGEVIDVMTSKGFVQDLIGRVKRV
FT                   EISALSAQLAYFFLLSFFPLLIFLVTLLPYLNLETTQVYSFLVNVLPDEVYKLIENTLN
FT                   EILTNRNSSLLSIGVLGTIWSASKGINALIRALNKAYDTEGRAGILDRGLSLVFTVALV
FT                   VVMAVALLLPVFGQQIGHFLFSIVGIEEQFESVWHNLRWSIPPILIFIVLMGIYWFVPN
FT                   TSPRLKILGVWPGAMFATLAWLVVTYAFSFYINNFANYSATYGSIGGVIILMLWLYFTG
FT                   IILIFGGVLNATMQKRALQKEINR"
FT   gene            complement(317482..319386)
FT                   /locus_tag="Bsph_0299"
FT   CDS_pept        complement(317482..319386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0299"
FT                   /product="Cadmium-transporting ATPase"
FT                   /EC_number="3.6.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37928"
FT                   /db_xref="GOA:B1HUP8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP8"
FT                   /protein_id="ACA37928.1"
FT                   /translation="MEHSNRENINLIEKIKEHAELIAALMAGVFILLAWRLDISGQTTA
FT                   SVLLYVIAFCVGGFAKAKEGIEETIEERKLNVELLMVLAAIGSAAIGYWTEGAILIFIF
FT                   AVSGALETYAMNKSHREISALMNLQPEEAWLVRGSFEPMKVSVSTLQIGDHLLIKPGER
FT                   IPADGIIFKGQSSIDESAISGEPLPVLKREGDEIFAGTVNLNGAITMEMTKANSETLFQ
FT                   KIIQLVQSAQSEKSPSQQFIEKFEGTYVKFVLLGVAIMMFLPHFVLGWDWTTTFYRAMV
FT                   LLVVASPCALVAAIMPATLAAISNGAKNGVLFKGGLHLEHLSVLGALAVDKTGTLTQGK
FT                   PVVTDFIVRDGFDRNMALAILAGIETQSNHPLAQAITSYAKAEGITALPSATIEDIPGW
FT                   GIKGTVHNKEYQVGKPDFVNAQHANDFANGAAAKLAAQGKTVIFIRDQNGIVALTALKD
FT                   TVRNEAKKAVSLLKELGIQVVMLTGDNEKTAKVIAKEAGVTEYVAECLPETKVTEMKRL
FT                   LSQYQFVGMVGDGINDAPALATATTGIAMGEGTDVALETADVVLMKNDLSKIAYAVRLS
FT                   RKMQRIVKQNIIFSIGVIILLIASNFLQVVDLPLGVIGHEGSTILVILNGLRMLNKNV"
FT   gene            complement(319646..321202)
FT                   /locus_tag="Bsph_0300"
FT   CDS_pept        complement(319646..321202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0300"
FT                   /product="Fumarate hydratase class I, aerobic"
FT                   /EC_number="4.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37929"
FT                   /db_xref="GOA:B1HUP9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUP9"
FT                   /protein_id="ACA37929.1"
FT                   /translation="MGGNTRMNLQTLEKSLYDLITETSTNLPKDVRRAIKKAKEAENAG
FT                   TRAAMSLDTISNNIIMAEDNVSPICQDTGLPTFKIYTPVGVNQLEIKAAIKKAINDTTA
FT                   DAKLRPNAVDSLTGANSGNNLGDGLPVMKFEQWENDYITIKLILKGGGCENKNIQYSLP
FT                   CEIDGLGRAGRDLDGIRKCILHSVYQAQGQGCSAGFIGVGIGGDRSSGYDLAKEQLFRH
FT                   VEDTNPNPDLAKLEEYVVKTSNTFGIGTMGFGGEATLLGCKIGVMHRIPASFYVSVAYN
FT                   CWAYRRMAVDIDPQTGEIIKWHYQEGEKITFKEDEVAATTEDNTTNVVELTAPITEEQI
FT                   RSLKVGDVVSITGRMYTGRDAIHHHLMSHDAPVDLNGQVIYHCGPVMAKDEEGNWTVKA
FT                   AGPTTSIREEPYQGDIMKKFGIRAVIGKGGMGPKTLKALNEHGGVYLNAIGGAAQYYAD
FT                   CIKGVDGVDLMEFGIPEAMWHLNVEKFTAVVTMDSHGNSLHADVDKSSLEKLALHAERV
FT                   F"
FT   gene            321270..322175
FT                   /locus_tag="Bsph_0301"
FT   CDS_pept        321270..322175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37930"
FT                   /db_xref="InterPro:IPR015315"
FT                   /db_xref="InterPro:IPR035948"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ0"
FT                   /protein_id="ACA37930.1"
FT                   /translation="MRAKFTHSLIVFGEGVDFIERLFYNDSNPHLGGICMSAKTLLELP
FT                   EEFDQYRPLIEETMKPVVLIDAYAGKTTLFQSKFAGDPYFPLAMEYPKNASGQPLKLLA
FT                   QVNFAELPKHLPHFPEEGIVQFYIDGYDDVLGMDFDNGKNQEGFRVIFHDTVIHDEAQL
FT                   IQDFSFVEKEDEEMYFPVEREMTLSFKTGFEPLTIDDYRANEIYSSILKAIEDNETVED
FT                   AFYDALTGDGLKIGGYPFFTQEDPRAYGNYTDSSILLLQIDSVGDDILWGDCGVGNFFI
FT                   TEEELKNKDFSNVLYNWDCH"
FT   gene            complement(322218..322403)
FT                   /locus_tag="Bsph_0302"
FT   CDS_pept        complement(322218..322403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37931"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ1"
FT                   /protein_id="ACA37931.1"
FT                   /translation="MSKPITDKKQQVTYLRERLEMFLEVLDALDPETAELDDIDRLIQM
FT                   MDDLEDKMEQFNAREQ"
FT   gene            322847..323950
FT                   /gene="yfkF"
FT                   /locus_tag="Bsph_0303"
FT   CDS_pept        322847..323950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfkF"
FT                   /locus_tag="Bsph_0303"
FT                   /product="YfkF"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37932"
FT                   /db_xref="GOA:B1HUQ2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ2"
FT                   /protein_id="ACA37932.1"
FT                   /translation="MLLPLISIIFERDGVSSALNGLNATGLYIGTLLISPFIEQPLRKW
FT                   GYKPIILMGGAFVFISLLAFPLWKSVTFWFVLRLLIGVGDHALHYATQTWITSTADHKS
FT                   LGKGMAIYGLSFSIGFAVGPLMVKLIEIAEALPFIVSSIMCLIAWSFVFFLQNEKPERL
FT                   TGDLHARGWKRYKMAILFGWIAFLGPFVYGFLESSLNALFPVYALRKGFEVGMIPIILS
FT                   VFTFGGILTQVPLGALGDKVGRRNILMVGSFGGAIIFAIASFLEQSQMAVAIAFFLTGT
FT                   LVGSMFSLGITFMADLTPKELLPTGNLLCGIALSIGSLTGPFLGGVYLEYVKNYSFLLL
FT                   VAILLLIVAFILLIFGRLKNKQTLMAK"
FT   gene            324187..324822
FT                   /locus_tag="Bsph_0304"
FT   CDS_pept        324187..324822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37933"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ3"
FT                   /protein_id="ACA37933.1"
FT                   /translation="MTEMKKLSIHRALTELKMLQQRIEGATNEVSSVVANRKSNQKING
FT                   IEIVEYEKQMQASYDKVMGLISYRNNIKALVVQSNASTKVIVGKEEMTVAEAIERKQSI
FT                   QYEKNLLEVMQHQYRSAIHTVAKENDALPAKLETYLINILGNKDKQSPEEVKLHTETFM
FT                   KRNEFEIIDPLNVRQRIETLSSRIEEFESEVDAVLSESNATTFIEVQA"
FT   gene            complement(325153..326541)
FT                   /locus_tag="Bsph_0305"
FT   CDS_pept        complement(325153..326541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0305"
FT                   /product="Hypothetical RNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37934"
FT                   /db_xref="GOA:B1HUQ4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ4"
FT                   /protein_id="ACA37934.1"
FT                   /translation="MERLTQQTTMTVGQKFPLIIRRLGINGEGVGFYKRNVIFVKGAIP
FT                   GEEITAQVTKTQRNFAEAEILSIHKASKHRQEAPCPVYNECGGCQLQHMTYEKQLLEKR
FT                   DIVIQALERYAKPLAETVEVRKTLGMDNPWHYRNKSQFQVRKEGKRVYAGLFAEGSNKL
FT                   LNINDCLVQHPVTSKITVATRKILQKLNITIYDGRTLDGLVRTIVVRTGIRTGETQVVL
FT                   VTTRKEIPHLAELITRIKKIDPSIVSIAQNINREKTSLIFGDETIVLDGKETIHEELGE
FT                   LAFDLSARAFFQLNPTQTVHLYDEIKKAAALTGKESVVDAYCGVGTVGLWLADQAAEVR
FT                   GMDVIPESIQDARKNARNHGFKHTKYAVGTAESVLSKWRKEGFTPDVITVDPPRTGLAS
FT                   EFIQTVLKLRPKRFVYTSCNPSTLAKDLQQLSKHYHVEYIQPVDMFSQTAQVECVAKLV
FT                   LKNK"
FT   gene            complement(326570..327394)
FT                   /locus_tag="Bsph_0306"
FT   CDS_pept        complement(326570..327394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0306"
FT                   /product="Hypothetical 30.6 kDa protein precursor"
FT                   /EC_number="3.5.1.-"
FT                   /note="Hypothetical 30.6 kDa protein in fumA 3'region
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37935"
FT                   /db_xref="GOA:B1HUQ5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ5"
FT                   /protein_id="ACA37935.1"
FT                   /translation="MWKQHIVGAVIATFIIAAGISINPYFAAGSDEHHWGFKRAKNGEQ
FT                   AEAGAQLDQLLDKYGAIYKGKADKKIAYLTFDNGYENGFTESILDTLKKEDVPATFFLT
FT                   GHYLDSASDLVKRMVKDGHTIGNHSYGHPNMARLTPEGMRAEWRKFDGKLREMTGIDRT
FT                   TYARPPEGTFNAKLLEVGNAEGYRHIFWSVAFKDWMKDERRGADYAYNALMEQLHPGAV
FT                   ILMHTVAQDNAEALPMFIAEAKKQGYTFLSLDDLVLEYEDFPVALQSSAPSL"
FT   gene            complement(327451..328407)
FT                   /gene="yfhF"
FT                   /locus_tag="Bsph_0307"
FT   CDS_pept        complement(327451..328407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhF"
FT                   /locus_tag="Bsph_0307"
FT                   /product="UPF0105 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37936"
FT                   /db_xref="GOA:B1HUQ6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ6"
FT                   /protein_id="ACA37936.1"
FT                   /translation="MIKLLVKYIFEKGVLLMKIVIAGGTGFVGKAFIKLAQENGHSIFV
FT                   LTRSPSSEKNGIQYVQWLQDESLPIEALEGADAFVNLAGVSLNNGRWTKKQKKDIYWSR
FT                   MHATLEIVRIIEKLRKKPKVLVNASAVGFYPHSTEVIYNENFSDAATNFLGSTVDDWER
FT                   HAKRAEHLGIRVALARFGVILGRKSGALPPMLLPYQMHIGGTIGSGKQWLSWVHIEDVA
FT                   RALYFAILHEEIHGPFNVTAPHATRMKEFGQTIAMVMNRRHWMPVPSFAIRFALGEQST
FT                   LVLEGQHVQPALLEKHHFTFKFPHLTEALEDLLIAQN"
FT   gene            328507..329319
FT                   /gene="recX"
FT                   /locus_tag="Bsph_0308"
FT   CDS_pept        328507..329319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="Bsph_0308"
FT                   /product="Regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37937"
FT                   /db_xref="GOA:B1HUQ7"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ7"
FT                   /protein_id="ACA37937.1"
FT                   /translation="MLAMRMITKIARQKNNPERYNIYLNEEYAFPVDEAILLQFSLTKG
FT                   KVLDEFEIQEIAYEDEIRKAFNKGLNFLSYQMRSEHEVKKKLLTLEFGEAVVLEAIQKL
FT                   KSYGFINDENYSKALLDTKKATMKKGPRAIRQDLMKKGINKNLQDEVLATYSFEEQIKL
FT                   ALQLAEKIIRSEKRKTPAQVKAKIQDYLLRKGYAFPIVEEVLNQIELEQDEDNWQPLLD
FT                   AQGEKVWKKYVSKYTGYELKMKVKQTLYQKGFPIEVIDRFIEEKENEE"
FT   gene            329316..329645
FT                   /locus_tag="Bsph_0309"
FT   CDS_pept        329316..329645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37938"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ8"
FT                   /protein_id="ACA37938.1"
FT                   /translation="MNEKNYAAMSEHELREEIAFLKEKARKAEQLGIINEFAVYERKAL
FT                   MAAAYLVDLNTIVPGEMYRIDRSDNEFFQVDYLKGRFAWGHRLGGDKYQEALPVSMLSP
FT                   VKVGK"
FT   gene            329646..329915
FT                   /gene="yfhJ"
FT                   /locus_tag="Bsph_0310"
FT   CDS_pept        329646..329915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhJ"
FT                   /locus_tag="Bsph_0310"
FT                   /product="YfhJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37939"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUQ9"
FT                   /protein_id="ACA37939.1"
FT                   /translation="MEEKIEKLTAELLAKNPQMSVGRARVWVELLWSDFESTSAKAGHD
FT                   YRGPDYTENLVRQLITSYGDKLHAFAGRNPKYAHLLDASDDMIQ"
FT   gene            complement(329951..330913)
FT                   /gene="yfhP"
FT                   /locus_tag="Bsph_0311"
FT   CDS_pept        complement(329951..330913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhP"
FT                   /locus_tag="Bsph_0311"
FT                   /product="YfhP"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37940"
FT                   /db_xref="GOA:B1HUR0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR0"
FT                   /protein_id="ACA37940.1"
FT                   /translation="MGIAIGGLALADPIVANHSMTFTAVMAGTIIGSQAPDVDTVLKLR
FT                   NNAIYIRHHRGITHSLPAVAIWPILITAVISLILQDVNVFHLWLWTFLAVALHVFVDIF
FT                   NAYGTQAIRPFSRKWVALGVINTFDPIIFSLHCLGIVLWAFGANPVWTFSIMYIIIVIY
FT                   YLLRFAVQKAVKNAVHSTIQDEEYVIVAPTMRFFHWRIAAKSKTHYYVGRAYGRTVNIY
FT                   DKFEIKPLPNTALIHAAMKDPNLAAFVSFSPMYRWEISELENGLLEVRLIDLRYRSDNR
FT                   YPFVAVAHLNDDNEIVTSYTGWIFTEDKLQKKLQIGASN"
FT   gene            331138..332181
FT                   /locus_tag="Bsph_0312"
FT   CDS_pept        331138..332181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0312"
FT                   /product="A/G-specific adenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37941"
FT                   /db_xref="GOA:B1HUR1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR1"
FT                   /protein_id="ACA37941.1"
FT                   /translation="MNYPYVTEFRHSLVEWFNAEKRDLPWRHTTDPYKIWVSEVMLQQT
FT                   RVDTVIPYYNRFMESFPTLDLLAEAPQDYLLKHWEGLGYYSRVRNLQAGAREVLENYGG
FT                   VVPDNRHEISKLKGVGPYTAGAILSIAYNKPEHAVDGNVMRVLSRVLNINEDIAVPKTK
FT                   KIFEAAVEELIDPTNASSFNQGLMELGALICTPTSPKCLLCPVREYCTAFNEGEPEKLP
FT                   VKSKKMKMKHLSYNILVCQDEQGRFLMEQRPEEGLLAKLWQFPMIDTTSQITEESFLKE
FT                   CFINVQARHELLSFKHVFSHLTWHINSYYMKCKSSSTGDWFTQEQIEQLPMPVPMLKIW
FT                   EEVKNNK"
FT   gene            332270..332446
FT                   /locus_tag="Bsph_0313"
FT   CDS_pept        332270..332446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37942"
FT                   /db_xref="GOA:B1HUR2"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR2"
FT                   /protein_id="ACA37942.1"
FT                   /translation="MKKQNNQNFQPNKNMQRQSEEFGYETDVNEVQKQNAKAEQKKAPA
FT                   SGRFSKTNQDLGE"
FT   gene            332715..333275
FT                   /locus_tag="Bsph_0314"
FT   CDS_pept        332715..333275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0314"
FT                   /product="UPF0374 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37943"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR3"
FT                   /protein_id="ACA37943.1"
FT                   /translation="MGFKMALPVEGETIQIHSYKHNGRIHRVWQETMVLKGTKNIVIGA
FT                   NERTLVTESDGRTWLTREPSICYFHAEHWFNIICMLREDGVYYYCNLSSPFVFDNNAIK
FT                   YIDYDLDIKVFPDMSYTLLDEDEYELHRKEMSYPDVIDKILKRNVDKLISWIQQKRGPF
FT                   APDFIDVWTNRYKFQLDMQSDDC"
FT   gene            333480..335204
FT                   /locus_tag="Bsph_0315"
FT   CDS_pept        333480..335204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0315"
FT                   /product="Putative multidrug export ATP-binding/permease
FT                   protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37944"
FT                   /db_xref="GOA:B1HUR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR4"
FT                   /protein_id="ACA37944.1"
FT                   /translation="MRFVKPYSWEIVLTIVIGIVKFAIPLFIPLLIKIVLDDIIAADDL
FT                   TDGEKTKELLYWLGGTIIVFFIIRPPIEYYRQYFAQHVSNKVLFDIRKEIYAHLQRLSL
FT                   KYYANTRAGDVISRVINDVEQTKNFVMTGLMNVWLDLATIVIAVIIMLTMDIKLTLVAL
FT                   LAFPFYALSVKYFFGKLRDLTRKRSQALAGVQSYLHERVAGMSIVKSFTLEKHEQTLFD
FT                   QANGEFLEKALDQTKWNAKSFAVVNTITDVAPLLVIAYAGYQVINGTLSVGTMVAFIAY
FT                   IERLYGPLRRLVSSSTTLTQSIASMDRMFDLMDEPYEVKNKVGARELPAATGEVRFDNV
FT                   SFQYEKDGVSILKNINFTINPGETVAFVGMSGGGKSTIISLIPRFYDATDGFVTIDGQD
FT                   VRDVTLHSLRSQIGIVLQDNILFSDSVKENILMGKPDATDEQVIEAAKAANAHDFIMTL
FT                   PNGYDTKVGERGVKLSGGQKQRVAIARVFLKNPPILILDEATSALDLESEALIQESLEE
FT                   LAHERTTIIIAHRLSTITHADKIFVIDHGQLIESGTHEQLMMEQGTYYDLFQVQHLE"
FT   gene            335504..336517
FT                   /locus_tag="Bsph_0316"
FT   CDS_pept        335504..336517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0316"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37945"
FT                   /db_xref="GOA:B1HUR5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR5"
FT                   /protein_id="ACA37945.1"
FT                   /translation="MRKKLLEIKGLKTTFFTDNGQIPAVDDIDFSVQEGEILGIVGESG
FT                   SGKSVTSLSIMGLIPSPPGKITGGEILLDGKNLVNYTEKQMQKIRGKDIAMIFQEPMTS
FT                   LNPLFTIGDQLKEAILIHNPKWSRKKAFARAVEIVKLVGLPRAEELLKDYPHQLSGGMR
FT                   QRVMIAMALVCDPQVLIADEPTTALDVTIQAQILQLMKDLNKRLNTAVLLITHDLGVVA
FT                   ETCERVIVMYAGQVVEEAPIQEIFANPKHPYTQGLIQSVPDMRFKKENLYSIPGSVPKP
FT                   GSIQVGCRFAARCEYAMERCLQETPPLFEAAEQHKSRCFLLEKQEVEQRVESVIKG"
FT   gene            336501..337400
FT                   /locus_tag="Bsph_0317"
FT   CDS_pept        336501..337400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0317"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37946"
FT                   /db_xref="GOA:B1HUR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR6"
FT                   /protein_id="ACA37946.1"
FT                   /translation="MLLKVDGLKKYFPIRKGVLNTQTGDVKAVDDVSFEVFEGETLGIV
FT                   GESGCGKSTTGRLLMRLLEPTEGNIEFAGKMISELSNNEMRKARRDIQMIFQDPYASLN
FT                   PRHNIGKILEEPLIVHGIGSAKERKQKVLELLEIVGLNEYHVKRYPHQFSGGQRQRIGI
FT                   ARALMTNPRLIIADEPVSALDVSIQAQVLNLLQKLQKDLKLTYIFISHDLGVVRHISNR
FT                   VGVMYLGKLVELTASEGLYAEPLHPYTQALLSSVPVPDPTFEREQIIITGDIPSASNPP
FT                   SGCTFHTRCPFKMEHAHR"
FT   gene            337503..339119
FT                   /locus_tag="Bsph_0318"
FT   CDS_pept        337503..339119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0318"
FT                   /product="putative oligopeptide ABC transporter (binding
FT                   protein)"
FT                   /note="initiation of sporulation, competence development;
FT                   KO:K02035"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37947"
FT                   /db_xref="GOA:B1HUR7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR7"
FT                   /protein_id="ACA37947.1"
FT                   /translation="MKKKKLWTLGVMLLLILSTILAACGGSDTKDTGSKDTSTGGDTAS
FT                   SGEPKILVYGRGGDSVALDPAVVTDGESFTVTANIYETLVNFGEQDVTIQPGLAKSWEA
FT                   SEDGLTYTFQLQEGVKFHDGTDFNAEAVVKNIERWKSGADKHPYFSSQFLVGDKQVIES
FT                   VNAEGDYTVVFKLSQPQAPFLKNLAMSPFAIASPTAFEADEEGLSANPVGTGPFKFVSW
FT                   VRNDSITIEKNPDYYIDGYPKLDKVIYRSIPENSARLNDLLAGNIDVADGISPSDKGTI
FT                   EGDANLQLIERPSMNVGYLGLTVTRPPFDNVKVRQAVNYAIDKQALVDAFYEGLAEPAK
FT                   NPMPPVISGYNDEVAGYTYDPEKAKALLAEAGYDGKEIELWAMPVPRPYMPDGQKVAEA
FT                   IQKNLEDVGIKSKIVSFEWATYLEKAQNGEADAFLLGWTGDNGDADNFLYTLLDGDNIG
FT                   SNNYTFYDNQELHKLLTAAQTEVDEDKRNELYKQAQVIISEDAPWVPLAHSTPILAANK
FT                   KVTNYIAHPTGSDRLGAVDIQ"
FT   gene            339336..340349
FT                   /locus_tag="Bsph_0319"
FT   CDS_pept        339336..340349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0319"
FT                   /product="putative oligopeptide ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37948"
FT                   /db_xref="GOA:B1HUR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR8"
FT                   /protein_id="ACA37948.1"
FT                   /translation="MMNMLHYMGRRLFQLIPVLLGMTFIVFMLIRAIPGNPAQVILGQQ
FT                   ATKEAVEALNASLGLDKPWYTQYFSYLAGIFQGDLGVSLRTKLPVSDEIFPYLAATAEL
FT                   AFFAMIIAIVIGVNAGIISAWFQNSWFDYTAMIVALIGVSVPVFWLGLMEQWTFSSKLG
FT                   WLPTSGREDVRNPITAITHFYLLDTLIQGRFDQFVEVLKRLILPGVALATIPMAIIARI
FT                   TRSSMLEVMRSDYVRTARAKGQKMFIVVYKHALKNAVIPVLTVIGLQTGLLLGGAILTE
FT                   TIFSWPGIGRYIYDAIGFRDYPVIQSGILIVAFIFIMINLIVDLLYTVVDPRIKYK"
FT   gene            340362..341258
FT                   /locus_tag="Bsph_0320"
FT   CDS_pept        340362..341258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0320"
FT                   /product="dipeptide ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37949"
FT                   /db_xref="GOA:B1HUR9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUR9"
FT                   /protein_id="ACA37949.1"
FT                   /translation="MMTGAIDIKKEAAPVRERAVGPWLEGWRSFKKSKVSLVGAGIVIF
FT                   FVLLAVIGPFIAPQGINEQDLTKRLLAPSADHWFGTDDFGRDIFSRIIHGARISLWVGF
FT                   FSVILSVIIGSLLGIIAGYYGKWIDTIISRIFDIMLAFPSMLLAIAVVSVLGPSLQNAL
FT                   IAIAIINIPNFGRLIRSKVLSVKEEEYIVAAKAIGMRDSRILFSHILPNSITPIIVQGT
FT                   LAIATAIIEAAALGFLGLGAQAPAPEWGKMLADARKFLLNAPWTMIFPGLAIMLTVLGF
FT                   NLMGDGLRDALDPKMKN"
FT   gene            341523..342140
FT                   /locus_tag="Bsph_0321"
FT   CDS_pept        341523..342140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0321"
FT                   /product="Stress response protein SCP2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37950"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS0"
FT                   /protein_id="ACA37950.1"
FT                   /translation="MAINLQKGQRVDLTKGNAGLNKIKVGLGWDPVGQEKSGGFLGGLF
FT                   SSRNSGSGRSVDCDASVLMLQDDKVLAGDDVIYFGKLTSNCGSVRHSGDNLTGDGDGDD
FT                   EVITIELSSVPTQFNKLVFVVNIYDAAGRNQHFGMIRNAYIRVYDDRTGSELIRYNLSD
FT                   DYSNLTTLICGEIYRHQTEWKFAAVGSGTNDLKLGDVVRRYQ"
FT   gene            342173..342754
FT                   /locus_tag="Bsph_0322"
FT   CDS_pept        342173..342754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0322"
FT                   /product="General stress protein 16U (GSP16U)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37951"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS1"
FT                   /protein_id="ACA37951.1"
FT                   /translation="MGISLQKGQKVDLTKTNPGLTNVIVGLGWDTNKYDGGNDFDLDSS
FT                   VFLLADTGKVADQNDFIFYNNTTGGNGSVEHSGDNLTGIGEGDDEVVKVALAQVPAHVQ
FT                   RLAFTVTIHDAESRNQNFGMVSNAYIRIVNAASNQELIRYDLGEDFSIETAIVVGELYR
FT                   HNGEWKFNAVGAGYQGGLAALCNDYGLNVN"
FT   gene            342788..343363
FT                   /locus_tag="Bsph_0323"
FT   CDS_pept        342788..343363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0323"
FT                   /product="Hypothetical yceE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37952"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS2"
FT                   /protein_id="ACA37952.1"
FT                   /translation="MAIQLSKGQRIDLTKQDPGLNNIGIGLGWDVKQFDGGQDFDLDAS
FT                   VFLLDASGKCRNEQDFIFYNNLASPDQSVVHAGDNRTGEGDGDDEKILVNLKQVSPQID
FT                   KIVVTVTIYDAEGRHQNFGQVLNAYVRLTNEESGAEVLRYDLGEDFSIETAVVFCELYR
FT                   HNGEWKFAAIGSGYQGGLAALINAYGLQ"
FT   gene            343473..343658
FT                   /locus_tag="Bsph_0324"
FT   CDS_pept        343473..343658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37953"
FT                   /db_xref="GOA:B1HUS3"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS3"
FT                   /protein_id="ACA37953.1"
FT                   /translation="MMHTIALVFLCLIERVSELETSAYILIPTIVWNMFAHIFGFHLLH
FT                   EAFFIILIAAFLLSSY"
FT   gene            343781..344974
FT                   /locus_tag="Bsph_0325"
FT   CDS_pept        343781..344974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0325"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37954"
FT                   /db_xref="GOA:B1HUS4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS4"
FT                   /protein_id="ACA37954.1"
FT                   /translation="MQHFATEAETIFYKKPQPFTKWATPDILSYALGATLYMPASMPNI
FT                   VGLIQSQKYKELTSLVIDLEDAVGDSELGDCEAKLLEDISELYKLYHQKQLLLQDIPLL
FT                   FIRVRHVEQFNYLTSSLKEKQEVLTGYVFPKFTATQGAQYFELLEKTILENNLTLYGMP
FT                   ILESREVLYKESRMEALLAIKSVLQQYQSRVLNIRIGATDFCGIYGIRRRMDSTIYDIS
FT                   LIRDCIADIVNVLGREEDGFVISGPVWEYFSNQRVLKPALRMTPFSEKGALETRKALLD
FT                   DCLDGLIKEVLMDKQNGIVGKTVIHPSHIRVVHALYAISYEEYLDALSIVEHNDGSKGV
FT                   MKSHYANKMNEIKPHMRWAQRILKQAHVYGVYHETVDFASLLLNSELGGHMYATTNE"
FT   gene            344955..346313
FT                   /locus_tag="Bsph_0326"
FT   CDS_pept        344955..346313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37955"
FT                   /db_xref="GOA:B1HUS5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS5"
FT                   /protein_id="ACA37955.1"
FT                   /translation="MQQQMSKLTILPNYSIDIEITHNPHDFALTDLFQMAARINKKRQF
FT                   LFISTVLGKHLAVRPQIPLLTGALLAMMYDQQGNNQKVNTITPVVQALKEGINLEELQN
FT                   SMKGSVELAHKTLFIGFAETATALGHAVFNAFQSNAMYIHTTREVIPHIEPFVTFEEEH
FT                   SHATSHRIYTEEPNVLQQAKRIVLIDDEITTGNTVINIIETLKKKFPDVKQYVVLSILD
FT                   WRSEQQRIVFQQLEEQWEISIKFISIMCGTFNCTGVPSLTSVQPKVTTIATRDITLLPI
FT                   KDSIDRLFYYSVAENGKINNQPYLKATGRFMLTSKQHFEQMNMLQAIAKQLKELRTDGP
FT                   ALVIGTGEFMYVPMQIASYLGEGVYFQSSTRSPIYCTDDVDYTITEKIVFESPENNGVE
FT                   NYLYNVQSQLYTELFLIIERISNKEVVDRMVAALQSVSGAKVYVICMHELEGV"
FT   gene            346310..347413
FT                   /locus_tag="Bsph_0327"
FT   CDS_pept        346310..347413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37956"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS6"
FT                   /protein_id="ACA37956.1"
FT                   /translation="MMTSTLQPDNMGSYAREDVIFLLRDIGNVFLEMGNEKREQLIQAG
FT                   THYSEMLPMEYQPSKTYMKLFYKTLDAFADRIAIAVGVVAERIVKSRGLENLILVSLAR
FT                   AGTPIGILIKRYISMNYKVDVPHYSISILRGRGFDEAAIRYILSEHPQGCLQFIDGWTG
FT                   KGAITKELIQSCQTFNEQYQTQLKADLAVLADPGHCATIFGTREDFLIPSACLNSTVSG
FT                   LVSRTVLNLQFMDKDDFHGAKYYKELEDMDVSNLYINRIVACFKQVRNEITSQLQDEAT
FT                   SLITWAGMKSVQNIQLDFDMENINLIKPGVGETTRVLLRRIPWKILINPQYKDELEHIL
FT                   LLAHEKNVVLEEYSHMSYACCGLIKEL"
FT   gene            347476..348237
FT                   /locus_tag="Bsph_0328"
FT   CDS_pept        347476..348237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37957"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS7"
FT                   /protein_id="ACA37957.1"
FT                   /translation="MMEMFPPISDKVVVEHKANEKMSMMTKETAILLQQVHQQTLFVPV
FT                   TTRALHQYKRIHFINDLNPSFAITSNGGTILEKGQPCDKWTKTLGRRIEDSSIPREDML
FT                   QIFHTIKSDTWLQRSFYIDDLFYVHHVNLDVLQQDDLRAMTQEFDTHGWYVFLQGKKLY
FT                   FMPKVLTKEAAIQYMMEFCTYDVHIAAGDSMMDYGMLKMADVAFTPNHGDLKDKQPETL
FT                   LNTTYSPYEGEAFTKHLLQAVLQHTTQQTVV"
FT   gene            348597..350228
FT                   /locus_tag="Bsph_0329"
FT   CDS_pept        348597..350228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0329"
FT                   /product="Hypothetical yceG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37958"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS8"
FT                   /protein_id="ACA37958.1"
FT                   /translation="MQTITIKTIVERNQDDWLQAFQDSPKNRAFYEETPQQICFSRMAL
FT                   RVLGVPIEEDEYFNSLYTLSQNQNIHILSEELNKHIEQKDFQAIQNILSQHQQTPKGLT
FT                   INRLVAMMYGYQLIPKHDDSIMNRHLQLTTIKVIELFQHQQSLGLLSNEFRRFLIDLVK
FT                   WLKNHWIQWAKALKPTDDFPKVVWYGEATVSQRYFLLLLMELGCDVLIFHPAKVDEFAE
FT                   VDPNDDFSISYSYTSQTSLQPFPDKLRDRQATVGYRSSQHFEQLMHDQQSGVYRPWQFK
FT                   DFMPRSLTLRMTYDDIFIYAKEKALVRPQFDVNGNEVVIPVIFAKISGVSSQREEYWHF
FT                   MHQLLINPQTIFVQEFPFTKTSKANFHFHYKHCLVNGELSAERIIQSDWWQYGELSLEL
FT                   QQAIAYTIKTSCEQPMLKQQPNETLYDLQLFVFKQLTMIPQEILRLLQSFDYSQEIPKI
FT                   IMYQAPQQPALSREDIALLAFLNRFGMDIIFYNPTGQLDLEKHLLEDTYDVHRLEHMLF
FT                   DLPYEEPSQQKAAPDKIIKKLFNRFF"
FT   gene            350266..351285
FT                   /locus_tag="Bsph_0330"
FT   CDS_pept        350266..351285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0330"
FT                   /product="probable tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37959"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUS9"
FT                   /protein_id="ACA37959.1"
FT                   /translation="MTLEQLTLETADAVKQQLREHEEVQQIAHQIDIKNQLELIELGKE
FT                   PATKLSKFADQVLAIVTQSATFESNELFKQLESLMLTFDKKDFAEQKGFFKKLFTRKSK
FT                   NEEDVYAKYNVLGRDIEKIHYQFVLMEEELAKDNRLLARLYKEDLMFYLDIEKYIVATD
FT                   MKLHEVQTTLIPLYEEQGEAGNQVAKMELNRLQTIAEMLQQKIDELEKSRMVAILTAPQ
FT                   IEMLRHGNNELIEQIHGAFVKTIPVFKMGLMNAVNERRQQLQNQSASAFENRVKQFGEA
FT                   SNEAVHLSTALAQQTDKTQTLEEMWDTIVTGIANYQHLRSEQTSKRKLAEQQLLALRP"
FT   gene            complement(351377..352465)
FT                   /locus_tag="Bsph_0331"
FT   CDS_pept        complement(351377..352465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0331"
FT                   /product="Hypothetical ygaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37960"
FT                   /db_xref="GOA:B1HUT0"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT0"
FT                   /protein_id="ACA37960.1"
FT                   /translation="MKLGARVFKTGVAIVFALFIAELLKLPSPVFAGIAAIFAIQPSIY
FT                   RSYQTIVEQVQANIIGATIAVFFGLLFGHHVVAIGIAVIIAIGLMLKFKLEKSLSLALV
FT                   SVVAIMEFQGEDFLTFGLIRFVTILVGVLAAFVVNLVFLPPKYEIKLFRKIYILQDDII
FT                   RWTRLAVRQASEHTSTKGALSKFKSRMLRVDTLYDLYKEERNYFKNKKYVKARKLVVYR
FT                   QMILTSKKSLELLQRLHNHENELAKLPTQFHLMIQERLDSLLTYHEQLLLKYTGKLKPE
FT                   HSEWSKSIDYVQRNELMEIFIKQVNFAREEGDTEFSSYHLLYILSRILDYEENLEHLDT
FT                   LIVSYQSYHGHEINVEFEEEFI"
FT   gene            complement(352598..353887)
FT                   /locus_tag="Bsph_0332"
FT   CDS_pept        complement(352598..353887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0332"
FT                   /product="Glutamate-1-semialdehyde 2,1-aminomutase 1"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37961"
FT                   /db_xref="GOA:B1HUT1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HUT1"
FT                   /protein_id="ACA37961.1"
FT                   /translation="MNHAKSEAVHAEALQHIVGGVNSPSRSYKAVGGGSPVAMVRGKGA
FT                   YFWDVDGNRYIDYLAAYGPIVTGHGHPHIAKAITHAAENGTLFGTPTEYEVTFANMLKE
FT                   AIPSMDKVRFNNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHFDLVLVAAGSGPATL
FT                   GTPDSAGVTTSTAEEVITVPFNNPEAFTEAMNTWGDEIAAILIEPIVGNFGIVEPNPGF
FT                   LELVHATAKEKGALTIYDEVITAFRFHYGGAQNLLGLTPDLTALGKVIGGGLPIGAYGG
FT                   RKEIMDTVAPLGPAYQAGTMAGNPASMQAGIACLEVLQTPGIYDEMDRLGGILEEGILA
FT                   AAKEHGVTITLNRLKGALTIYFTDVKVENYEQAENSNGEIFGRFFKLMLEQGVNLAPSK
FT                   YEAWFLTTEHTEADILETIKAVNYAFSQLS"
FT   gene            354017..354493
FT                   /locus_tag="Bsph_0333"
FT   CDS_pept        354017..354493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0333"
FT                   /product="Putative peroxiredoxin bcp"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37962"
FT                   /db_xref="GOA:B1HUT2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT2"
FT                   /protein_id="ACA37962.1"
FT                   /translation="MTLQEGQKVPDFSLMNEKGETVQLTDFKGQNVILYFYPKDMTPGC
FT                   TTEACDFRDRFEDFSHLNAVVLGVSPDDANKHTKFIDKHGLPFSLLVDEDHAVAEAYGV
FT                   WVLKKMYGREFMGIERSTFLIDSEGKLMKAWRKVRVKNHIEEVYAYLAEQEATT"
FT   gene            354490..355434
FT                   /locus_tag="Bsph_0334"
FT   CDS_pept        354490..355434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0334"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37963"
FT                   /db_xref="GOA:B1HUT3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT3"
FT                   /protein_id="ACA37963.1"
FT                   /translation="MRIYFTFEPRPDLREPLLAEFPQVDFIFESGITNEELQKADVLVT
FT                   YGENLTTESIQQATKLKWIFVASAGIEKMPAQAIMERGILVSNVRGIHKTPMAESMLAH
FT                   ILAIKRALPWMYEQQKKGEWSKKAKQTELRDSTALILGPGAIGSEVGRLLQAFGVTTIG
FT                   CNRSGNEASNMDKMISFEQLIEVLPSADIVISVLPKTQETTHLLNEEHFIAMKSSAIFM
FT                   NFGRGNLVDEKVLIQALEDGEIGYAVLDVFEEEPLSSDNPLWALPNVIVSPHVSSHSSR
FT                   YVERSLEIFKTSLTKWLRGDRDLENVMELSRGY"
FT   gene            355547..355996
FT                   /locus_tag="Bsph_0335"
FT   CDS_pept        355547..355996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0335"
FT                   /product="Peroxide operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37964"
FT                   /db_xref="GOA:B1HUT4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT4"
FT                   /protein_id="ACA37964.1"
FT                   /translation="MTMSTTHLQDALDTLKTTGVRITPQRHAILEYLIQSMAHPTADEI
FT                   YKALEGKFPNMSVATVYNNLRVFREVGLVKELTYGDASSRFDFVTNDHYHMICECCGKI
FT                   VDFHYPGLDEIEHFASQVTDFDVHSHRLEIYGTCPSCKGVTAKVQ"
FT   gene            complement(356018..356371)
FT                   /locus_tag="Bsph_0336"
FT   CDS_pept        complement(356018..356371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0336"
FT                   /product="UPF0295 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37965"
FT                   /db_xref="GOA:B1HUT5"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HUT5"
FT                   /protein_id="ACA37965.1"
FT                   /translation="MKPYKSKINKIRSFALALIFIGFIVMYGGIFFKNSPILVLIFMTL
FT                   GVLCIIGSTVVYAWIGLLSTRAIQVECPNCHKHTKVLGRVDMCMYCNEPLTLDPTLEGK
FT                   EFDQSYNHKTKKS"
FT   gene            356497..357405
FT                   /locus_tag="Bsph_0337"
FT   CDS_pept        356497..357405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0337"
FT                   /product="Hypothetical ygxA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37966"
FT                   /db_xref="InterPro:IPR029348"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT6"
FT                   /protein_id="ACA37966.1"
FT                   /translation="MNKGGLNMEQVLRPIYQERASQSNTLGVILVEKREEQSNVTDTFD
FT                   TVLLIIVKEAEQPVFSKHYLYEGNKVALHTVTEKLIRKWLLIGSNKKVVDWIFFGRVLF
FT                   DRNEFLHKLKIELQEFPYSGRKIKTGIQFSKLIRRYLEGKEYFDKGSYLDAYNHVVDSL
FT                   HHLGRLSIIDSGLYPEVTVWGQVKKIEPAIYKLYEELVTSNEPIEKRLELLFLASEFLI
FT                   HSRTRDGAQHILEVMQTKETWSIQELHDHHELMNYSVDLEVFVEYLVDKGYIHIEPVTA
FT                   KNEMIFHRHYKVDKEALEIGQ"
FT   gene            357759..359302
FT                   /locus_tag="Bsph_rRNA0616S"
FT   rRNA            357759..359302
FT                   /locus_tag="Bsph_rRNA0616S"
FT                   /product="16S ribosomal RNA"
FT   gene            359626..362542
FT                   /locus_tag="Bsph_rRNA0623S"
FT   rRNA            359626..362542
FT                   /locus_tag="Bsph_rRNA0623S"
FT                   /product="23S ribosomal RNA"
FT   gene            362660..362766
FT                   /locus_tag="Bsph_rRNA065S"
FT   rRNA            362660..362766
FT                   /locus_tag="Bsph_rRNA065S"
FT                   /product="5S ribosomal RNA"
FT   gene            362788..362864
FT                   /locus_tag="Bsph_tRNA10"
FT   tRNA            362788..362864
FT                   /locus_tag="Bsph_tRNA10"
FT                   /product="tRNA-Asn"
FT   gene            362870..362961
FT                   /locus_tag="Bsph_tRNA11"
FT   tRNA            362870..362961
FT                   /locus_tag="Bsph_tRNA11"
FT                   /product="tRNA-Ser"
FT   gene            362986..363060
FT                   /locus_tag="Bsph_tRNA12"
FT   tRNA            362986..363060
FT                   /locus_tag="Bsph_tRNA12"
FT                   /product="tRNA-Glu"
FT   gene            363080..363155
FT                   /locus_tag="Bsph_tRNA13"
FT   tRNA            363080..363155
FT                   /locus_tag="Bsph_tRNA13"
FT                   /product="tRNA-Val"
FT   gene            363181..363255
FT                   /locus_tag="Bsph_tRNA14"
FT   tRNA            363181..363255
FT                   /locus_tag="Bsph_tRNA14"
FT                   /product="tRNA-Met"
FT   gene            363259..363334
FT                   /locus_tag="Bsph_tRNA15"
FT   tRNA            363259..363334
FT                   /locus_tag="Bsph_tRNA15"
FT                   /product="tRNA-Asp"
FT   gene            363351..363426
FT                   /locus_tag="Bsph_tRNA16"
FT   tRNA            363351..363426
FT                   /locus_tag="Bsph_tRNA16"
FT                   /product="tRNA-Phe"
FT   gene            363434..363509
FT                   /locus_tag="Bsph_tRNA17"
FT   tRNA            363434..363509
FT                   /locus_tag="Bsph_tRNA17"
FT                   /product="tRNA-Thr"
FT   gene            363519..363602
FT                   /locus_tag="Bsph_tRNA18"
FT   tRNA            363519..363602
FT                   /locus_tag="Bsph_tRNA18"
FT                   /product="tRNA-Tyr"
FT   gene            363626..363699
FT                   /locus_tag="Bsph_tRNA19"
FT   tRNA            363626..363699
FT                   /locus_tag="Bsph_tRNA19"
FT                   /product="tRNA-Trp"
FT   gene            363712..363787
FT                   /locus_tag="Bsph_tRNA20"
FT   tRNA            363712..363787
FT                   /locus_tag="Bsph_tRNA20"
FT                   /product="tRNA-His"
FT   gene            363832..363907
FT                   /locus_tag="Bsph_tRNA21"
FT   tRNA            363832..363907
FT                   /locus_tag="Bsph_tRNA21"
FT                   /product="tRNA-His"
FT   gene            363912..363986
FT                   /locus_tag="Bsph_tRNA22"
FT   tRNA            363912..363986
FT                   /locus_tag="Bsph_tRNA22"
FT                   /product="tRNA-Gln"
FT   gene            363993..364067
FT                   /locus_tag="Bsph_tRNA23"
FT   tRNA            363993..364067
FT                   /locus_tag="Bsph_tRNA23"
FT                   /product="tRNA-Gly"
FT   gene            364076..364149
FT                   /locus_tag="Bsph_tRNA24"
FT   tRNA            364076..364149
FT                   /locus_tag="Bsph_tRNA24"
FT                   /product="tRNA-Cys"
FT   gene            364197..364280
FT                   /locus_tag="Bsph_tRNA25"
FT   tRNA            364197..364280
FT                   /locus_tag="Bsph_tRNA25"
FT                   /product="tRNA-Leu"
FT   gene            364580..364735
FT                   /locus_tag="Bsph_0340"
FT   CDS_pept        364580..364735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37967"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT7"
FT                   /protein_id="ACA37967.1"
FT                   /translation="MERLEVIFMKKVISGQQDEFKGNDTANGIDKMFSGQPVHPTCRNM
FT                   FEADIV"
FT   gene            complement(364865..366160)
FT                   /locus_tag="Bsph_0341"
FT   CDS_pept        complement(364865..366160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0341"
FT                   /product="sphaericase (sfericase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37968"
FT                   /db_xref="GOA:B1HUT8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT8"
FT                   /protein_id="ACA37968.1"
FT                   /translation="MKKMKSTLLSLLIAGSVINPVYATAMDSEDSLGNDGGQEKFRVYV
FT                   EANKKTEKSTLKTQYSARWELTENGFSTDMNEKQFEALQKNKNFTVTKVPIVTLDTIGL
FT                   EDDSMVENETLDLVTSLRASQQIPWGIKAIYNNDTLTSTTGGSGINIAVLDTGVNISHP
FT                   DLVNNVEQCKDFTGATTPINNSCTDRNGHGTHVAGTALADGGSDQAGIYGVAPDADLWA
FT                   YKVLLDSGSGYSDDIAAAIRHAADQATATGTKTIISMSLGSSANNSLISSAVNYAYSKG
FT                   VLIVAAAGNSGYAQGTIGYPGALPNAIAVAALENVQQNGTYRVADYSSRGYISTAGDYV
FT                   IQEGDIEISAPGSSVYSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSN
FT                   LQERAKSVDIKGGYGAAIGDDYASGFGFARVQ"
FT   gene            366290..367516
FT                   /locus_tag="Bsph_0342"
FT   CDS_pept        366290..367516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0342"
FT                   /product="Transcriptional activator nprA"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37969"
FT                   /db_xref="GOA:B1HUT9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUT9"
FT                   /protein_id="ACA37969.1"
FT                   /translation="MKMKIGSLIKYYRTKLGMTQNSVAMGICSIPHLSKIENNNKEANS
FT                   ETIRLLLERLNISIHDVENNEQNIICLLNDLQKHINYLEIDKVKETMSRLKEYEEIIGF
FT                   TESIYLYELYKLRYYVFVKEHKLADNQLKWLNAHRPNFSQHERYLHSYYYALVLITKGK
FT                   YEEAAKELTQILQIHPELGSLEGEFYYHFALIKGRLEEPSQAIIYGKKALQFYKDQFNF
FT                   KRIVYTLMSLALNYSRGKVFHEAIEIYEHLVRNVELLQQQQLLPAIYHNLGDLYQMRWE
FT                   YENALIYFEKSASLMSKNCDHYLLCLYNLGVTQFRLEQTEKSIKTFTILKEEAKNKKKL
FT                   SFNLFATFYLYLLGEEKKKAMDFLEGRLIPFIADNEELKEMHQQFSNLLGEYYRQEKQF
FT                   EKAMQFIEI"
FT   gene            367951..368982
FT                   /locus_tag="Bsph_0343"
FT   CDS_pept        367951..368982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0343"
FT                   /product="putative ABC-transporter transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37970"
FT                   /db_xref="GOA:B1HUU0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU0"
FT                   /protein_id="ACA37970.1"
FT                   /translation="MNLAWKEMKKNKVRFLILGSIIFLVSFLTFIISGLANGLSQDNAA
FT                   LIKDLPQGQFYMTEDADGTFNLSRISNNLQQEVMSEEKEAVAFSIQMGFLSDEDDKQQS
FT                   VAFVTSTESSLFRNVRQGEVLLDSSLQEKGIKVGDILANNQYSGEFKVKGFVEQKKYSH
FT                   APVAYISKEAYQEMYRIQDMQLIFVPHNAAKDFEGLQSYSNKEFLNAIPSYSAEQMSLN
FT                   MIIWFLVVISGMLFAIFFYMMNVQKIGLYGILKAIGLKTGRLFNMIWTQMVIITAISLV
FT                   LSVSLSQLFNIVAPKGMPFTLNFGTTMQLSLVFLVIGFVGATLSGLQIKKIQPLQAIHQ
FT                   GEA"
FT   gene            368985..369680
FT                   /locus_tag="Bsph_0344"
FT   CDS_pept        368985..369680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37971"
FT                   /db_xref="GOA:B1HUU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU1"
FT                   /protein_id="ACA37971.1"
FT                   /translation="MTLFTIDEVRKTFKNGDVEEEILKGINLSLKEGEITALVGASGSG
FT                   KSTLLTIAAGLQPATDGQILFEGQNLTTMNEEQVRKLRASKFGFVFQFAHLVPFLTVEE
FT                   QLLLMLDVAGSPLKKHEQKHEVNRLLQLVGLAHRQDAYPSSLSGGEKQRVAIARAIIHQ
FT                   PKVLFADEPTASLDSQRSKEIMMLLRTLTKTLSITTLLVTHDEEMLAYTDRIIKMSDGV
FT                   VLQNKQGSH"
FT   gene            complement(369700..370509)
FT                   /locus_tag="Bsph_0345"
FT   CDS_pept        complement(369700..370509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0345"
FT                   /product="short chain dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37972"
FT                   /db_xref="GOA:B1HUU2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU2"
FT                   /protein_id="ACA37972.1"
FT                   /translation="MKKIAVVTGGVSGIGKAICQELITRHIFVIIADIQEQEGRMLEAQ
FT                   LNKDAVHAKFVPLNVTDYNSVASVIHGVIEEYHRIDYLFNNAGIAMYGELGETTIEDWK
FT                   EIMAINLWGVIYGTQLGYSLMKKQGFGHIINTSSAAGLGPSPFSSAYATTKHAVIGLTT
FT                   SLHYEAEEFGIKVSALCPTFVDTPIFDNAKAIHMDKSIITKQLQQQKMISPQRIAKIAI
FT                   EGVHQNKPIICPMPMRKTMDVIFTIFPFLHKALMRMVCKVSRNARLT"
FT   gene            complement(370513..371214)
FT                   /locus_tag="Bsph_0346"
FT   CDS_pept        complement(370513..371214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37973"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU3"
FT                   /protein_id="ACA37973.1"
FT                   /translation="MKVGLIGDSLTEGRPGVSFYNLLKLQYPHISFDNLGNPGETIKSL
FT                   FTRLEKTPLQSSYDLLFLWVGVNDVYSKLLKVQAQPVTKDHIEFEEYCLKVLEKAHTAS
FT                   KNVVLVSPALVGEDLQNHSNNEVKELTSVMESIALKSGNVYFVNMQNLFKEHLEHLDCS
FT                   SFINTSVMRVLLDVLFYKNPLRIDKLSQKRGLHVTMDGVHLNSKGADIVAQQYSSIIEH
FT                   YANEGDKIGRS"
FT   gene            complement(371215..371811)
FT                   /gene="qacR"
FT                   /locus_tag="Bsph_0347"
FT   CDS_pept        complement(371215..371811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qacR"
FT                   /locus_tag="Bsph_0347"
FT                   /product="HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37974"
FT                   /db_xref="GOA:B1HUU4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU4"
FT                   /protein_id="ACA37974.1"
FT                   /translation="MNKRRYDSDKAKLEIIKHATQLFSQHGYNQTSVGDISKVSGYSKG
FT                   HIYYHFENKEKLFVLLAQQSMKNWHDKWLQKESSYTTSTEKLYGMALHVLYEYQTPLLK
FT                   SGQELASNPKSTPESIQQLFNLAITPMNAYRVILQEGIDQNEFVHGDVDTWTVLLGTWL
FT                   GGLCQLTNTQHLKSLEPLFQQAITIFLKEIKKGGI"
FT   gene            372043..372333
FT                   /locus_tag="Bsph_0348"
FT   CDS_pept        372043..372333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37975"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU5"
FT                   /protein_id="ACA37975.1"
FT                   /translation="MFGWRIAAPNWDYWPVTTGHESKIGINGGISKGPSDYPHGTRIQI
FT                   EVDAMDEVIEQATSNGATILRGKMEFEDFYLAYLMDPTGIEIGLIQHKNNE"
FT   gene            372479..373501
FT                   /locus_tag="Bsph_0349"
FT   CDS_pept        372479..373501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37976"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU6"
FT                   /protein_id="ACA37976.1"
FT                   /translation="MQAASFKDLTDDTLMTEIHYLVEQDIVKGYSNQLFKPNDYVTKAQ
FT                   VAVMLTRALGLNTINIQNPNYQDVTPANKYYKEIAAVQKKGIFDAAHKFNPDAPLTRAE
FT                   MAIVLNRAFKLKGSDPYYFTDVTEQTYGYKEILTLAHNHLVRGYENGEFKPNAPVTRAH
FT                   FSAFLARALTLSKPSLLKDPAFVYTYGYYSLSDHKRYTLSYQYKQHDGKNDVWTVKNIS
FT                   TGQTLSDELLYGHDRVYGQAIASDANTHYDLYMELPLRIGVILHEDDPGVTAGERVTVK
FT                   STNGTVQAGEVQYTGVIIVEKRSVYSDVVKTYYFVDDIGLVKELHNDKVVFELFNRTMK
FT                   "
FT   gene            complement(373542..374288)
FT                   /locus_tag="Bsph_0350"
FT   CDS_pept        complement(373542..374288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0350"
FT                   /product="N-hydroxyarylamine O-acetyltransferase"
FT                   /EC_number="2.3.1.118"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37977"
FT                   /db_xref="GOA:B1HUU7"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU7"
FT                   /protein_id="ACA37977.1"
FT                   /translation="MNAQIQQYLQHIQFQGTLEPTVQLLGQLQTKHLLTIPYENLDVAL
FT                   NLGISFSIPDLFQKIIIERRGGNCFELNILFSWLLRELGFSVTNRYAQFWRNVEEHSPP
FT                   EDIPMHQLLLVKDAKQSYISDVGVGALAPCKPVPLIAGYQHREGRELYKVEYDEENGWM
FT                   LFELTKQQWRLLYCFHDDANDAKFAPRLSKQKNKIAMIRTTRGRHTMMNNEFRIYEGQS
FT                   LTTYTTNTEKEWLQALQRFFHISLQQ"
FT   gene            374475..375188
FT                   /locus_tag="Bsph_0351"
FT   CDS_pept        374475..375188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0351"
FT                   /product="Glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37978"
FT                   /db_xref="GOA:B1HUU8"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HUU8"
FT                   /protein_id="ACA37978.1"
FT                   /translation="MKWIEVNTYDEMSEVAANIFLKQIQKKPNSVLGLATGGSPVGMYK
FT                   ELVARYQAGQLTFKDVQTFNLDEYVGLKRSSPASYWTFMHNNLFNGVNIKQENIHLPNG
FT                   EAEDLAAECKAYDARIDAAGGIDLQLLGIGVNGHIGFNEPGTPFDSMTNIVELTESTRT
FT                   ENAIYFDDAADVPIHAITMGIQSIMKAKEIVLIAFGEKKMEAIQKLKSGHITEDFPASQ
FT                   LLKHPNVTIIYGGTN"
FT   gene            375479..376387
FT                   /gene="ykfA"
FT                   /locus_tag="Bsph_0352"
FT   CDS_pept        375479..376387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfA"
FT                   /locus_tag="Bsph_0352"
FT                   /product="YkfA"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37979"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUU9"
FT                   /protein_id="ACA37979.1"
FT                   /translation="MNVKNTVPRLQKGDLVGVVALSSVVNHEKLGDALSFLDELGLHYI
FT                   VGDTIHATHDYLAGSDEVRLADFHEMVKNPEVKAIFCVKGGYGSARIAEKIDYTLLEEN
FT                   PKIFWGFSDITYLHCAINEYANLVTFHGPMLMAANKMDELSKKMFVQLFSPIEIQYTES
FT                   ISPLTTIAGGVARGELIGGNLYRLVSTLGTKFEIQTEGKILLIEELAESIPNIDSMLQQ
FT                   LKQARKIEQLAGVVIGSFTQTEANETALHNLMKEYFGDLGIPVVAGFKIGHESTNVGIP
FT                   LGVDAYLDAEEKVLKILPGVY"
FT   gene            376398..376811
FT                   /locus_tag="Bsph_0353"
FT   CDS_pept        376398..376811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0353"
FT                   /product="cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37980"
FT                   /db_xref="GOA:B1HUV0"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV0"
FT                   /protein_id="ACA37980.1"
FT                   /translation="MLNDMDIEKKLYEAAVQLVEKRYPSGWGGAAALYSEDGHILTSVA
FT                   PEVINAATELCMETGAILEAHKLNTKVTHSICVARENEKSKFVVLTPCGVCQERLFYWG
FT                   ENVKAAVTNTDDTLLFKTLKEIQPYHWYKAYEQ"
FT   gene            complement(376859..378445)
FT                   /locus_tag="Bsph_0354"
FT   CDS_pept        complement(376859..378445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0354"
FT                   /product="Catalase X"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37981"
FT                   /db_xref="GOA:B1HUV1"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV1"
FT                   /protein_id="ACA37981.1"
FT                   /translation="MTQKNDSTHDQDTTLTNRQGHPITNNQNLRTVSNRGPATLENYDF
FT                   LEKISHFDRERVPERVVHARGAGAHGYFETYGVVGNEPISKYTRAKVFQDKGKKTPVFV
FT                   RFSTVIHGGHSPETLRDPRGFAVKFYTEDGNWDLVGNNLKIFFIRDAMKFPDMIHAFKP
FT                   DPITNIQNVERFFDFCASSPESFHMVTFVYSPWGIPANYRMMQGSGVNTYKWVNQEGKG
FT                   VLVKYHWEPLQGIKNLTQKEAEEIQQKNFNHATQDLYDAIEREEFPEWELHVQIMEDGP
FT                   HPELDFDPLDDTKLWPNDQFPWYPVGKMVLNKNPEDYFAEVEQATFGTGVLVDGLDFSD
FT                   DKMLQGRTFSYSDTQRHRVGANYLQLPINAPKKRVATNQSGGQMMYKRDLAPGQNPHIN
FT                   YEPSMLNGLKEATQDGKEYTPYVEGNLVRESIDRQSNTKQAGETYRNFEQWERDELLAN
FT                   LIRDLSVCHMEIQNAMIALAEEADEEYGRLLKEGLHKARKESSTSKPLGNIDGDQAPQN
FT                   AIDKGHNAEPY"
FT   gene            complement(378744..379253)
FT                   /locus_tag="Bsph_0355"
FT   CDS_pept        complement(378744..379253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37982"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV2"
FT                   /protein_id="ACA37982.1"
FT                   /translation="MINLAEAVKLKSILGKKTQELISELHRSAFVTVEKGQTPKTSNRA
FT                   LPLIETELAQVRLDTLTLDRLVYEANIQNTVEFKDQKLALVEAIELATQLRAEAELCKE
FT                   FSMREKESVRFGYGDGAMLYEIALYEPDDYRERAMKLEKEAHKLSNLINSKNYSIQINF
FT                   DDSRYF"
FT   gene            complement(379269..379958)
FT                   /locus_tag="Bsph_0356"
FT   CDS_pept        complement(379269..379958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0356"
FT                   /product="Hypothetical yhzB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37983"
FT                   /db_xref="GOA:B1HUV3"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV3"
FT                   /protein_id="ACA37983.1"
FT                   /translation="MEISINESLLTQHPELKIGIIHYTKIVVAESPQMIKGRMQLYQEN
FT                   LFLDMQDFPVNQREGIAEWRVFWKKLGSDPNRYRHSAESLMRRISKQNYVTPFHSAVDL
FT                   NNFFSLQYEIPVGLYDIAFMKGYVEIALGHEDIGYEGLNGRFNTFNKILYSRDEKGAFG
FT                   SPFVDSKRTAVTEDTTEALQIFYLRPSLTHEAANDLLASAGKMFNQIHGGDYQIALLSN
FT                   NAPSTSL"
FT   gene            380018..381151
FT                   /locus_tag="Bsph_0357"
FT   CDS_pept        380018..381151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37984"
FT                   /db_xref="GOA:B1HUV4"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV4"
FT                   /protein_id="ACA37984.1"
FT                   /translation="MNIHDLQRDFVAYARAIGVDKIGFTTAAPFTELKNRLRRQQELGY
FT                   QSGFEESDIEKRTEPLQLLNEAESIVSIAVAYPSRMQNAPIGKKGARRGIFCRASWGVD
FT                   YHTAIRERLKLLSAWLEERVEGVRIESMVDTGALVDRAVAERAGIGWSGKNCSIITPEF
FT                   GSYVYLGELITNVPFSPDKPMEDECGECRLCLDVCPTGALIQGGQLDAQRCIAFLTQTK
FT                   GTLPDEFRNHIGNRLYGCDTCQTVCPKNKGKINWIHDEFIPDPELAKPLLTPLLTISNR
FT                   EFKAKFGHVSGSWRGKKPIQRNAILALAHFKEEAAIPDLINLLKNDDRPVIRGTSAWAL
FT                   GKIGGEQAKSALYDAEANEQDEEVLNEIHKGLQFFHE"
FT   gene            381219..381692
FT                   /locus_tag="Bsph_0358"
FT   CDS_pept        381219..381692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0358"
FT                   /product="Hypothetical tRNA/rRNA methyltransferase in gldA
FT                   3'region"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37985"
FT                   /db_xref="GOA:B1HUV5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV5"
FT                   /protein_id="ACA37985.1"
FT                   /translation="MPLHIVLYQPEIPANTGNIARTCAGTNTSLHLIRPLGFSTDDKML
FT                   KRAGLDYWHSVNIVYHNSLDDFIEYSRDGDVYLIETYSDEPFTTHDFSNKERDIYFMFG
FT                   KETTGLPKDFAYERRNMCLRIPQSDHVRSLNLSNTAAIVIYEALRQQGYPGLH"
FT   gene            complement(381728..382606)
FT                   /locus_tag="Bsph_0359"
FT   CDS_pept        complement(381728..382606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0359"
FT                   /product="Hypothetical yfiE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37986"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV6"
FT                   /protein_id="ACA37986.1"
FT                   /translation="MNKNNLTEVFYMHFHEKPNTYVTNVEIKVSDLQRSLTFYQEVIGF
FT                   NVLHQESHKATLTADGHTALLTIVQPDTVEEKLSMTTGLYHFALLLPTRRDLANIITHF
FT                   HEKGVYLGASDHAVSEALYLNDPDHNGIEVYADRPENVWDWHQDQVNMVTEPLNIRSIL
FT                   EEGDGNWDGLPSGTVMGHIHLSVSNLAEAEQFYTKGLGYDIVARYGSQALFISTGRYHH
FT                   HIGLNTWHSENAPKLGENQVGLKTFSLRLDNEEQASMMKANLRTIGARVIDIDGGFQTE
FT                   DPAGNVVLLKF"
FT   gene            382969..383139
FT                   /locus_tag="Bsph_0360"
FT   CDS_pept        382969..383139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37987"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV7"
FT                   /protein_id="ACA37987.1"
FT                   /translation="MKKKVPNIENGTMARDMKELKDLGKQMEHLRDGLELADDERIADP
FT                   IQLESIEEKDE"
FT   gene            383224..384054
FT                   /locus_tag="Bsph_0361"
FT   CDS_pept        383224..384054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0361"
FT                   /product="plant-metabolite dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37988"
FT                   /db_xref="GOA:B1HUV8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV8"
FT                   /protein_id="ACA37988.1"
FT                   /translation="MYLQSSKTLSNGVEMPRFGLGVYKMTDHEETLQSIDTALKFGYRA
FT                   IDTASLYGNEAEVGEAIRYSGIPREHIFVTTKVWNNDQGYDETLRAFEVSLKKLKMDYV
FT                   DLYLTHWAVPETFEETYRAIERLYDEKLIRATGVSNHHEHHLEKILAKANIAPMVNQVE
FT                   MHPYLQQQALSAYCHEHQIAVTAWSPLGRGGVLDDSTILEISKEIGKTTAQVVLRWHLQ
FT                   NDTLIIPKSVTPSRIEENAQIFDFELTQTQMEKIASLNRNQRFGQDPDHFKFDF"
FT   gene            complement(384079..384942)
FT                   /locus_tag="Bsph_0362"
FT   CDS_pept        complement(384079..384942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0362"
FT                   /product="Hypothetical RNA pseudouridine synthase yhcT"
FT                   /EC_number="5.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37989"
FT                   /db_xref="GOA:B1HUV9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUV9"
FT                   /protein_id="ACA37989.1"
FT                   /translation="MFLYAFNEDNLTIEELLRNHWRLGKKLVHELRMAKAITLENDELV
FT                   QWNTPLQVGTIVKFTFPIPASSYKRTPVCAIDIVYEDDHCLIVSKPKGMATHPNDDRDT
FT                   HTCMNHVMAHIQEQGGIYAEHVHRLDKGTQGLLLVAKHPLAKSIFDRMIEEKSIIRTYA
FT                   AEVQGNIRSSSGTISESIGKDRHHASRRVVSQTGQHAVTHYEVVSRYKNSCVVHLILET
FT                   GRTHQIRVHLAYIGHPIIGDTMYGARETASGDYELHAIQLEFDHPFLNKRITVKDEQSS
FT                   KNPASQ"
FT   gene            complement(384997..385422)
FT                   /locus_tag="Bsph_0363"
FT   CDS_pept        complement(384997..385422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0363"
FT                   /product="Probable disulfide formation protein (Disulfide
FT                   oxidoreductase) (Thiol-disulfide oxidoreductase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37990"
FT                   /db_xref="GOA:B1HUW0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR012187"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUW0"
FT                   /protein_id="ACA37990.1"
FT                   /translation="MSKKEENGLLFIWIVSAVATLGSLYFSEIRHYEPCKLCWIQRIFM
FT                   YPIVIMATVAFIQKNARIAVTTAVFSVIGGCISLYHYGIQKLSFLADSAPSCGAVSCTG
FT                   QYINWLGFITIPFLALTAFILIAGASFYLIKATKAVK"
FT   gene            385606..386721
FT                   /gene="liaS"
FT                   /locus_tag="Bsph_0364"
FT   CDS_pept        385606..386721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="liaS"
FT                   /locus_tag="Bsph_0364"
FT                   /product="Sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37991"
FT                   /db_xref="GOA:B1HUW1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUW1"
FT                   /protein_id="ACA37991.1"
FT                   /translation="MKENEHSNISILKEIAELLNEETEIVTMLKGALIKFLNGTNFETG
FT                   WIFFIDAKGRSELVVHENLPEALEFKNCHYLNKGGCWCVSRYRNEELKKASNIIECQRI
FT                   ESAIAANVGDHEGITHHATVPLQSGQERFGVLNVASKDTVRFSEEELALLESVAFQMGS
FT                   AIKRILLTKQEQEMALVKERNRLARDLHDSVNQLLFSVTLTARAGIEMTQDSDVKETFK
FT                   EIQHLTQDALTEMRALIWQLRPKGLENGLLEAIKVYAEMLGLKLHVTVSGVLQFPSRIE
FT                   ETLFRVAQEALNNVRRHAGVLEAALYITVTSTDILLVIRDEGRGFVIDNNTKLLSMGLQ
FT                   SIKDRAKSVGGTADWVSEMGKGTELLIRLPY"
FT   gene            386734..387381
FT                   /gene="yhcZ"
FT                   /locus_tag="Bsph_0365"
FT   CDS_pept        386734..387381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcZ"
FT                   /locus_tag="Bsph_0365"
FT                   /product="two-component response regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37992"
FT                   /db_xref="GOA:B1HUW2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUW2"
FT                   /protein_id="ACA37992.1"
FT                   /translation="MIRVLIADDHHVVRRGLLFFLKTQKDIEVVGEAKNGHEAVSLAES
FT                   IQPDIILMDLVMPELDGIQATKRIKAKFPKIEILMLTSFSDRDHVVPAMEAGAAGYQLK
FT                   DIEPDELVLSIRRIMRGENTLHPEATTTLEMDRQEAQNAPHSLNPLTPREQDVLAELTK
FT                   GKSNREIASSLFVTEKTVKTHISNIFTKLQVQDRTQAALYAVKHGLTEGSGS"
FT   gene            complement(387435..388556)
FT                   /locus_tag="Bsph_0366"
FT   CDS_pept        complement(387435..388556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37993"
FT                   /db_xref="GOA:B1HUW3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUW3"
FT                   /protein_id="ACA37993.1"
FT                   /translation="MIRAVLIDNEPLALHYFQNKLQVFQQIQVIQTFTSVEVFLNELPS
FT                   IEFEVLFLEVKLKELSGLEVADMIKTERPHVSVVFITSYHEFALQAYEIGGLDYLLKPI
FT                   SHARLEKTVTRIEHEFSIQQMLQQATQTLLNVQCFDQFAVYSNKSLVAFKTEKTKELFA
FT                   YFILHPNIPIHRDYLIEILWPDLDYVRAKSNLHTALSYLRKTLNTIGYENCIVFSNKYY
FT                   IFEKPSLVCDLYDFQKLHEDFSRLEFPSISLIHQCLAIYKNGLFVFDDYEWAKAYKDRL
FT                   TKSYIELLEKGFQTTVFSDTDKAIEFLHALLEYDPYNEQKLEHYLYTLIQAGLHEQAHK
FT                   IFLTYKQKLKEDLALPPSSTLLEISKKLFVESK"
FT   gene            389128..390054
FT                   /gene="yobV"
FT                   /locus_tag="Bsph_0367"
FT   CDS_pept        389128..390054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yobV"
FT                   /locus_tag="Bsph_0367"
FT                   /product="YobV"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37994"
FT                   /db_xref="GOA:B1HUW4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HUW4"
FT                   /protein_id="ACA37994.1"
FT                   /translation="MKLERLLTMIMILINRKKVTAQELAELFNVSVRTIYRDIETLSCA
FT                   GIPVISQQGVHGGISLIDGYRVDKQVLTKEELASLTIAIKSALTTYEDSHALAVLEKLT
FT                   SIADDHVTQTIDHLFVDLSPWGPNILFKEHITSLKSAIENRHCVSFTYTTAHGELTKRV
FT                   VEPHTIVQKGKTWYLYGYCTLRMDFRLFKLARIKNLMQEDLHFERKEINLSELPWGKEW
FT                   YQPQNVVDLVISFDTAITTLVEESFGVAYVDHGQDKIYISIPEDEWLYGFLLSFGNRIK
FT                   VLEPPHIRDILQKRAHEIAQLYNPDNS"
FT   gene            390106..390861
FT                   /locus_tag="Bsph_0368"
FT   CDS_pept        390106..390861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37995"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR025868"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVH6"
FT                   /protein_id="ACA37995.1"
FT                   /translation="MESTMMQSYCQSCGMPLTDEALLGTEKEGHKNQDYCTYCYEEGSF
FT                   KQPNLTVEEMIDICVPHLKGDGMPANEARTMLTSFLPSLKRWRKQEWSEPKIIKREAFQ
FT                   IIGISTKTSNANELTAQAKIPQLWQDFYEKNIVDQLSKLDNQNVYGLYSDYETDVNGNY
FT                   AITIGVEASKMNDASPEWVIKTIPAAKYLVFTSHKGKMPEIVIQTWQEIWAWFANSKVE
FT                   RTYTGDFELYDERCANPQEAQVEVYIAIK"
FT   gene            complement(390880..391788)
FT                   /locus_tag="Bsph_0369"
FT   CDS_pept        complement(390880..391788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37996"
FT                   /db_xref="GOA:B1HVH7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVH7"
FT                   /protein_id="ACA37996.1"
FT                   /translation="MELYTNLRQGEKGAWLSIGTYLILSSIKLTIGYIGTSEALKADGL
FT                   NNTTDIIASIAVLIGLRIAQRPPDSNHQYGHLRAETIASLVASFIMLVVGLQVLINSLK
FT                   SLWAPSGTTPSLLTAFVAIGSGAVMYIVYRYNLALSKKIKSSAVKAAAFDNRSDAFVSI
FT                   GTAIGIFGAIFGFPIIDSLTALIVAVLIIKTAVEIFGEAVQSLTDAFDIDEVETLSVLI
FT                   RNVDGVIELLDFKGRAHGNMYFIDITVTVDPYLNVFDSHRITEEIERTILRENRFCQVL
FT                   VHIEPHIEIIPPQNDEKSPTS"
FT   gene            complement(391982..393274)
FT                   /gene="yhdP"
FT                   /locus_tag="Bsph_0370"
FT   CDS_pept        complement(391982..393274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhdP"
FT                   /locus_tag="Bsph_0370"
FT                   /product="UPF0053 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37997"
FT                   /db_xref="GOA:B1HVH8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVH8"
FT                   /protein_id="ACA37997.1"
FT                   /translation="MTGFFVATEFAIVKVRTTRIDQLLAEGHKKAKNAKRVVSDLDEYL
FT                   SACQLGITITALGLGWLGEPTFEIILHPVFEFLNLNGSITSILSFILAFSIVTFMHVVI
FT                   GELAPKTLAIQKAEFVTLNFSGALILFHNITYPVIKLLNGSARGLTGLFGLKMMSESEV
FT                   AHTEEELRMILSDSLKGGEINNAEYEYVNSIFEFSDRLAKEIMVPRTEIVGIEKELTIK
FT                   EVFDLMGVEQYTRYPIIDGDKDHIIGLVNMKHLLTAYIKDSKNGDKPVIDYMQPIIRVM
FT                   ETTQINDLLLKIQRERIHMAILMDEYGGTSGLVTIEDIIEEIVGDIQDEFDEDEIPEVQ
FT                   EIADNHFILDAKMLLENVNDMLGTDIEDDDIDTIGGWFMTKRFDAVEGDSIQEQGYEFI
FT                   AKELDGHHILYLEVLKLPETDLSNEFDAVTE"
FT   gene            complement(393394..393531)
FT                   /locus_tag="Bsph_0371"
FT   CDS_pept        complement(393394..393531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37998"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVH9"
FT                   /protein_id="ACA37998.1"
FT                   /translation="MALTITLLLILPIFLNGIENQLKKVVVNICVFLLNNLLLKHPTIF
FT                   "
FT   gene            complement(393766..394209)
FT                   /locus_tag="Bsph_0372"
FT   CDS_pept        complement(393766..394209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACA37999"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI0"
FT                   /protein_id="ACA37999.1"
FT                   /translation="MFFMQEAISMSKVTLSDDLNSYHSKALIRVKVKEFFSEFSAKIFE
FT                   LADEAGNLDIKKFEAISGINGDFYNEYCSQLKGFFDSSASTFGKKSIKTMYFTYNGKNY
FT                   MLTQQGITEKAPVSIAPFTGDLPLKESFHDVEKACLKLRFQQE"
FT   gene            complement(394354..394560)
FT                   /locus_tag="Bsph_0373"
FT   CDS_pept        complement(394354..394560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0373"
FT                   /product="YheE"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38000"
FT                   /db_xref="InterPro:IPR017263"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI1"
FT                   /protein_id="ACA38000.1"
FT                   /translation="MMIQHFSFKPLFENTQLPGWTIAFFYQRERYSAEYLKDGTIQWTG
FT                   PTPPNEEDVKKMIHELMLFHVYD"
FT   gene            394746..395888
FT                   /locus_tag="Bsph_0374"
FT   CDS_pept        394746..395888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38001"
FT                   /db_xref="GOA:B1HVI2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="InterPro:IPR016991"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVI2"
FT                   /protein_id="ACA38001.1"
FT                   /translation="MDNFIVTLLFMAIIGAAIGGVTNHLAIKMLFRPHNAIYIKNWRVP
FT                   FTPGLIPKRRDELAKQLGLTVVNYLLTPETFRKKFFSKDIQEKVEQFVQTKVEETIFTN
FT                   DKTIQDWLNIAGFSHMPATIEQKVEAIVEGQFASVKNTLSTKSIRTLLSSDMQDTLDAK
FT                   IPVAVSHILEKGEDYFLSPEGEMTIKAMIDDFLSSKGSFGGMINMFLGDSSSLVGKVQR
FT                   ELVKFLQAPGTSTLLTKIFTQEWEKLKDRPAMDFLQDMQFDPILSKLQMYVKEQLAVAE
FT                   RLNQPISYYWPEGNEWMKNSVIPQAIDKAFVKAEEKLEDVLKRLNLQEVVREQVDSFPV
FT                   EKLEELVLGISKREFKMITVLGAVLGGLIGIVQGLIVNFI"
FT   gene            395905..396252
FT                   /gene="yheA"
FT                   /locus_tag="Bsph_0375"
FT   CDS_pept        395905..396252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yheA"
FT                   /locus_tag="Bsph_0375"
FT                   /product="UPF0342 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38002"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVI3"
FT                   /protein_id="ACA38002.1"
FT                   /translation="MVNIYNDINALEATFRKTPEFEALQAAVEVVKSDEEALNVFKNFR
FT                   KIQIELQKKQLAGEELLEDELVYAQKASQLVQQNEKISAMLEAEMKLSKVIEEVNRILI
FT                   KPIQGLYEDIQ"
FT   gene            396383..397045
FT                   /locus_tag="Bsph_0376"
FT   CDS_pept        396383..397045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0376"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38003"
FT                   /db_xref="GOA:B1HVI4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI4"
FT                   /protein_id="ACA38003.1"
FT                   /translation="MYVFIEWTYKTPKGATTVLRSEEMPAAQALLLAEDMEKTGRVKSI
FT                   HCLDRQDTSWTIKELKTYLKEIDTEPHNIIVYFDGGFDRGTRQAGLGCAIYYEQNGKPY
FT                   RLRRNAFSSELTSNNEAEYAALYLGVVELELLNVHHLPVQIKGDSQVVINQLRGEWAAL
FT                   EKDLVGWADKIDAKLAQLTIQPDYQLITRKDNSEADSLATQALNGIDITGLSELVKE"
FT   gene            397164..398072
FT                   /locus_tag="Bsph_0377"
FT   CDS_pept        397164..398072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0377"
FT                   /product="copper amine oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38004"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI5"
FT                   /protein_id="ACA38004.1"
FT                   /translation="MYMKKLAPVALSALLMGSVMIPVASANEQKDEVEIPQIQIDPVHI
FT                   FNQTHGTVEDVRVGKDITYYTVKDGEQTNILEITKDTLVYDNTGKKVELKEGDQVVAYT
FT                   FANKPQKYIYPPQFNPEIIIVDSKEVGFVEVDYFFDDLTNTYDILKLNIGKETELVNAK
FT                   GKKVTSKDLVEKHLAVFYTASTKSIPAQTTPSKVIVLDDNSEISLSPIDEEINTIIATD
FT                   YYMVAETTMVPLRSIAEKLGFQVESKGKAVILTKGNESYTITRGEKAFGYNKSLRTLSV
FT                   APSLKDTKTYVPVEFIEEYLK"
FT   gene            complement(398119..398499)
FT                   /locus_tag="Bsph_0378"
FT   CDS_pept        complement(398119..398499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38005"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI6"
FT                   /protein_id="ACA38005.1"
FT                   /translation="MFLLKNNKRPFISSFIHQVEVAFHHFDLARCDEKTLYVTVLFKYG
FT                   THNVICDFIYIIDQQDMYGAISINKHYEKARAFVKQHFQQLLLYSDEMILANNFMNTVS
FT                   FKYCLQQFVKRYPTFNSSKIVS"
FT   gene            398674..400179
FT                   /locus_tag="Bsph_0379"
FT   CDS_pept        398674..400179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0379"
FT                   /product="Oxygen-independent coproporphyrinogen III oxidase
FT                   2"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38006"
FT                   /db_xref="GOA:B1HVI7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023995"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI7"
FT                   /protein_id="ACA38006.1"
FT                   /translation="MKMIHIDQKYPEDWIRVLNHIANLFFEDSKLRVEPEEADMSVSFT
FT                   YDVEENFTISTKAILTVDGQQYTNNYSIQYESAATGRELNIRMKRALSHVFLDVLEQHT
FT                   GVHQQWGILTGVRPTKLYHKFRKEGKGEQEIAELLIRDFRLSEEKVALLKDIVERQLVT
FT                   IPDIDQIGQEISVYIGIPFCPTKCAYCTFPAYAIGSNRKQGRVNTFLDGLHIELREMGK
FT                   WLKNNNMKITSIYWGGGTPTSIEADEMDALYQTMYESFPNPETIREITVEAGRPDTITP
FT                   EKLEVLKKWGIDRISVNPQSYTDETLKAIGRHHTVQETIDKFWLARESGMNNINMDLII
FT                   GLPNEGIEEFQHSLVESAKMQPESLTVHTLSFKRASEMTRNKDKYKVADRDTVAEMMQM
FT                   AQDWTKENDYVPYYLYRQKNILGNLENVGYSKAGEESIYNIVIMEEVQTILGVGCGASS
FT                   KFVHPETGKITQFHNPKDPAAYIMTFEEAIGKKIEFLDELYKI"
FT   gene            complement(400217..401296)
FT                   /locus_tag="Bsph_0380"
FT   CDS_pept        complement(400217..401296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38007"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI8"
FT                   /protein_id="ACA38007.1"
FT                   /translation="MLTKKLADEIVHQTMLRLRHNINVISPTGVILASGDKMRVEDIHE
FT                   GAVYVAQTKKTLIINEDNIELYPNTKPGINMPILYQDEVVGVIGITGDSEEMLEIANLV
FT                   QLTTEIMTHQALVESKSEWQRKNNDYIFEALVHGSKLDATLNKRIQKLPFSLIAPFQVI
FT                   LVSLHETSYLENRMPFFFEDLFYRQPILAGHSQLQEYYILLTYRQEQNYQSIIKALRKK
FT                   KQKLPSLQIGIGPVVQQLSQLPYSYQGARTALEFATIHNEITFFEDVELFSLFKHRESE
FT                   EVQAFHHRILKNINAKQLETLQSFFDCNLQLKLCAQQLNIHRHTLTYRLNKIRELTGYD
FT                   PQYFEDAVILQMACTLRTL"
FT   gene            401462..402601
FT                   /locus_tag="Bsph_0381"
FT   CDS_pept        401462..402601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0381"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38008"
FT                   /db_xref="GOA:B1HVI9"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVI9"
FT                   /protein_id="ACA38008.1"
FT                   /translation="MKIIISPDSFKGTLSAVEVAKSMQQGILDVNPSIETIILPVADGG
FT                   EGTLDSLIASTGGQYFSTEVLDPIGRDIQAQYGVLGDKETCVIEMAQASGIMLLQDHEK
FT                   NPEFATTYGTGQLIKAALDRGFRKFIIGIGGSATNDAGIGMLKALGVRFIKEDGSDLED
FT                   GISSLMELTAIDISGLDERLIGAIFTIACDVDNPFIGERGATAIFGPQKGVQDYQITHF
FT                   DNCLKHFADIIEQQFAIRLHDYQGAGAAGGLGGALIAFLNGTFHAGIDIVIDAVQLQDH
FT                   LAAAQLVITGEGKSDLQTLHGKAPLGVAKAAALAHVEAVLLSGDIDSMAKPALQNYFSV
FT                   VETLVDEEITTEQAMREPAYFIRLKTKQIFELYIQKGDD"
FT   gene            402602..403948
FT                   /locus_tag="Bsph_0382"
FT   CDS_pept        402602..403948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0382"
FT                   /product="Gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38009"
FT                   /db_xref="GOA:B1HVJ0"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ0"
FT                   /protein_id="ACA38009.1"
FT                   /translation="MLFIIILLGVLFVVWGTAKLKLHPFLALLISAFFVGIASGMPLLT
FT                   VVESINTGFGGLMTSIGLVIIAGTIIGLILEKSGAAYRMAEVVLRIVGPKRPQLAMSLI
FT                   GYIVSIPVFCDSGFIILSSLQKSLAKRANVTIASMAVALATGLFATHVLVPPTPGPIAA
FT                   AGNIGAANYLGTVIVIGLLVAIPATFVGYMWSVKVATKIRVPQDEVEALDYEEVIKSFG
FT                   KMPSTFKAFLPIVLPIVLIGLGSIASLAGDPESTFNTIFKFLGSPTVALFLGVAAAFLL
FT                   LPEISETTLTGWIGESLKEAAPILLITGAGGSFGTVIKNAGVGEILQEMDLGMFASGTL
FT                   FLLVPFIVAAALKTAQGSSTTALVITSTLVAPMLVTLGIEGAVPLALVVMAIGAGAMTV
FT                   SHVNDSFFWVITQYSGMEVTQAYKAQTVATLLQGIVTIMITMVLWWIFV"
FT   gene            404021..405199
FT                   /locus_tag="Bsph_0383"
FT   CDS_pept        404021..405199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0383"
FT                   /product="Beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38010"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ1"
FT                   /protein_id="ACA38010.1"
FT                   /translation="MRKLIVVLLCIFLLAGCTEAIKTERVPVTAGDEMRVHFMDVGQGD
FT                   SILIESPNGKTMLIDAGVKGAGQQVVSYLKELGVNKLDKVVATHPDADHIGGLIPVLHA
FT                   IPIEQFYDSGKVHTSQTFEEMLMAIDEKNIPYYVPKTGDFIEFDKDVTVKVLNANEHAT
FT                   DNNDASIVLKVVYGNVSFLLTGDAGIALEKEMMSNDVTATVLKAGHHGSNTSSSEDFIR
FT                   AVKPEVTILSYGEDNKYGHPHAEVVNRLQAIGSNIYATADLGTITVATNGVNYTVNGKR
FT                   AVTQKKPSTVEPTTAVEIVSKDLVTEIVGIKNNGQQAVSLNDWQLISLEGNQVFNFPNL
FT                   SLQPGKIIYVTSGANAREGDNYLKWTTKQIWLNDGDAAQLRNEKGELVSELD"
FT   gene            405186..405434
FT                   /locus_tag="Bsph_0384"
FT   CDS_pept        405186..405434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38011"
FT                   /db_xref="InterPro:IPR021377"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ2"
FT                   /protein_id="ACA38011.1"
FT                   /translation="MSSTKYTLDRIEDGYAVFLKYPEEEEQIIILQSALNKPVLVGDRV
FT                   QIEEIDGMYHIEILREETEQKRADIQNLMDRLRHKNK"
FT   gene            405627..406415
FT                   /locus_tag="Bsph_0385"
FT   CDS_pept        405627..406415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0385"
FT                   /product="N-acylneuraminate-9-phosphatase"
FT                   /EC_number="3.1.3.29"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38012"
FT                   /db_xref="GOA:B1HVJ3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ3"
FT                   /protein_id="ACA38012.1"
FT                   /translation="MSINTIIFDLDDTLLWDKKSVKTAFEKTCDYAATIHNVNSAELEE
FT                   AVRQEARALYEGYETYDYTVLIGINPFEGLWGTFDDPTESFQAMKRLVPGYRAAAWTKG
FT                   LSALGIEDAKFGAELGERFVAERKASPFLYEDTFTVLDELKGKYQLVLLTNGAPSLQNL
FT                   KLEITPEIAPYFDHIIISGDFGKGKPDASIFEHVMERTGITADDAIMVGDNLNTDILGS
FT                   SRVGMRNVWINRDNNMANGAVTPTYEISSLTDLVKLVKQL"
FT   gene            complement(406572..408179)
FT                   /locus_tag="Bsph_0386"
FT   CDS_pept        complement(406572..408179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0386"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38013"
FT                   /db_xref="GOA:B1HVJ4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ4"
FT                   /protein_id="ACA38013.1"
FT                   /translation="MITATKTINVFIADPLSEDGIFPLRQEQDLDLNIIVDTGLAPEEL
FT                   MTKIADVDVLLVRSQTTVTREVIEAAKSLKLIGRAGVGVDNIDLTAATEHGIIVVNAPD
FT                   GNTNSAAEHTIAMMTSLARHIPQAFNTLKNGKWDRKSYVGVELKNKTLGVVGFGRIGVE
FT                   VAYRAKGQRMNVMAYDPFLTDERAKELGVTKASVEEICEAADFITVHTPLLPETRNLIN
FT                   KEKFAMMKDGVRIINCARGGIINEDDLYDAIVAGKVAGAALDVFVSEPATDHKLLTLPQ
FT                   VIATPHLGASTIEAQESVAVDVSNDIIKFYKTGTVTNPVNMPSIPKELLAQVEPFFELA
FT                   EKLGSFLSQVTTEPVKEINLSYAGEVANYDVRPLTSNALKGLLAKNHGNHVNDVNARYL
FT                   SERIGMKIIEHKTTTAKGFTSLITIEIITANETHTVAGTLLNGLGARIVKVEDYVVDVI
FT                   PQGHLLYIKNTDKPGAIGRVATKLAEKDINIATMQVGRAQVGGTAVMMLTIDNVVTNED
FT                   LAFVAQLENIDEVKAINL"
FT   gene            408982..410631
FT                   /locus_tag="Bsph_0387"
FT   CDS_pept        408982..410631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38014"
FT                   /db_xref="GOA:B1HVJ5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014614"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ5"
FT                   /protein_id="ACA38014.1"
FT                   /translation="MKYDVAIVGAGLAGLVAACELVDAKKKILLVDQEPENSMGGQAFW
FT                   SFGGIFLVNSPEQRRLGIKDSKELAWQDWLGTAGFDRLEDEDSWAYKWARAYVDFAAGE
FT                   KYHWLKSKGIKFFPVVGWAERGGSHAGGHGNSVPRFHIVWGTGPGIVKPFVDKVKKAIK
FT                   DGYIEFKPRHRVDEFIQQDEKIMGISGTVLAETFISRGEKSSRLGVGEFSYEAAAVIVA
FT                   SGGIGANFDLVRKNWPERLGTPPKNMVCGVPAYVDGRMLEITEHAGGRIVNRDRMWHYT
FT                   EGLKNWDPIWPNHGIRILPGPSSLWFDAEGNRFHAPNFPGFDTLSTLETIQKTGYDYSW
FT                   FILTEKIIEKEFALSGSEQNPDLTNKSIGDVLKRIMPGPPAPIQAFKNHGEDFVIANDL
FT                   RELVNGMNKLAGNDLLDFMKIKEQILARDREMDNKFTKDIQVNAIHGARNYIGDKLIRV
FT                   AKPHKILDTKNWPLIAVRLNILTRKTLGGLQTNLNGAVLGMDGQPIPGLFAAGEVSGFG
FT                   GGGVHGYRALEGTFVGGCLFSGRQVGRFLAEV"
FT   gene            complement(410698..411669)
FT                   /gene="ybfQ"
FT                   /locus_tag="Bsph_0388"
FT   CDS_pept        complement(410698..411669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfQ"
FT                   /locus_tag="Bsph_0388"
FT                   /product="UPF0176 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38015"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ6"
FT                   /protein_id="ACA38015.1"
FT                   /translation="MTQKDYRILLYYKYVTIEDPIAFAEEHLAVCQELGLLGRILVGHE
FT                   GINGTVSGTIEQTDAYMNHMKADPRFSDIMWKIDEAEGHAFKKMHVRPRREIVHLGLEN
FT                   DINPLEITGDYLSPKEFMEQMQEENTIIIDARNDYEYDLGHFRGAVRPDIENFRDLPAW
FT                   METHKEEFTDKKILTYCTGGIRCEKFSGWLKREGYGKSVGQLHGGIATYAKDSEVKGQL
FT                   WDGQMFVFDRRRSVPINQVEHIVIGKDYFTGEPSERYTNCANPECHKLMLCEEKHEAFY
FT                   MRSCSDECRRAKRNFFVEEHGWTVHQIEEQIARIAVVQNAKS"
FT   gene            411803..412591
FT                   /locus_tag="Bsph_0389"
FT   CDS_pept        411803..412591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0389"
FT                   /product="Probable enoyl-CoA hydratase paaG"
FT                   /EC_number="4.2.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38016"
FT                   /db_xref="GOA:B1HVJ7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ7"
FT                   /protein_id="ACA38016.1"
FT                   /translation="MEMEFSTITVEKLDRRATLTLNRPQAMNAMDDVMMRELAECFEAL
FT                   QQEKDIQVLVIRGEGKVFSAGGDIKTMLDSTKPLNIDEAMGYLTRIVKAYYQLPMIVIA
FT                   AVHGASAGLGFSLTLGADIVVACENSKLAMNFIGIGLIPDGGGHFFMKERVGTVKAKQM
FT                   IWEGKVLTANEALDAGLIDYMAPDGTVFAMADQLVGKMLASPISSMITTKNILHAQNLP
FT                   QLENILALEAEGQSTMRKTTDHIEGIHAFVEKRTPVFVGK"
FT   gene            complement(412638..412823)
FT                   /locus_tag="Bsph_0390"
FT   CDS_pept        complement(412638..412823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38017"
FT                   /db_xref="InterPro:IPR025544"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ8"
FT                   /protein_id="ACA38017.1"
FT                   /translation="MENYRFTAFEKTGETLFDETWTFENDEAAKLNGQQQIEEKGVANK
FT                   THRLVNASGKLILFHV"
FT   gene            413092..414306
FT                   /locus_tag="Bsph_0391"
FT   CDS_pept        413092..414306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38018"
FT                   /db_xref="GOA:B1HVJ9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014576"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVJ9"
FT                   /protein_id="ACA38018.1"
FT                   /translation="MSEIRFFHMADLHLDSPFKGLFGLPEHILKEIRSSTFDAFDKIIQ
FT                   KAIQEQPDFLLIVGDIYDGENRSLQAQRKFQDAMEKLFQHNIPVIISYGNHDHLKGTWT
FT                   RFSLPSNVYELPAETSVVQLKIRGQQVCIYGFSYSERHLKESVIDTFPIAQDSHAIHIG
FT                   MLHGSEASDTSHALYAPFTKQQLLEKNYHYWALGHIHKRQLLHENPPIVYPGNIQSRHR
FT                   KEQGIKGCYDVTLSQTACELDFIPTSAIVYTTIEVDCTNIVHANELLKRCEEAIAVNRT
FT                   SWGAAVVELYLKNIDEQTEALFEHATVDTWLDTIREAEEGIEPMCWVQKMVLQKPSIHG
FT                   EYSAATQSVVSLMEQWDSNDWKDILKDLYQYAGGARLIEPLSEKDIKNLTHNAQSLLAE
FT                   EIQRA"
FT   gene            414306..417200
FT                   /locus_tag="Bsph_0392"
FT   CDS_pept        414306..417200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0392"
FT                   /product="Hypothetical yhaN protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38019"
FT                   /db_xref="GOA:B1HVK0"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK0"
FT                   /protein_id="ACA38019.1"
FT                   /translation="MHMLTIKKLQIYGFGKHENVTIPLNEGVTIFYGLNEAGKTTIQQF
FT                   VLQMLFGFPTRQQTQRKYEPKASTKFGGQLTLLHPIYGSCIIERVKGKAAGDVTVYLED
FT                   GTTGQEELLAKLLYGYSRASFESIFSFSLHELQGIEKMSEEELTHLLLSSGTTGIQHLS
FT                   ALEKKMDKEANELFKKTGKVPVINQKIEQLKQLERMIRHEQGKIQTFENKLQQLQLLEQ
FT                   NLEKLYATQKKQQQQWQYLTVQKQALPLIKQQQMLQQALGNDPHVQFPAEGVRRYEQVK
FT                   DRLLHESQQLLQLKEQYQLLQDKVLATVNEQTVNEMGRLMQKEATWHQLIVKEKNLRDD
FT                   LFMLEQEIDAQFRLLGVQEKEAQNILLGETVSLQQEQQFQQQLKRLEEAEDELKFHLHS
FT                   LEQVHQALDAITQQKQRLKQESLTKEEEHILAQWPQQKRRLEQLRAAKSQRTKQRQPNY
FT                   FSLMILLIGLLSFVYGIFQKNVAVAIIGAILTIITIWLIKFVRPATETSDKENSHLLRQ
FT                   LEQDEMTVQTILLKKQRLEDRWLHVHEQQSEKEQQYAQLEYKIQQAELESEETTQSLQQ
FT                   FLKRYRLQGTIARTLMPELFMRIRSVQELAVKREGSISLLQEVQDEKNSLYEQLQLVLN
FT                   ENYNEHEIYMYLRTAYLDAQQQQQQVQQAQAQLADIKIKLQSGQTRIDRYTADMMQLLN
FT                   EAEVQNEQAFYERYEQFEHQRKIMTELQTVQAQIASLDLSENVGLKEDSVIEDMRVLEQ
FT                   EQASLQMDIDRCLEHRAALQIEKEQLLNDEKYGQLLQEFEQEKSELQQMIEHWATKKAV
FT                   ATAIHETLFRLREEKLPHVLSKVNAIFQLLTGGRYVQLTIHDEGYFMAQDVAGIRYQMV
FT                   ELSQATKEQAYIALRLALAQTLITSAPFPIIMDDPFVHFDRNRTDKMVQLMKEVGYERQ
FT                   ILYFTCHDEMLKHWPKEQIIDVGALANERGVAST"
FT   gene            417197..418135
FT                   /locus_tag="Bsph_0393"
FT   CDS_pept        417197..418135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0393"
FT                   /product="3'-5' exoribonuclease yhaM"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38020"
FT                   /db_xref="GOA:B1HVK1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK1"
FT                   /protein_id="ACA38020.1"
FT                   /translation="MKGITTLQVGESVDQYLLIKQATKGVTTVGKPFMSLILQDKSGDI
FT                   EAKLWDTNEDHEKMYHAEAIVRVGGEIHDYRGKNQLRIKAIRVAKPEEGVAIHDLVPSS
FT                   ATPKEQLFEELNQFFFDIKNPNISRITRAAIKKHQDAILVFPAATKNHHDYASGLLDHM
FT                   VSMLKLGKAIADLYPTLNRDLLYAGIILHDIGKVVELSGPVATTYTVEGNLLGHITIMV
FT                   NEIAKIANELEIEGEEVMLLQHMVLSHHGKEEWGSPKKPMVQEAEILHYIDNIDAKMNM
FT                   LTRALGKTAPGEFTERLFPLDNRSFYKPTID"
FT   gene            418670..418825
FT                   /locus_tag="Bsph_0394"
FT   CDS_pept        418670..418825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38021"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK2"
FT                   /protein_id="ACA38021.1"
FT                   /translation="MFSTVLVLGVIFTWLASAEGIIAPENKKVVVAKILANNFPFFINE
FT                   TTPYNI"
FT   gene            complement(419502..420461)
FT                   /gene="prsA"
FT                   /locus_tag="Bsph_0395"
FT   CDS_pept        complement(419502..420461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="Bsph_0395"
FT                   /product="Foldase protein prsA 1 precursor"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38022"
FT                   /db_xref="GOA:B1HVK3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR023059"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK3"
FT                   /protein_id="ACA38022.1"
FT                   /translation="MKKTVLSLTLAASVLALGACSGGDSKAIVTSKVGDISVADFNEKA
FT                   KSLTGPYVLQQMVTEKVLSDKYEVTDKEFKEAYDVTASQFGDSFSQALAESGLTEEGFK
FT                   DSLRVQLLQEKALKDQAIKEEDVKKYYEQMKTELNGRHILVADEKTAKEVIAKIKGGAK
FT                   FADVAKEYSTDTGSAEKGGELGWFSVGSMVDEFNDAAYALELNTLSEPVQTSFGYHVIE
FT                   ITDKRDVKDVGSFKDEEENIRTAMLGKLKQTGEDQVILKDIIAKMAKDANVRTPDKNLK
FT                   QSLEFFTTTSEEQAKATEEAAKKAESEDKAEDTDKESN"
FT   gene            complement(420888..421016)
FT                   /locus_tag="Bsph_0396"
FT   CDS_pept        complement(420888..421016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38023"
FT                   /db_xref="GOA:B1HVK4"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK4"
FT                   /protein_id="ACA38023.1"
FT                   /translation="MTYALCMRREIPEENQPKIFRTINILITILLVSFYIEILYAV"
FT   gene            complement(421144..421689)
FT                   /locus_tag="Bsph_0397"
FT   CDS_pept        complement(421144..421689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38024"
FT                   /db_xref="GOA:B1HVK5"
FT                   /db_xref="InterPro:IPR021683"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK5"
FT                   /protein_id="ACA38024.1"
FT                   /translation="MHCWKILNLEHHYGTTRIIIMGVITFLSVFSVSYVTFNLFNEEHY
FT                   TDHLFWLFVIAVLTLYPVHKFLHFLALYDLRQHLKLRVRTQFYLIPVVHMRIHEPLSKN
FT                   RYILALLTPFIVLNTSIIIGTWLLPAYTHYGTLLLAYHCSLCLIDILYVKYLLNSPKNS
FT                   QIEETPKGYEILVPPTVH"
FT   gene            complement(421865..422425)
FT                   /locus_tag="Bsph_0398"
FT   CDS_pept        complement(421865..422425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0398"
FT                   /product="Protease production regulatory protein hpr"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38025"
FT                   /db_xref="GOA:B1HVK6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR023488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVK6"
FT                   /protein_id="ACA38025.1"
FT                   /translation="MVLSEELYTQKEAMLYSQRIAQLSKALWKAVEKDWQQWIKPYDLN
FT                   INEHHILWISYHLKGASISDVAKFGVMHVSTAFNFSKKLEERGFLKFSKRDDDKRNTYV
FT                   ELTEAGTELIVEMNKNYHNTYHSVLEGSLALKDLYGRFPDFLDVMAVIRNIYGEDFIDI
FT                   FERSFQHFRDSFDTLEERPTVKG"
FT   gene            complement(422583..422915)
FT                   /locus_tag="Bsph_0399"
FT   CDS_pept        complement(422583..422915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0399"
FT                   /product="IG hypothetical 17707"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38026"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK7"
FT                   /protein_id="ACA38026.1"
FT                   /translation="MFSTPQSGQQLRTTLKQNVDQTKGMLLDVKQQVGTVKHSVNTLTN
FT                   EVKNNIPQIINDLKQTITTFSEEIEPNKNNLQQELDALQNSISEIEKNIAQFTENKEKP
FT                   QKKISD"
FT   gene            complement(422870..423001)
FT                   /locus_tag="Bsph_0400"
FT   CDS_pept        complement(422870..423001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38027"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK8"
FT                   /protein_id="ACA38027.1"
FT                   /translation="MTRNEVYIMKAKPFLIGLATGIIGGTAAVCSQLHNQASSYVQL"
FT   gene            complement(423109..423324)
FT                   /locus_tag="Bsph_0401"
FT   CDS_pept        complement(423109..423324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38028"
FT                   /db_xref="GOA:B1HVK9"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVK9"
FT                   /protein_id="ACA38028.1"
FT                   /translation="MGEGTILSGTVFLAAALCVFNANVGATFTMLFIGVVLPAVAFNVV
FT                   AFAIIYPIVAKLVKRSKFVTAISQIS"
FT   gene            complement(423326..423622)
FT                   /locus_tag="Bsph_0402"
FT   CDS_pept        complement(423326..423622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0402"
FT                   /product="Probable tryptophan transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38029"
FT                   /db_xref="GOA:B1HVL0"
FT                   /db_xref="InterPro:IPR031360"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL0"
FT                   /protein_id="ACA38029.1"
FT                   /translation="MALLVGIGAALYVVTPGMINGMKPDFMLTMMFIGILLFPTVKETF
FT                   LLSLATGVLSGLFTTFPAGLVPNIIDKAVTGFVFLAAVVILKRIAKMSGVSAI"
FT   gene            complement(423795..424208)
FT                   /locus_tag="Bsph_0403"
FT   CDS_pept        complement(423795..424208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0403"
FT                   /product="Protein hit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38030"
FT                   /db_xref="GOA:B1HVL1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL1"
FT                   /protein_id="ACA38030.1"
FT                   /translation="MSDCLFCKIIDGSIPSTKVYEDEHVYAFTDISPVAKGHTLLIPKH
FT                   HCQDLYEMPEDVARNLYAVAPKIANAIKAAFEPIGLNTINNNGAAAGQTVFHYHLHFIP
FT                   RYDEKEGLGLVWQTQKYSPEQLADVAENIKAHL"
FT   gene            424344..425063
FT                   /gene="ecsA"
FT                   /locus_tag="Bsph_0404"
FT   CDS_pept        424344..425063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecsA"
FT                   /locus_tag="Bsph_0404"
FT                   /product="ABC-type transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38031"
FT                   /db_xref="GOA:B1HVL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL2"
FT                   /protein_id="ACA38031.1"
FT                   /translation="MDIQENLVIKDLSFTIEKGELVGLIGLNGAGKSTTIKHIIGTMLP
FT                   KEGDIYLNGVTLKEDTDKYRTAFSYIPETPVLYDELTLREHLELTAMAYGIDKATLDAR
FT                   SEVLLKEFRMEKRLNWFPSHFSKGMRQKVMIMCAFLINPSLYIIDEPFVGLDPLGIQSL
FT                   LDQMDEKKKEGASILMSTHILSTAEKHCDRIILLHEGRVRAQGTMADLRQTFAMPHATL
FT                   DDLYIAMTKERDHEELA"
FT   gene            425083..426228
FT                   /locus_tag="Bsph_0405"
FT   CDS_pept        425083..426228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0405"
FT                   /product="Protein ecsB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38032"
FT                   /db_xref="GOA:B1HVL3"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL3"
FT                   /protein_id="ACA38032.1"
FT                   /translation="MHYIGEVQKYMQFIFTGHIAIVLVFLIGAGGYQYSEWLKVVQTDF
FT                   PAEILIAVFIGILLAFSRPTTLLREPDQVYLLPLESKMSHYFSKALAWTFWSQVWIVAI
FT                   VYIVSIPLLKAVTDLTTIEIWSIFILVIVLKYISVRGEFSYRYSERGQMVWVDRLIRAI
FT                   IFAAAVYMGLQAQLLLTIVATVISIIYMIVFRKKSVGEPVPYEHFVKLEQNRMMSFYRF
FT                   ANYFTEVPHLHGSIRRRGWMDWLYKFVPYGKKNSQKYLVFRTFVRTDDHFYLWLRLTAI
FT                   AGVIAAFVDIPIVTWIVAGALSFATTIQLKQALLSSGEFRMDMLFPLPDNARQLAVKQI
FT                   VRLAMVTQAIIVGLCAITQPMFYIVVVIVLVISELTAKVSK"
FT   gene            complement(426287..426802)
FT                   /locus_tag="Bsph_0406"
FT   CDS_pept        complement(426287..426802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0406"
FT                   /product="Hypothetical yhgC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38033"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL4"
FT                   /protein_id="ACA38033.1"
FT                   /translation="MNIYLTSGTGDFLEQLKNKYPNEHMILIHGEGNSVLIHETEGKSV
FT                   FATPRKFEVLDSVNELEEHGFFVLNNIPVTDEGRPVFEHRFLQRSHAIEDEPGFESYRL
FT                   LRPIKSDTYIVMTQWHGPHSFEAWKSSKAFEKAHAKRDDSTGVNQQNIFSAASYVTTYS
FT                   AMPKEQSE"
FT   gene            complement(426954..427085)
FT                   /locus_tag="Bsph_0407"
FT   CDS_pept        complement(426954..427085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38034"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL5"
FT                   /protein_id="ACA38034.1"
FT                   /translation="MGLPLSIAERVFCILSIVLVQKTFAESRKKCIIYSIIIDIRFQ"
FT   gene            427182..428270
FT                   /locus_tag="Bsph_0408"
FT   CDS_pept        427182..428270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0408"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38035"
FT                   /db_xref="GOA:B1HVL6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL6"
FT                   /protein_id="ACA38035.1"
FT                   /translation="MDSNEFIEGKELFMTTFNDTLLRAARGEKTTHTPVWYMRQAGRSQ
FT                   AEYRAIKEKYSLEEITHQPELCAYVTRLPVENYNVDAAILYKDIVTPLPGIGIDVKIKA
FT                   GVGPVISNPIRSVADVDNLGEFNAKEHTPFVLETIKILTEEQLNVPLIGFAGAPFTLAS
FT                   YMIEGGPSRNYNKTKSFMVSEPQAWFALMDKLADMIIADVTAQIKAGAKAIQVFDSWVG
FT                   ALNVEDYRVFIKPIMTRIFAELQKENVPLIQFGVGASHLAKEWNDLPIDVVGLDWRLPI
FT                   KEARTNGITKPVQGNLDPSLLLADWSVIEKRTKDIIDQGLEMPGHIFNLGHGVFPEVDP
FT                   AVLKRLTTLIHEYSAQQIQARS"
FT   gene            428418..429338
FT                   /locus_tag="Bsph_0409"
FT   CDS_pept        428418..429338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0409"
FT                   /product="Ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38036"
FT                   /db_xref="GOA:B1HVL7"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL7"
FT                   /protein_id="ACA38036.1"
FT                   /translation="MKEVKGLLVMAYGTPYKEEDIEPYYTHIRHGRKPSEEHLEDLRSR
FT                   YEAIGGLSPLAAATQAQAEALCSRLNEVQDTVEYKLFIGLKHIHPFIEDAIEQMVAEGI
FT                   KEAVSIVLAPHFSTFSIKSYNGRAVEAAGDRLTITSVESWYDEPKFIEYWKQQVNDTFK
FT                   SMSEEERETACLIVSAHSLPEKIKDLGDPYEDQLIETARLIQEATDLKNVEVGWQSAGQ
FT                   TPEPWIGPDVQDLTRELYEEKGFRSFVYTPVGFVTEHLEVLYDNDFECKVVCDELGAKY
FT                   YRPSMPNTHPLFIDAMVDAIYKKLS"
FT   gene            429353..430774
FT                   /locus_tag="Bsph_0410"
FT   CDS_pept        429353..430774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0410"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38037"
FT                   /db_xref="GOA:B1HVL8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR004572"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL8"
FT                   /protein_id="ACA38037.1"
FT                   /translation="MMLVTQKRRKVVVVGGGITGLTAAFYMQKQASTKELPLDIVLVES
FT                   SLRLGGKIQTLRKDGFIIERGPESFFDRENYVNALAKDLGIEQKIMTSNAGPNYVAVGS
FT                   QLYPIPSHLLSGETPHISSFITSGLFSLSGKVRAAGDFFIPRSVQDDDQPLGSFFRRRF
FT                   GAEVVENLVEPLLAGTFAGDIEQLSMSSTFPQLYHLEQKYRSLLVGMKKAGTNFLSNDV
FT                   IDENKGIFQTFSNGLETLIESIEESLLPGTVMKGVKVEEIEHGKDGSVHVMLNNFTHIK
FT                   ADAVIIATPFNMADKMFSKYNLLNELGTMKAATIATVTMAFKKEQLGDLDALSFYVSRN
FT                   SDFSITSCTWMNRKWPGTTPDDYVLLRSYIGRVGDEAIVALSDTEIEKTVLQDLNKTIS
FT                   IDGEPVTTVVTRWRNAMPQYTVGHEAKVQRIKQELREHFPTVKLAGSSFEGISIPECVQ
FT                   QGKHVAEEVLAEIFC"
FT   gene            complement(430914..434342)
FT                   /locus_tag="Bsph_0411"
FT   CDS_pept        complement(430914..434342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0411"
FT                   /product="hypothetical glycine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38038"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVL9"
FT                   /protein_id="ACA38038.1"
FT                   /translation="MLLGLLGLSGATGATGVTGVTGVTGVTGVTGVTGVTGVTGVTGVT
FT                   GVTGVTGVTGVTGVTGVTGVTGVTGVTGSYWRYWRYWRYWRTGVTGATGVTGSTGATGS
FT                   TGATGIAGVTGSTGATGVTGITGSTGATGTTGATGAIGVTGATGATGVTGATGATGAIG
FT                   VTGATGATGVTGSTGIAGVTGSTGATGVTGVTGSTGVTGATGSTGVTGTTGSTGTTGVT
FT                   GTTGATGSTGVTGATGATGDIGATGSTGSTGATGVTGVTGATGFTGATGVTGATGATGA
FT                   TGATGATGSTGATGVTGSTGAAGVTGATGATGFTGSTGVTGSTGVTGATGNIGPTGATG
FT                   AAGIAGVTGATGATGFTGSTGITGSTGATGIAGVTGATGVTGATGVTGSTGATGIAGVT
FT                   GATGSTGASGDIGPTGATGVTGVTGATGVTGTTGATGVTGATGNIGPTGATGAAGIAGV
FT                   TGATGSTGATGDIGPTGATGVTGVTGATGVTGTTGSTGIAGVTGTTGATGVTGATGNIG
FT                   PTGATGVAGIAGVTGATGSTGATGDIGPTGATGAIGVTGATGAAGIAGVTGATGSTGAT
FT                   GDVGPTGAIGVTGATGPTGAAGIAGVTGATGFTGSIGVTGSTGATGAAGIAGVTGATGS
FT                   TGATGDIGPTGATGVTGVTGATGVTGTTGATGATGATGVTGVTGTTGSTGSTGTTGVTG
FT                   VTGATGVTGTTGATGIAGVTGATGVTGSTGVTGATGATGDIGPTGATGATGIAGVTGAS
FT                   GSTGATGVTGATGVTGATGATGDIGPTGATGIAGVTGTTGATGSTGATGDIGPTGATGA
FT                   TGATGFTGATGATGATGATGATGATGAAGIAGVTGATGSTGDIGPTGATGVTGATGATG
FT                   AIGVTGATGATGIAGVTGPTGATGATGATGSTGATGSTGVTGATGATGDIGPTGATGAT
FT                   GATGVTGVTGATGATGATGVTGATGATGATGATGATGATGATGPTGATGFTGPAFTEGF
FT                   SAFKNTLTVSGSTSITNWSVASPYFTTPAFNPTTGIFTVPTTGRYSFEATINYSTTAAI
FT                   SVTLGAGINPSFAIRQNATTNLISGLFPVLNVNVALVLTLRAVLGNGTITLAGEVNLNA
FT                   GDTIDLFYEANGLTISLILGGANSGGIVWSCHRIS"
FT   gene            434499..434732
FT                   /locus_tag="Bsph_0412"
FT   CDS_pept        434499..434732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38039"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM0"
FT                   /protein_id="ACA38039.1"
FT                   /translation="MAPVEPVTPVTPVTPVAPVAPVAPVAPVAPVAPVLPVAPVMPPVV
FT                   PVGFTGQTGQLGIGPVLQQQGKELHLLHTCFK"
FT   gene            complement(434918..435982)
FT                   /locus_tag="Bsph_0413"
FT   CDS_pept        complement(434918..435982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38040"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM1"
FT                   /protein_id="ACA38040.1"
FT                   /translation="MIVKNEEEVIGRCLESVKGLVDEINIVDTGSTDRTKQIVAQFTDR
FT                   IFDFEWIHHFAAARNYSFQQATMDYILWLDADDVFLEEDQEKFKALKNSLSATIDAVSM
FT                   NYNLSFDSEGNVDALIRRNRLVKKDKNFQWIGAVHEYLEVGGTLLDSDIAVSHLPLTHD
FT                   HSRNITIYKTLVESGKTLSPRDTFYFANELLDHGQFEEAIYYYELFLTSKLGWVEDNIR
FT                   ACFKLADCYSNLNDPENNFSSILRSFEYDVPRPEACCRLGYHFMEQYKNYQAIFWYEQA
FT                   LIIKQNPNAPFQNKSFSTWLPHLQLCVLFDRLQEYELANAHNELAGSFIPNDAKVLHNK
FT                   KYFQQILKSNQTDS"
FT   gene            436158..437150
FT                   /locus_tag="Bsph_0414"
FT   CDS_pept        436158..437150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0414"
FT                   /product="surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38041"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM2"
FT                   /protein_id="ACA38041.1"
FT                   /translation="MKYSKGAEVITLKKWAFFIFSLLQIIWLAGCTEKSYESIERDRNF
FT                   IASLNIQEPSLDFIDENGHVLAKWLFDKAYSGATLLGDDQVLLYGHQLNTIDVYTLSTG
FT                   EKLYSQKVEVGTTNVYYDNNIKQFFITNSKTNTVTSFDHEGNMLASQRIGNYPMSMASY
FT                   KDKLYVINFKDTKLSVLNMKDLQIEQEWPIQKSSHGIAIIDEIDELWIGGHGEGSKPNS
FT                   SVKKYDLNSGQLHGEINMPLMPVGLKKTKDAVLVVSHGHNELYVADFDGHIKWQQEVGA
FT                   NPFVVNQFKDYIVVAGYDDHKLHFIKDGQTEKTVDVGKGAFQLLVREEK"
FT   gene            437147..437833
FT                   /locus_tag="Bsph_0415"
FT   CDS_pept        437147..437833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0415"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38042"
FT                   /db_xref="GOA:B1HVM3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM3"
FT                   /protein_id="ACA38042.1"
FT                   /translation="MMTTVLIVDDEQDMRNLIEMMLNNSDIETYTAASGTEAYDIIVRE
FT                   KIDLVLLDVMMPHEDGFVVCQSIRAMSNVPIIFLTARDANEDKVKGLTLGGDDYIVKPF
FT                   THDELAARIYAVLRRSGANIAELQQKYVVFGPIKIDEIARKVSVHGKSIPLTLKEFELL
FT                   HLFMKNPGNAYTREQLLERIWDIDYVGGTRTVDTHIKTLRIKLGKEAAAHIQTVWGVGY
FT                   RFDPGE"
FT   gene            437830..439218
FT                   /gene="resE"
FT                   /locus_tag="Bsph_0416"
FT   CDS_pept        437830..439218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resE"
FT                   /locus_tag="Bsph_0416"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38043"
FT                   /db_xref="GOA:B1HVM4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM4"
FT                   /protein_id="ACA38043.1"
FT                   /translation="MKKIATRIWLLIFAFLIITVVFMYVLTNFLYQRLYVQDTEDTMVE
FT                   VGLKLQTMYNNGKVTDEFIADIERFNDYSNLNIFAVRNPRELSACVPFDIDYETLIGPE
FT                   ERQKLLSGSYVQKIGYEPRFDRQLISVVLPLVDQNRLEGIIYIYFPLAKISELANSGVI
FT                   LLFISAFIFLMVVSYLIYKGIRHIMRPLNDLQRAVEQMSFGNYETRVPVNSRDEIGKLS
FT                   STFNKMAEAIQQEDEAQKTFLATVSHELRTPISYVKGYSEAMQNGIITENQKEETIQLI
FT                   VREANRMERLTNELLQLARTENEQTEIVVYPIPLGETLREVQKILTHQADKKNITLHLD
FT                   VDDALIIQADEVKLKQIFINIIENAINYSYENSKVEMVAIEKNGSAQITIKDYGIGIPQ
FT                   EDISHVTERFYRVNKARSRADGGSGLGLSIVEQLLKQLQGRLEIKSIIEKGTIVKITLP
FT                   LMED"
FT   gene            439222..439749
FT                   /locus_tag="Bsph_0417"
FT   CDS_pept        439222..439749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38044"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM5"
FT                   /protein_id="ACA38044.1"
FT                   /translation="MKKWLFALIAVPALLVGCGENKEETLPEPEVPQIPEVEILTPKEV
FT                   ALHETIELAAHVEQGGKNVDDAVVEFEVWESGKRDEGQMVDGKLEKDGVYKATTTFDHD
FT                   GVYYMYAHTTANGVHNMPKQQIIAGSPDMTQVLPEDEKSNNSMDNNMMNHGNGTSDDTD
FT                   QNEEKKDEKNHH"
FT   gene            439870..440442
FT                   /locus_tag="Bsph_0418"
FT   CDS_pept        439870..440442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0418"
FT                   /product="transcriptional regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38045"
FT                   /db_xref="GOA:B1HVM6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM6"
FT                   /protein_id="ACA38045.1"
FT                   /translation="MDRRQEILEAAAKSFTLFGYKATTMEQVAKIANVGKGTIYTFFAN
FT                   KEILFQEIAMSLVREMKGEADAVLDASASFMDNAHNALMKMLQFREKHLLFAKLIEEEK
FT                   ELRTPAVKQVLLRIETEILSYVAELIQRRINKGEIRDCDAELVSYLLLKAYLAFVVDWH
FT                   ELHGDAIPEEKILNLFKETIFRGLILT"
FT   gene            440572..442761
FT                   /locus_tag="Bsph_0419"
FT   CDS_pept        440572..442761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0419"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38046"
FT                   /db_xref="GOA:B1HVM7"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM7"
FT                   /protein_id="ACA38046.1"
FT                   /translation="MIKAEWLKIFKTRKMLVSIIAVLFIPVMYAGMFLWAFWDPYAGLP
FT                   NLPVAVVNEDTGAEMDDVKLDLGDTLVDKLIDSEQFNFIEVSKEEAEKGLNSRDYYMIL
FT                   EIPTNFSEHATTLLDDKPSKLVMNYIPNEGLNFLGAQIGETAMDRVRAEVNSQVSATYA
FT                   EKLFDSIATLGDGFTEAADGSNKLDEGAQKVANGAKDLKGYLEQLASSTVELSNGTDKL
FT                   TKGAGDAAKGANDLSSGLVKLQDGTVQLQQGAQQAANGASSLEQGISQYTQGVAKVGAG
FT                   LNTLNDKQQQISAGAASIAENAGALNGAANQLTAGSAKVEAGITALSNQLQTMMTSMPE
FT                   EQAAALKQTLAELQAGSASVHNGLTTLSAGTEKLQAGANQVSSGAGQIAAGQAEVLAGA
FT                   NALTAKSNALVEGAKGLQAGNATLAAKLGELNAGVTTAVTGSKTLASGLNELANGTTTL
FT                   NQGTSTLASKSGELAQGSATLADGSTELADGTSTLSGKLGEASEKANEVKANQDTYDMV
FT                   GSPVEVEKESVNHVPNYGTGFAPYFISLGLFVGALLISIVFPLVEPAIRPKNGASWFTS
FT                   KVTVLAVVGLVQTVLTVVIVKWGLGLEVNNMGYFIVTALLTSYVFLALIQMLVSIFGDP
FT                   GRFMAIVVLILQLTTSAGTFPLELIPSPLQVFNKLLPMTYTVQAFKSSISTGDTSFLMQ
FT                   NYGVLAGFLVAFLAITFGYFMLLHNKRYSKIAEEN"
FT   gene            complement(442960..443085)
FT                   /locus_tag="Bsph_0420"
FT   CDS_pept        complement(442960..443085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38047"
FT                   /db_xref="InterPro:IPR025432"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM8"
FT                   /protein_id="ACA38047.1"
FT                   /translation="MLENVVEFFKNLPAKQCTECGEKIEEQSECYSNTCEKCNHL"
FT   gene            443230..444222
FT                   /locus_tag="Bsph_0421"
FT   CDS_pept        443230..444222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0421"
FT                   /product="Probable lipoate-protein ligase A"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38048"
FT                   /db_xref="GOA:B1HVM9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVM9"
FT                   /protein_id="ACA38048.1"
FT                   /translation="MIFVDNKGIHDPRVNLAIEEYLLKTMDVEKEPVLLFYINQPSIII
FT                   GKNQNTIEEINTDYVEDNGIIVVRRLSGGGAVYHDLGNLNFSFITNDDGDSFMNYKKFT
FT                   QPVVDALAKMGVNAELSGRNDILAEGRKVSGNAQFSTRGRMFSHGTLMFDTEIDAVVSA
FT                   LKVKKDKIESKGIKSIRSRVANISEFLKEKMTIEEFRLEILKSIFGGETNIRYYELTDE
FT                   DWVNIHKLSAERYQTWEWNYGKSPRFNIQKTHRFPTGGIDIRLEVNHGVIEEAHIFGDF
FT                   FGVGDMTDIEQRLVGTNHDRTAIANALVDIDIPTYFGGISTEDFLQLIY"
FT   gene            444323..445027
FT                   /gene="yxdJ"
FT                   /locus_tag="Bsph_0422"
FT   CDS_pept        444323..445027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdJ"
FT                   /locus_tag="Bsph_0422"
FT                   /product="YxdJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38049"
FT                   /db_xref="GOA:B1HVN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN0"
FT                   /protein_id="ACA38049.1"
FT                   /translation="MEKHRIFIVEDDVKIASLLAETLRKYQYEVETIQEFDHLIEEFTA
FT                   FNPHMVLLDINLPSYDGYYWCRQLRQHTTCPIIFISARSGEMDQIFALENGGDDFITKP
FT                   FNYEIVLAKIRSHLRRTYGEYATRQEERTIKQGQLILHLERMELHKNELEIPLQKKECI
FT                   ILELLMGNAPKVVTREQLLEELWDDQAFVDENTLNVNMTRVRKKLADYHISSTIETVRG
FT                   AGYRFILSAGEL"
FT   gene            445204..445602
FT                   /locus_tag="Bsph_0423"
FT   CDS_pept        445204..445602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0423"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38050"
FT                   /db_xref="GOA:B1HVN1"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN1"
FT                   /protein_id="ACA38050.1"
FT                   /translation="MRQRYLLKISQLPTAMEDVLQKNAKTPEAMQAEKYMHELYRLYQH
FT                   ELHSLYASQKRHDQFMNQWVHQMKTPISVIELLLQDDRPLDKKNVQEEIDRLRRGLDMV
FT                   LVNARLENFEDAYASRTGCIKDNSDCNC"
FT   gene            445553..446011
FT                   /gene="yxdK"
FT                   /locus_tag="Bsph_0424"
FT   CDS_pept        445553..446011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdK"
FT                   /locus_tag="Bsph_0424"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38051"
FT                   /db_xref="GOA:B1HVN2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN2"
FT                   /protein_id="ACA38051.1"
FT                   /translation="MQVEQVALKTIVTATVNENKRLFITKRVFPEIHIEDDLIVASDSK
FT                   WLRFILGQFVTNAVKYTFEANKKIVISAIKKDDYVQLAICDEGIGIPASDLSRVTKAFF
FT                   TGENGRKTGESTGMGLYLAKEICEKLGHDLAISSEVGKGTIVTVTFTN"
FT   gene            446023..446448
FT                   /locus_tag="Bsph_0425"
FT   CDS_pept        446023..446448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38052"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN3"
FT                   /protein_id="ACA38052.1"
FT                   /translation="MTEVSIEGWLLNINKEKTKALYMTHLQEGDQVSYQNFVMANEVLN
FT                   EELLHFSNILGLNLQQPTLLQAFPVDGQQIMYSGHYTVYGEILEGEMDAWDVIIGEHCF
FT                   SLVAEESVLGLTEPHFQIGFEVVLQWLLPQSLELMKK"
FT   gene            446461..447237
FT                   /gene="yxdL"
FT                   /locus_tag="Bsph_0426"
FT   CDS_pept        446461..447237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxdL"
FT                   /locus_tag="Bsph_0426"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38053"
FT                   /db_xref="GOA:B1HVN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN4"
FT                   /protein_id="ACA38053.1"
FT                   /translation="MPILQIKDVTKVYEGKVTHRALNQLSFEVEEGEFLAVMGPSGSGK
FT                   TTLLNIISTIDEPTSGEIILDGMNPHTLNATELAYFRRRQLGFVFQDFNLLHMLTVEEN
FT                   IVLPLTLDQQPLEVMEERLANIVEKLDLTPFLHKRPNEISGGQAQRTAIGRALIHNPSL
FT                   ILADEPTGNLDSNSSRDVLELLTKVNKDKRTTIVMVTHDPIAASYCDRVLFIKDGEFFN
FT                   EIYRDDRRQMFFQRILNVLSLLGGGQVGDLSTIRLP"
FT   gene            447275..449143
FT                   /locus_tag="Bsph_0427"
FT   CDS_pept        447275..449143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0427"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38054"
FT                   /db_xref="GOA:B1HVN5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN5"
FT                   /protein_id="ACA38054.1"
FT                   /translation="MASFFSVAVFFIYSMLMFHPDIERGILGEVSLIGMVGAEIVLVLF
FT                   TLFFLYYSMSAFLEARSHEFAILLHLGMEKRQMNKLVFLETMIIGAGSIIVGIVFGFSF
FT                   SKFFFMIVREILHLDELPLYVSWQPFLLTIGVFTSAFVVISFISVYFTRERKLRDLIKG
FT                   SDYLNSLTTYSKIRAVYGIALILGTYILAFVVGHTSLIGLTLLIPFSATFGTYYFFSDS
FT                   VPCFLDLARGKRKFHWQRYRLLSLAEQTHIMMDNVKMFFVVTMVSTLAFLSVGVLATMS
FT                   SYTTQYDRLNPLGLVYKGDIDNPYEREHINSLRLQLEEKGLSYQLSRFVVIKQTSSFTQ
FT                   NEVEVFRESDMNVLLSSYSYPLLDLGSGEAVFIPYSEDSLKKLKNRVVHTVLEENSIPI
FT                   TIDSVYPKIVFPGSIVSVNSIVISDEDFAKLIHPISEKNLIQPSYHLFTFVIPQWMETK
FT                   EVGKDIDYLESNLYFLKKDKFSPFYFENAGLNYSYILATYSLFTLVGVLVATVFLLAAG
FT                   SFIYFKLHTSLEREKRKFDVLKRMGLTDIELKKLVNRHLFPQFFLPWGVAMMHSAFAFL
FT                   MVQGILKDIANISIVKEVFFAFGFFVLIQVVYFYLIRWRYISHIRS"
FT   gene            449286..450833
FT                   /locus_tag="Bsph_0428"
FT   CDS_pept        449286..450833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0428"
FT                   /product="long-chain fatty-acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38055"
FT                   /db_xref="GOA:B1HVN6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN6"
FT                   /protein_id="ACA38055.1"
FT                   /translation="MNLVSRVRQQATEQPDKVAYHFMGKDTTYGEFEQTVGRFAKGLQD
FT                   LGIEKGDHVAFLLGNTPHYLIALYATMRIGATAIPVNPIYTPDEISYILHNGDVKAVIA
FT                   LDLLLPLVEKGVQAFPQVKAFVVCETTADIAEKVAALSLKAQEKTHLFTQIVKNTSQSL
FT                   QPVEVADDDNAIILYTSGTTGTPKGAMLTHENVYSNARDVAHYLDIQEKDRVIATLPVF
FT                   HVFALTVVVNAPLLSGATVLLAPKFSPTEIFALAREQKATVFAGVPTMYNFLYQLPEGN
FT                   PEDFSTIRLAISGGASLPVALLHNFEQKFNVRVSEGYGLSEASPVTCFNPLDRDRKAGS
FT                   IGTSISNVENRVVDVNGQEVPVGEVGELIVRGPNVMKGYYKMPEETAMAIRDGWLYTGD
FT                   LAKVDDEGYFYIVDRKKDMIIVGGFNVYPREVEEVLFAHNNIVEAAVVGFPDPNLGEAV
FT                   HAYVVLKEVAATTTEDLLSYCGKHMVKYKVPKVIEIMDELPKNTTGKILRRSLKEKV"
FT   gene            451086..451733
FT                   /locus_tag="Bsph_0429"
FT   CDS_pept        451086..451733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0429"
FT                   /product="Protein dedA (Protein DSG-1)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38056"
FT                   /db_xref="GOA:B1HVN7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN7"
FT                   /protein_id="ACA38056.1"
FT                   /translation="MIELIKELISFIVHIDVHLEEIIRDFGNWSYLILFAIVFVETGVV
FT                   IFPFLPGDSLLFASGTLAAAMGAFDMWILIPVFLAAAILGDTMNYHIGHKVGTSIPPKS
FT                   LLGRVVKKERMEAAEKFFNTHGGKTIVIARFMPFIRTFIPFVAGASKMNYSYFLLYNIL
FT                   GAILWVFSCTLLGYFFGNIPIIKDNFSVVLILIIFISVVPAVIGAIKAKVGK"
FT   gene            451905..453134
FT                   /locus_tag="Bsph_0430"
FT   CDS_pept        451905..453134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0430"
FT                   /product="Hypothetical yuxH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38057"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN8"
FT                   /protein_id="ACA38057.1"
FT                   /translation="MEVFIGRQPIFNLHEQVVAYELLYRGKNVNAFPMVDSDAATIDVL
FT                   VNSFLSIGFEEVTKGKPGFVNFTDNLLMSSIHEFLNPSQVVIEILEDVPLTSQLVKRVV
FT                   ELKNYGFQIALDDFIMDEQVDIYDELFEQVDFIKVDFLATSMVKRMEIENKVKGNYPHI
FT                   QLLAEKVETRHQFEVAKSSGYVLFQGYFFEQPQIIKATDIPANTIQYIHIISLLKEEEP
FT                   NIQLLAENIERDISLTYKLLQMINNSSKRSKSKVRSIKQAIVLLGISNLRKWIYLLAMR
FT                   EIDIDADSDLFKEVMCMSLFRAKVCEKLAKLSYKKNFSEYFLVGMFSLIDTLLQRPMSV
FT                   ILHQLPFSEDITNTILGHETDMTSFLEFSIALGKLDWARLEELSAQLNIQLNDMDHLYY
FT                   EAMEWAEKSF"
FT   gene            complement(453187..453333)
FT                   /locus_tag="Bsph_0431"
FT   CDS_pept        complement(453187..453333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38058"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVN9"
FT                   /protein_id="ACA38058.1"
FT                   /translation="MFSLTSCFISPRPLQLSEFFKDEMIIANTLHIENFILMKGLAIVE
FT                   DKK"
FT   gene            453335..454150
FT                   /locus_tag="Bsph_0432"
FT   CDS_pept        453335..454150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38059"
FT                   /db_xref="GOA:B1HVP0"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP0"
FT                   /protein_id="ACA38059.1"
FT                   /translation="MDYVYVIVGAAVIAIGFNVFLLPNQVASGGVSGISTILHGLFGWN
FT                   PGIVQYAFNIPLFIAGVLLLGKKFGIKSFIGTITLPFIVLLTNSWEPWTDNPLLGALFG
FT                   GIVVGLGIGLVFKGNASTGGTDLLAQIITKYTGLTLGTSVLLIDGIIAISAAVVFDLEK
FT                   GLYALIGLYVTTKTIDIIQLGFSQSKMVYIITLKQDEVREAIYAEINRGVTKLQAFGGY
FT                   TGEARPVLMVVVYQTEFTKLKQLIKSVDPSAFVIVSDAYEVLGEGFKRA"
FT   gene            454203..454487
FT                   /locus_tag="Bsph_0433"
FT   CDS_pept        454203..454487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG: Cytochrome c, mono- and diheme variants"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38060"
FT                   /db_xref="GOA:B1HVP1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP1"
FT                   /protein_id="ACA38060.1"
FT                   /translation="MKKAMLTLVFGSAIFLAACGGGNKEATNNEGATAPDGEAIAMKSC
FT                   VTCHGGELQGANGPALNDVGSRLSESEILDIINNGKGGHAWRNCKRRRC"
FT   gene            454730..455581
FT                   /locus_tag="Bsph_0434"
FT   CDS_pept        454730..455581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0434"
FT                   /product="HPr kinase/phosphorylase"
FT                   /EC_number="2.7.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38061"
FT                   /db_xref="GOA:B1HVP2"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP2"
FT                   /protein_id="ACA38061.1"
FT                   /translation="MTSDISRPGLEMAGYFTHYPANRVQLLGKTELSFFEMLPTDVKLE
FT                   RMRLLCSQDTPAIIISRDLEVPEELIQASNEKHVPVFKTHMTTTKFSSRLTNYLEGRLA
FT                   PMTAAHGVLVDVYGIGILIIGKSGVGKSETALELVKKGHRLVADDCVEIRQESENLLIG
FT                   SPPPLLEHLLEIRGIGIIDIMTLFGASAVRPYKRITLIIELEIWDPQKVYDRLGLEEEK
FT                   MKIIDTELTKLTIPVRPGRNVSVIIEVAAMNYRLKKMGVNAAEEFSRRLDEVISSNDVL
FT                   DD"
FT   gene            455627..456448
FT                   /locus_tag="Bsph_0435"
FT   CDS_pept        455627..456448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0435"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38062"
FT                   /db_xref="GOA:B1HVP3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVP3"
FT                   /protein_id="ACA38062.1"
FT                   /translation="MDLLLLQINPIAFHLGPIPVRWYGLLIVSGIILAYVVGQREAVKR
FT                   GLPEDFLADLLLWAVPISIICARIYYVSMRWDYYSENPGKIIEIWNGGIAIHGALIGAF
FT                   VTAYIFTRIKNVSFLRVADIAAPSILIGQIIGRWGNFMNQEAYGGPVSKEFLENLMLPD
FT                   WIINQMYIEELGTYVHPTFLYESVWNLIGLIILLILRKVNLNRGEIFFSYLIWYSIGRF
FT                   YIEGMRTDSLYLVGDLRSAQIVSIIGIVVGLGAIIYRRIKVKPAMKYLDNK"
FT   gene            456462..457103
FT                   /locus_tag="Bsph_0436"
FT   CDS_pept        456462..457103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0436"
FT                   /product="Pyrophosphatase ppaX"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38063"
FT                   /db_xref="GOA:B1HVP4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP4"
FT                   /protein_id="ACA38063.1"
FT                   /translation="MAVKALLFDFDGTLLNTNELIIQTFMHVLNERFPGQFSPKDCLKF
FT                   IGPSLKQTFNDIAPGEEEALIAKYRAWNIEHHDELVSQYPDVVSTLEQLKAQGIRLAIV
FT                   STKRNDTIDRGLSILGATHLFDVRIGTDDVHNVKPDPEPVLLALERLGINKDDAIMIGD
FT                   NSHDIEAGHRAGVRAAGVAWAIKGEAYLQQFQPEYILHHMTDLLDIVKEG"
FT   gene            457109..457651
FT                   /locus_tag="Bsph_0437"
FT   CDS_pept        457109..457651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0437"
FT                   /product="Putative acetyltransferase MW0724"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38064"
FT                   /db_xref="GOA:B1HVP5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP5"
FT                   /protein_id="ACA38064.1"
FT                   /translation="MARKTERYRVEGANSLWKIYDTVSFWKVMKCFIVIQIGRFTPFLR
FT                   VKNWLYRTFLKMTIGEKTSLALMVMPDTMYPERIFIGDNTVIGFNTTILAHEYLIEEYR
FT                   LGDVRIGHEVMIGANSTILPGVTIGDGAIVSAATLVHKDVPAGCLAGGNPMQIIYTAEQ
FT                   MAERKRHEVVQWCTPKK"
FT   gene            457917..459074
FT                   /locus_tag="Bsph_0438"
FT   CDS_pept        457917..459074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0438"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38065"
FT                   /db_xref="GOA:B1HVP6"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVP6"
FT                   /protein_id="ACA38065.1"
FT                   /translation="MFEKPLGMRDTFPQIFEKVEAVRQTGRDFLTKRGYEFIKTPAVEY
FT                   FDTVGKASAIADTHLFKLVDSQGNTLVLRPDMTTPIARVATSKLLKEMIPQRLAYFASV
FT                   FRAQEAEGGRPAEFDQMGIELIGDQSVFADAEVIVTAMELLKHLKLEAFKVTIGHAGIL
FT                   NCILQDYTESIEQQTTLRTLLVHRNYVGFEEAVDSFNLPKAKADALLQFIEEAMDVKDI
FT                   RDIEKYVRKNDALVYMQQLAQLLEMADLAAYVTFDFTLSSHMSYYTGMLFEVFALGSGF
FT                   PLGNGGRYDGLLEVFGSKAGATGFSIRVDRLLETLHGQSEMQQEATVVLFDEEQFEAAL
FT                   IKVNTLRAAGKLATLQLRSSLVDEEAFLAHFTEVVVVGQEEIGSE"
FT   gene            459067..459711
FT                   /locus_tag="Bsph_0439"
FT   CDS_pept        459067..459711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0439"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38066"
FT                   /db_xref="GOA:B1HVP7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVP7"
FT                   /protein_id="ACA38066.1"
FT                   /translation="MNELTIAMPKGRIFEEAYQMLLKAGFHLPEEVEMSRKLMIEIPEE
FT                   KIRFILSKPMDVPVYVEHGVADIGIAGKDVLLEQQREVHELLDLNISNCYIASAGLPNT
FT                   DMNEIAPRIATKYPNIAMKYYKGIGEQVEIIELNGSIELAPMIGLADRIVDIVSTGRTL
FT                   KENGLVEYEFISTVSSRLIANPVSYRMKGERIIDLVRRLKKCVNEQKSNHI"
FT   gene            459744..461018
FT                   /locus_tag="Bsph_0440"
FT   CDS_pept        459744..461018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0440"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38067"
FT                   /db_xref="GOA:B1HVP8"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP8"
FT                   /protein_id="ACA38067.1"
FT                   /translation="MKITKLAKGISLKRPLEGGNEEQLKVVRQVLTDVRTQGDVALRAY
FT                   TERWDGYMPTSLRVTKEEIQEAVNALDQQLYQDLVEAAQNIRLYHEQQSRQGYRLELGD
FT                   GSWLGQRVTALDAVGLYVPGGTAAYPSSVLMNVIPAQVAGVKRIVIASPAGLDGKMPAG
FT                   VLVAAQLLGIEEIYKIGGAQAIAALAYGTETIAPVDKITGPGNIFVALAKREVFGEVAI
FT                   DMIAGPSEIAVLADDTAFPDEIAADLLSQAEHDRLACAVLVTTSEKLAKKVAEEVEKQL
FT                   EILPRQEVARASIENFGVIYIAETVSDAVEAINSLAPEHLEIMTNNAEAIAEQIRHAGG
FT                   IFIGRYSSEPVGDYFAGTNHVLPTNSTARFASGLNVDDFVKKSSVVYYSEKTWQEHAPK
FT                   IARLARMEGLEGHARAVESRGWKKE"
FT   gene            461023..461622
FT                   /locus_tag="Bsph_0441"
FT   CDS_pept        461023..461622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0441"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38068"
FT                   /db_xref="GOA:B1HVP9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVP9"
FT                   /protein_id="ACA38068.1"
FT                   /translation="MTEKKRYAQVERTTNETQISVAIDLDGEGKADIKTGVGFMDHMLD
FT                   LFIKHGLFNGTIQANGDTYIDDHHTTEDLGIVLGQAIREALGDKKGIKRYGTAFVPMDD
FT                   ALAQVVVDCSNRPHLEYRVPPLKEKVGTFDTELVHEFLWKFALEARMNVHVIVPYGHNT
FT                   HHIIEAIFKALARAIDAAVEIDPRVKGVPSTKGLLT"
FT   gene            461619..462251
FT                   /gene="hisH"
FT                   /locus_tag="Bsph_0442"
FT   CDS_pept        461619..462251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="Bsph_0442"
FT                   /product="Imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38069"
FT                   /db_xref="GOA:B1HVQ0"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ0"
FT                   /protein_id="ACA38069.1"
FT                   /translation="MKIGVVDYGMGNLFSVVQALNRLGCEVIVTANQQLLDTTDALILP
FT                   GVGAFPDARKRLAETKLDCYLKNAQSQHRPLLGICLGMQLLFEKSDEVTPTNGLGFFKG
FT                   HIKRFSGTNEGRAYRVPHMGWNELVMANRPAWLENSAPAKHVYFVHSFYATNIEKSELV
FT                   AYADYCGIQVPGIVAKGSVTGMQFHPEKSGELGVYLLEQWLKGVKSC"
FT   gene            462245..463006
FT                   /gene="hisF"
FT                   /locus_tag="Bsph_0443"
FT   CDS_pept        462245..463006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="Bsph_0443"
FT                   /product="Imidazole glycerol phosphate synthase subunit"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38070"
FT                   /db_xref="GOA:B1HVQ1"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVQ1"
FT                   /protein_id="ACA38070.1"
FT                   /translation="MLTKRIIPCLDVKEGRVVKGIQFVSIRDAGDPVELAKFYDEQGAD
FT                   ELVFLDISASHEGRETMIEVVQQTAATLAIPFTVGGGIRTLDDMKRILRAGADKVSVNT
FT                   SALERPSLIQEGSDFFGAQCIVVAIDARYSEEDGTWMVYTHGGRNKTTWSAIDWAKEAV
FT                   RLGAGEILLTSMNQDGEKSGFDLGLTKAVREAVSVPVIASGGAGYAEHFYEVLAEEVDA
FT                   DAALAASIFHYKETSVAQVKEYLRAKGVAVR"
FT   gene            463003..463620
FT                   /gene="hisIE"
FT                   /locus_tag="Bsph_0444"
FT   CDS_pept        463003..463620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisIE"
FT                   /locus_tag="Bsph_0444"
FT                   /product="Histidine biosynthesis bifunctional protein
FT                   hisIE"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="Includes: Phosphoribosyl-AMP cyclohydrolase
FT                   (PRA-CH); Phosphoribosyl-ATP pyrophosphatase (PRA-PH)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38071"
FT                   /db_xref="GOA:B1HVQ2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ2"
FT                   /protein_id="ACA38071.1"
FT                   /translation="MIERIRFDEKGLVTAVVQDANTKEVLTVAYMNKESFVKTMESGET
FT                   WFYSRSRQELWHKGATSGHTQKVVAIKTDCDYDAIVVEVLPEGPACHNGTASCFTEVVQ
FT                   QNTGVGSVEIIAKLVRVIEKREQEMPVGAYTTYLFEKGIDKICKKVGEEATEVVIGAKN
FT                   RDAEEVKWEAADLIYHLLVLLQEQKVSIYDVLDVLKKRHEEK"
FT   gene            463750..465234
FT                   /locus_tag="Bsph_0445"
FT   CDS_pept        463750..465234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38072"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ3"
FT                   /protein_id="ACA38072.1"
FT                   /translation="MSFIPTGDYYYKKSIQAMNSGQMNKAYKYLQRAVDLSPDDPMIIL
FT                   QLAIIELEGQRFEEAYDLLRRAYQIDPDNPEIIFYMAEVSGCVGIMQDAKRFAEEYLQL
FT                   EPEGAYADEAAEILEFVAFEQDEFEELEGSGEDLYRQEQARRHMEKGDFPEAITILEDL
FT                   IEDRPAFWSAYNNLALAYFYVGEEEQAKALLHTVLRENKGNLHALCNLTVIAYYEKNEE
FT                   DLQELLNVLVKIQPYTWEHRYKLGATLALIGQYELAYKWLRSMQKRGYVGDAGFYFWLS
FT                   HAAYFSGHEEVSKSAWGQLLEVDPDKEGFEPWRQHDNEFALDALEHDRNFIVEKLESSY
FT                   LSERIFGLFLLKATAHKQEIIAHPKWVNIEQFGAFEKLFLAYALGHEFDKKNKVEASFL
FT                   RAVNVPEILLKQYGKLSTLIVPMFQMWFVLCEQALIQNYRFTNPVAIAGANDYLFRSSQ
FT                   MLKVTKKEIAQQYGVSVATLSKYIDEILAFLPSSHN"
FT   gene            465466..466410
FT                   /locus_tag="Bsph_0446"
FT   CDS_pept        465466..466410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0446"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38073"
FT                   /db_xref="GOA:B1HVQ4"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ4"
FT                   /protein_id="ACA38073.1"
FT                   /translation="MSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMA
FT                   NTEEVENYPGFDTILGPELSTKMFDHAKKFGAEYAYGDVTEIIDGEEFKTIKSGTKEYK
FT                   TRAIIITTGAEYKKMGVPGEKELGGRGVSYCAVCDGAFFKQKNLVVVGGGDSAVEEGVY
FT                   LTRFADKVTIVHRRDKLRAQKILQDRAFANDKIDFIWNATVKEINEANGKVGSVTLQST
FT                   VDGTESEFTTDGVFVYIGMLPLTKPFESLGILNDAGYILTNDNMETTIPGIFAAGDVRE
FT                   KSLRQIVTATGDGSIAAQAVQHYVEELLEKINA"
FT   gene            466739..467206
FT                   /locus_tag="Bsph_0447"
FT   CDS_pept        466739..467206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0447"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzymes"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38074"
FT                   /db_xref="GOA:B1HVQ5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ5"
FT                   /protein_id="ACA38074.1"
FT                   /translation="MQRIANLIAVKDGKVLLLQKPRRGWYVAPGGKMESGESIFEAAIR
FT                   EFQEETNVIPLHVHLKGVYTMVIKENNEVVDEWMLYTFVARDVEGVPFVETREGKLAWH
FT                   PVEDLVHLPMAEGDRTNLQFAVSQSGIQYGTFDYTTNFELLHQKIQISKEQ"
FT   gene            467216..468109
FT                   /locus_tag="Bsph_0448"
FT   CDS_pept        467216..468109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0448"
FT                   /product="UPF0042 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38075"
FT                   /db_xref="GOA:B1HVQ6"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVQ6"
FT                   /protein_id="ACA38075.1"
FT                   /translation="MTVVVEGQQRTHELVIITGMSGAGKTVAIQSFEDLGYYCIDNLPP
FT                   ALLTTFLTLLRDSGKNSTRIAAVMDMRGGNFFDALIGALDHILKEGDIVARILFLDADD
FT                   ATLVRRYKETRRAHPLAVSGLPLDGIKQERALLSEVKGRANFVYNTSNMKPKQLREKIV
FT                   KEFASEADTIFTVNIMSFGFKHGMPIDADLVFDVRFLKNPYYVEELRPKTGLQTEVSSY
FT                   VLALEDTQILIQKLTDLFDFMIPLYRQEGKSQLVIAFGCTGGQHRSVTLAEFFGAYLAS
FT                   KENTVITHRDINRRKE"
FT   gene            468114..469082
FT                   /gene="yvcK"
FT                   /locus_tag="Bsph_0449"
FT   CDS_pept        468114..469082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yvcK"
FT                   /locus_tag="Bsph_0449"
FT                   /product="UPF0052 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38076"
FT                   /db_xref="GOA:B1HVQ7"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ7"
FT                   /protein_id="ACA38076.1"
FT                   /translation="MGKKQTKLVVIGGGTGLSTLLRGLKHHPFDITAIVTVADDGGSSG
FT                   RLRDDYDIPPPGDVRNVIAALSDIEPLVEQMFQYRFSASEDLRGHSLGNLMLTALTDIT
FT                   GDFNHAISEMGKVLKVHGRVIPAANKKINLHAVLEDGSIIEGESKIPTATKRIDRVFLV
FT                   PENVQPLPEAIRAIQRADYILIGPGSLYTSIIPNLLVKEIGESVVKAKGRKMYVCNLMT
FT                   QKGETISYTAGDHVSAIHKHVGASFIDSILVNDEELPNPVKELYKEERAEPVTFDVAKL
FT                   ESMGLEVIRRDIATIRPDGTVRHNATNVAEWLVDYAGIYDR"
FT   gene            469158..470123
FT                   /locus_tag="Bsph_0450"
FT   CDS_pept        469158..470123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38077"
FT                   /db_xref="GOA:B1HVQ8"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR033981"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVQ8"
FT                   /protein_id="ACA38077.1"
FT                   /translation="MKGGRDMSFASETKKELTQIEADNHCMKAEVSALIRMNGSLSFAN
FT                   KQLSLDVQTENAAIARRLYTIMKKLYPYNVELLVRKKMRLKKNNVYICRVREGARELLI
FT                   DLEIISDDFQFNHTISRKLIKKNGQKRAYLRGAFLAGGSVNNPETSAYHLEIYSLYKEH
FT                   GEALMDLMNEFELNAKTIERKKGFVTYLKEAEKISDFLNIVGAHQAMMKFEDVRILRDM
FT                   RNSVNRIVNCETANLNKTIGAALRQVENIRFIENSIGLDQLPEKLREIARLRVEYQDVT
FT                   LKELGEMVSSGTVSKSGVNHRLRKIDEIADALRRGEKIGG"
FT   gene            470237..470494
FT                   /locus_tag="Bsph_0451"
FT   CDS_pept        470237..470494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0451"
FT                   /product="HPr-like protein crh (Catabolite repression HPr)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38078"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVQ9"
FT                   /protein_id="ACA38078.1"
FT                   /translation="MIERRVQVKLKLGLQARQAALFVQEANRFSADIFLEKDEKKVNAK
FT                   SIMGVMSLAVAKGTEVTLSSEGNDAEQAVTALATIIENED"
FT   gene            complement(470545..471138)
FT                   /locus_tag="Bsph_0452"
FT   CDS_pept        complement(470545..471138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0452"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 1"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38079"
FT                   /db_xref="GOA:B1HVR0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVR0"
FT                   /protein_id="ACA38079.1"
FT                   /translation="MNLIPTVIEQTSRGERAYDIYSRLLKDRIILLGSAIDDNVANSIV
FT                   AQLLFLQAEDPDKDISLYINSPGGSITAGMAIYDTMQIIKPKVQTICIGMAASMGAFLL
FT                   AAGEPGKRFALPNAEVMIHQPLGGAQGQATEIEIAAKRILFLREKLNGILSERTGQPLE
FT                   VIARDTDRDNFMTAERAKEYGLIDHIMHRSTDNK"
FT   gene            471455..471529
FT                   /locus_tag="Bsph_tRNA26"
FT   tRNA            471455..471529
FT                   /locus_tag="Bsph_tRNA26"
FT                   /product="tRNA-Arg"
FT   gene            472028..472822
FT                   /locus_tag="Bsph_0453"
FT   CDS_pept        472028..472822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0453"
FT                   /product="Histidine-binding protein precursor (HBP)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38080"
FT                   /db_xref="GOA:B1HVR1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR1"
FT                   /protein_id="ACA38080.1"
FT                   /translation="MKKTAWMLLMILAALTLALAGCGTKDTASSGSTPSEGGDGKKVYK
FT                   VGTEATFAPFESVDDKGKIVGIDVDILKAIADEMDFEVEWNNIGWEPVFQTIKNGETHI
FT                   GASGITITDERKESFDFTEPYYESQLLIVVKEDSKIKSLDELKDKKVSVQINATGHMAA
FT                   KKLQGEASTNIMAFESQPIAIQEMLNGNVDAAIGDNAVVYEYIKAHPDQKIKVIQDDAF
FT                   EKEYYGFMVQKGNKELLDKLNEGLKKIKENGKLKEITGTDFE"
FT   gene            472852..473610
FT                   /gene="yckA"
FT                   /locus_tag="Bsph_0454"
FT   CDS_pept        472852..473610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="Bsph_0454"
FT                   /product="Probable amino-acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38081"
FT                   /db_xref="GOA:B1HVR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR2"
FT                   /protein_id="ACA38081.1"
FT                   /translation="MLATHLMDVTLKGKWGFRMDIFDLRWDIVWNYRDMFIRGIGVTLI
FT                   LTLSGYFGGILLGLFLGLGKLSSKKWIYWPSKLYIDLFRGTPMLVQILLIHLAVIPTIF
FT                   GHSLGYMVSGITALILNCAAYNAEIFRAGIQSIAKGQMEAARSLGLTHNQAMRKVILPQ
FT                   AFRRMIPPLGNEFIALLKDSSLVTVIAAPDILYASKVVAGASFRFWEPYMVAALLYLIL
FT                   TYGVTKIVAFIEKRFSNSYVPRKAEGREAR"
FT   gene            473607..474329
FT                   /gene="glnQ"
FT                   /locus_tag="Bsph_0455"
FT   CDS_pept        473607..474329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="Bsph_0455"
FT                   /product="Glutamine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38082"
FT                   /db_xref="GOA:B1HVR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR3"
FT                   /protein_id="ACA38082.1"
FT                   /translation="MIKIENLHKYFGKLEVLKGIDYEIQEKQVVCVIGPSGSGKSTFLR
FT                   CINMLEEVTDGAIYIEDVKINDPKTNINAIRAEVGMVFQQFNLFPHMNVIDNVTMAPMQ
FT                   IRKMSRSEAEALGHELLNKVGLDSKAYNYPEQLSGGQQQRVAIARALAMKPKAILFDEP
FT                   TSALDPEMVKEVLDVMKNLAAEGMTMVVVTHEMGFAREVGDRVVFMDGGYIVEEGLPEE
FT                   LFGNPQSERTKAFLGKVL"
FT   gene            complement(474384..474998)
FT                   /locus_tag="Bsph_0456"
FT   CDS_pept        complement(474384..474998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0456"
FT                   /product="Hypothetical yhcQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38083"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR4"
FT                   /protein_id="ACA38083.1"
FT                   /translation="MSQSFYNESSNQTNLNQQHSLNHGGHEMMDMHEAIGEIIAGMNQA
FT                   IILRPQVKDQELLSILDRQYNFSLGMYNTIVESFKTGHDPSVPTGRYQMETGNDFKYGL
FT                   TPGQPKKPMQNANEINDEAISGFLLGAQKGVAKCMTAAATETTNPVVRRVVADSIPNCI
FT                   EMAYELSIYQNKHGYYQVPQYSQQDMQTMLNAFDTTSNPLH"
FT   gene            475137..475717
FT                   /pseudo
FT                   /locus_tag="Bsph_0457"
FT                   /note="This region contains a gene with one or more
FT                   premature stops or frameshifts, and is not the result of a
FT                   sequencing artifact; conserved hypothetical protein;
FT                   identified by sequence similarity; putative"
FT   gene            475804..476466
FT                   /locus_tag="Bsph_0459"
FT   CDS_pept        475804..476466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38084"
FT                   /db_xref="GOA:B1HVR5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR5"
FT                   /protein_id="ACA38084.1"
FT                   /translation="MKNTYIHDFANVLSLDVKQKLNHYSEQLDKGTGAEIMVVTVDSLH
FT                   GQEAKMYATKLIRSWGIGDKEKNNGALILATFGQGKGQNDVVIAVGQGLEGALPDGKLG
FT                   RILDNAFYPLASEGDNDQAFLATYAEVFRAVAEEYNWNGELPAGANADEEIPIWLMIVI
FT                   IIAVIIFSSFFSKGGGGPRGRGYGGYPGSFGGRRSGGGSFGGFGGGSSAGGGASRKF"
FT   gene            476600..478870
FT                   /locus_tag="Bsph_0460"
FT   CDS_pept        476600..478870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0460"
FT                   /product="Dipeptidyl peptidase family member 6"
FT                   /EC_number="3.4.14.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38085"
FT                   /db_xref="GOA:B1HVR6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR6"
FT                   /protein_id="ACA38085.1"
FT                   /translation="MKKRFLTASLAIILTTATVIPATLQEVRAANETNIVLAQEQQLSA
FT                   QEFLDLAVTALTFQHGSDSMRQQIKDQWVKAGEITDLSATIKRDQAARILVRAANKEGK
FT                   EKTLAEYLKKANKLGFFKGISSSTDFISKQEASKLLNNVKKIKNGSSNKGVKEISVEDF
FT                   VKNPGNFGYELSPDGNYITFASAWENRSNVFVKKMNDNSEPVRVSSSKDRNIAGFFWKD
FT                   DSLLYLKDKGGDENFHIYSTTFNGSVEKDLTPYPNVTVGILDSLQGVKDEILIMMNKED
FT                   ATVFDVYKLNVKTGKTTHVAKNPGNITNWLADRNGNVRVAVATDGVKGAILYRDSEKDE
FT                   FRPFIKMGAGDEVMPLAFSKDNKFIYATSNKGRDKVEVVKYDLQGKEEVIMSNDEVDVS
FT                   GVLYNAEKDKLLFGAYATDKIHYQFFDKDFEKLFRKIQNKLGVHESELGINDYNKEMTK
FT                   FIVSVSSDTIYGKYYYYDSTTDELKELATLSPWLKSADLAEMHPISYKSRDGLTINGYL
FT                   TLPKNKKAENLPLIVNPHGGPWARDMWGFNPEVQLLANRGYAVLQVNFRSSTGYGKEFL
FT                   QAGNKQWGLKIQDDITDGVQWAIDQGIADPKRIGIYGASFGGYATLAGITYTPDLYAAA
FT                   VDYVGVSNIFTLLDTIPPYWETMRDLFYERVGHPEKDKELLKAVSPVFHVDKIKTPLFV
FT                   AQGANDPRVNKAESDQIVEALRARGVDVEYMLKDNEGHGFANEENRIEFYNAMVKFLDH
FT                   HLK"
FT   gene            479073..479306
FT                   /locus_tag="Bsph_0461"
FT   CDS_pept        479073..479306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG: Thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38086"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR7"
FT                   /protein_id="ACA38086.1"
FT                   /translation="MIVQFFSRANCPLCVEGLHTLKLVQEDVAFDIEIVNIEEDDHIHE
FT                   KYMFMIPVVEKDGTVIQYGNLDYATLMEHLGS"
FT   gene            479545..479685
FT                   /locus_tag="Bsph_0462"
FT   CDS_pept        479545..479685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38087"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR8"
FT                   /protein_id="ACA38087.1"
FT                   /translation="MKGDFTMWVITVFEKKDVRIFEFTNKNEATKALEGFKKNAILSFT
FT                   K"
FT   gene            479860..480909
FT                   /locus_tag="Bsph_0463"
FT   CDS_pept        479860..480909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0463"
FT                   /product="Central glycolytic genes regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38088"
FT                   /db_xref="GOA:B1HVR9"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVR9"
FT                   /protein_id="ACA38088.1"
FT                   /translation="MFTIPEAQQRLLPEMYPLLQSRYRILQAVQLMQPIGRRTLADSLK
FT                   MTEREIRKETDILREQGLLDSQKSGMVCTDDGEEVIEKLRAIVYEWSGLTQLAKLLEKH
FT                   FGIQHVVVVPGDYSEDNTVLTLLGKEAALQFMSTAFDEQVVAVTGGKSVASLAQFLHPL
FT                   DGQKDITFVAARGGIGHEMQMQANTLVATFAMQMEEQYRTLFLPEHLSEQAYKAMLTEP
FT                   MVTEMMAFYDRADCVIHGIGSAEEMAIRRNSSSEDLRILEEKGAVSEAFGYYFNAEGEI
FT                   VHRIRTIGIQLEQVKNSQQVIAVAAGKQKVNAMLSYFKVAPKQTIFITDEAAAKAIAAT
FT                   LPSDNSHFE"
FT   gene            481024..482055
FT                   /locus_tag="Bsph_0464"
FT   CDS_pept        481024..482055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0464"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38089"
FT                   /db_xref="GOA:B1HVS0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS0"
FT                   /protein_id="ACA38089.1"
FT                   /translation="MEELTMALKLAINGFGRIGRLVFREAMKQSEFEVVAVNDLTDAGQ
FT                   LAHLLKYDSVHGIYDAEVNADEDSFVVNGQRIKVYAEKDPSQLPWGELGVDVVLECTGH
FT                   FRSLEEVGKHIEAGAKKAILSAPAKGAMPTFVMGVNHTDYNPATDDVISNASCTTNCLA
FT                   PVAKVLDEKFGIERGMMTTIHSYTNDQRILDFPHSDPRRARAGAVSMIPTTTGAAVAVS
FT                   KVLPQLKGKLDGFSMRVPTPNVSCVDLVVELKADVTKEAINAVLKEASENELKGILDYN
FT                   ELPLVSIDYNGNHHSSTVDGLSTMVLENKMVKVLAWYDNEIGYSTRLMDLALYIAEQGL
FT                   NNK"
FT   gene            482604..483788
FT                   /locus_tag="Bsph_0465"
FT   CDS_pept        482604..483788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0465"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38090"
FT                   /db_xref="GOA:B1HVS1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS1"
FT                   /protein_id="ACA38090.1"
FT                   /translation="MLNKKTMKDIDVKGKRVFVRVDFNVPMADGVITDETRIRAAIPTV
FT                   EYLVEQGAKVILASHLGRPKGEVKEDMRLTAVGIRLAELMSKPVTKLDESIGQAVEKAV
FT                   ANMQDGDILLLENVRFHAGEEKNDPALAQQFAQLADIYVNDAFGAAHRAHASTEGIAKH
FT                   IPAVSGFLMQTELDVLGKALSNPEHPFTAIIGGAKVKDKIGVIESLLEKVDHLIIGGGL
FT                   SFTFIKAQGYDIGKSLLEEDKIELAKSFIEKAKAKGVQLHMPIDAVVANEFSQDAETKV
FT                   VDVDAIPADWMGLDIGPKTAAHYAEVINNSKLIIWNGPMGVFEMDKFANGTKTVADAMA
FT                   TTSGYTVIGGGDSAAAVEKFKVADKMDHISTGGGASLELMEGKELPGIVALNDK"
FT   gene            483815..484576
FT                   /locus_tag="Bsph_0466"
FT   CDS_pept        483815..484576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0466"
FT                   /product="Triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38091"
FT                   /db_xref="GOA:B1HVS2"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVS2"
FT                   /protein_id="ACA38091.1"
FT                   /translation="MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPAL
FT                   YLPTLVQVASESELAIGAQTMHYENEGAFTGEISPAQLASVDVDYVILGHSERREYYNE
FT                   TDEAINKKVAAALAHNIVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQVEHMV
FT                   IAYEPIWAIGTGKTATADDANQVCGAIRSVVEELFDAATANAVRIQYGGSVKPDNVHEL
FT                   LSKEHIDGALVGGASLQPESYLTLLEAAANA"
FT   gene            484569..486110
FT                   /locus_tag="Bsph_0467"
FT   CDS_pept        484569..486110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0467"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38092"
FT                   /db_xref="GOA:B1HVS3"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS3"
FT                   /protein_id="ACA38092.1"
FT                   /translation="MPKKPVALIILDGFAFRDETFGNAVAQAKKPNFDRYWSQFPHATL
FT                   TASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRLNKSIREGDFFTNQAFLDAVAHV
FT                   KAHNSKLHIMGLLSDGGVHSHYEHMFALLKLAKQQDLNDVFVHGFLDGRDVGPTTALDY
FT                   IEETEKQMSEIGIGQFASIHGRYYAMDRDKRWDRVALTYNVLVDGVGQTAESAKSGVAA
FT                   SYEREVTDEFVIPFSIQEHGEPVATIGDNDAVIFFNFRPDRAIQLSKVFTNEDFDGFAI
FT                   SAKHPKNLKFVSFTHYSDEVNAQIAYENDNLKNTIGEVLAMNGKTQLRIAETEKYPHVT
FT                   FFMSGGREEKFLGEERILIASPKVATYDLKPEMSAYEVTEALLAEIEAEKFDGIILNFA
FT                   NPDMVGHSGMLEPTIKAIEAVDECLGKVVDALLAKGGAAIITADHGNSDEVVTLAGQPM
FT                   TAHTTNPVPVIVTKPNVVLRNGGILADLAPTMLELLQVSQPTEMTGQSLIEKEEN"
FT   gene            486113..487405
FT                   /locus_tag="Bsph_0468"
FT   CDS_pept        486113..487405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0468"
FT                   /product="Enolase"
FT                   /EC_number="4.2.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38093"
FT                   /db_xref="GOA:B1HVS4"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HVS4"
FT                   /protein_id="ACA38093.1"
FT                   /translation="MPFITQVYAREVLDSRGNPTVEVEVFTESGAFGRSIVPSGASTGE
FT                   YEAVELRDGDKSRYLGKGVLKAVENVNTIIAQELEGNYSVLDQVVIDKALIELDGTENK
FT                   GKLGANAILGVSMAVAHAAADYLDVPLYQYLGGFNSKQLPVPMMNILNGGAHADNNVDI
FT                   QEFMVMPVGAESFRHALRIGAEIFHNLKAVLKDKGYNTAVGDEGGFAPNLGSNEEAITV
FT                   ILEAIEKAGYKPGEEVKLAMDVASSELFNKEDGKYHLDGEGVVKTSEEMVDWYEELTNK
FT                   YPIISIEDGLDENDWAGHKLLTERIGSRVQLVGDDLFVTNTKKLAAGIEQGVGNSILIK
FT                   VNQIGTLTETFEAIEMAKRAGYTAVISHRSGESEDATIADIAVATNAGQIKTGAPSRTD
FT                   RVAKYNQLLRIEDQLGSTAEYLGLKSFYNLK"
FT   gene            488117..488653
FT                   /locus_tag="Bsph_0469"
FT   CDS_pept        488117..488653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38094"
FT                   /db_xref="GOA:B1HVS5"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS5"
FT                   /protein_id="ACA38094.1"
FT                   /translation="MQRKTKSAIVIIAVLVIFGGIFGYFKFTEPMEKPTPVKEKAIVEN
FT                   AGVTLDDKRVTKEELLYPDNLIEHKMNEAIHSMSHQKVEAKTKWGHTQITQAKVDRLLE
FT                   ISKESNYKFRELYIEILERWSKGDFSHAIEDHNAIWEMQGGDESGNSGKAIRLLTPAEE
FT                   QAYIENNLTYDLYDK"
FT   gene            488771..489292
FT                   /locus_tag="Bsph_0470"
FT   CDS_pept        488771..489292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0470"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38095"
FT                   /db_xref="GOA:B1HVS6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039135"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS6"
FT                   /protein_id="ACA38095.1"
FT                   /translation="MKILETERLILRLQTTEDALFILELVNDPSWIQFIGDRGVKTVEE
FT                   AASYIENGAIRMYEQFGFCLYVVEIKENQTPIGICGFVKRETLEDVDIGFAFLPDYWGK
FT                   GYAYEAASAVLAYGLVTLGFNRIVAITTQENYASAKLLERIGLQFERVIQFSNDSEELR
FT                   LFSLNGEKSK"
FT   gene            complement(489357..490532)
FT                   /locus_tag="Bsph_0471"
FT   CDS_pept        complement(489357..490532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0471"
FT                   /product="Protein dltD precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38096"
FT                   /db_xref="GOA:B1HVS7"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS7"
FT                   /protein_id="ACA38096.1"
FT                   /translation="MIKKGFLSLFIAFALFTGFVFFPNSWIKAWISEDDVEQAKTNMSP
FT                   LVFQGTYLQERMLQEPTSMPLYGSSELNRFDPFHPYNYTRATDAPYSTFMIGRGGMQSI
FT                   THFLNFAAQEKNLAGKKLVFIISPQWFTEKGMGEFHFSPNYSMLHAYDLAFNDDMDADL
FT                   RKQAMERLLEFDTVERDRLLKTMYQYQMSNGKKHPVTGRMAMVAGRFHKELLEKKDLYY
FT                   SLFPRKGHPLKNNDKLVTDQSFEQQIQHAEAYGEKRVSNEYMIENRAFKRLVNANFSKF
FT                   KDMRKHEDYTESPEYKDFQLVMDVLKDAGAKPLFISIPVNGYWYDYNGYPKERRQQYYE
FT                   KMAQLLKDADVDYVDFTDHEYDPYFIMDTIHIGWKGWVYLDQHMDKYWAQQ"
FT   gene            complement(490529..490762)
FT                   /locus_tag="Bsph_0472"
FT   CDS_pept        complement(490529..490762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0472"
FT                   /product="D-alanine--poly(phosphoribitol) ligase subunit 2"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38097"
FT                   /db_xref="GOA:B1HVS8"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS8"
FT                   /protein_id="ACA38097.1"
FT                   /translation="MDKQQVLEMLVELCEDEIIVENPDIDLFEEGLLDSFGTINLLVEI
FT                   ENRFNISVPITDFNREEWNTPNRIAGKLAERQ"
FT   gene            complement(490811..491974)
FT                   /locus_tag="Bsph_0473"
FT   CDS_pept        complement(490811..491974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0473"
FT                   /product="Protein dltB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38098"
FT                   /db_xref="GOA:B1HVS9"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVS9"
FT                   /protein_id="ACA38098.1"
FT                   /translation="MTPYGNIAFFLIIGLLLLPTILLGLRGKSAKHYNLFVSLIVLALI
FT                   FGHSLNGSISLILFTVFQIILITAYQRYRLRQNNGPVFVMAVLLSILPLVLVKVLPILG
FT                   LHHLFGFLGVSYITFKAVQMILETRDGLMKEKISIAELAYFLLFFPTVSSGPIDRWRRF
FT                   TKDFHSVPSSEDYQKLLLSGINYIFVGFLYKFILAYLIYNYTLIYLPNHTYNYLTPFQG
FT                   QLAYMYMYSFYLFFDFAGYSAFAVGVSRIMGIQTPINFNRPFASRNIKDFWNRWHMSLS
FT                   FWFRDYVYMRFVLWMTKKKWLKNKFTISYIGFFLLFFLMGIWHGLEWHFVVYGLYHALL
FT                   IISFDKFERWNKKHKLWPKNKWTHAIGVFITFNAVCFGFYIFSGKLF"
FT   gene            complement(491971..493446)
FT                   /locus_tag="Bsph_0474"
FT   CDS_pept        complement(491971..493446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0474"
FT                   /product="D-alanine--poly(phosphoribitol) ligase subunit 1"
FT                   /EC_number="6.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38099"
FT                   /db_xref="GOA:B1HVT0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVT0"
FT                   /protein_id="ACA38099.1"
FT                   /translation="MLSILAAIERVAIQQPQKTAYQTHNASLTYGELWHFSDCIADYIM
FT                   THHLQRQQPIVVYGHMSPLQIVAFLGAVKAGHPYVPVDSSTPSERLQLILEASKAGLLF
FT                   TTEPLQMLTNIPVVAVSDVLDSPSLPNSPATRDWVQQEDIHYIIYTSGSTGQPKGVQIT
FT                   ANNLAHFVTWMQEHFPLQKSGVFLNQAPYSFDLSVMDLYPALVGGHTLYAITQQEIANP
FT                   RALFDSLALSNTRVWTSTPSFAKMCLMNKEWEQQLMPALDTFLFCGEVLPIAVIKELMQ
FT                   RFPQATIYNLYGPTETTVAVSYVKVTKALLEQFEQLPIAPISEPNVSLLDDGEIVISGS
FT                   TVSAGYLGAPELTAKAFPTVDGHRIYQTGDMGYEQDGYLFFLGRKDFQVKLHGYRLEIE
FT                   EIEKQISNLPPVSSCVVVPVYKDKEIVSLNAHIVLREPLADSAFKMTKQLKALLSEYLP
FT                   AYMIPRTFKYMDALPLNANGKVDRKGLAVMETV"
FT   gene            complement(493882..495528)
FT                   /locus_tag="Bsph_0475"
FT   CDS_pept        complement(493882..495528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0475"
FT                   /product="Alkaline phosphatase 3 precursor"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38100"
FT                   /db_xref="GOA:B1HVT1"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVT1"
FT                   /protein_id="ACA38100.1"
FT                   /translation="MKYAKKWASLFLASAVTLSAVSIPQQDVQAAPVKKPTNVIMLVMD
FT                   GSSNNAVTLSRWYKGESLAMDEILSGAMRTYSAESAITDSAPAATALATGNKSNDKYIG
FT                   VLPSEINSPGLAQIDKKDAFRPVANVLEGAKQQGKATGLISTSEIQHATPAGFSAHANN
FT                   RSQYGDIAEQQVYQNIDVVLGGGLESLTPGTSKNARKDGEDLLKVLKDHQYDLVHTRDE
FT                   LLNSPSSKIWGSFAPSALAYDLDRAKTRKSEPTLAEMTNKAINTLKKDKDGFFLFVEGS
FT                   KVDWAAHANDTIGIISDILSFDDAVKEAVDFAKEDGNTLVIAVTDHGNSGITMGNANTT
FT                   STYSSIPVSAYIDPLKKASMTVEGALSQLKEDRSNLVEVAALYGLDPLTKDELSTLKSA
FT                   KDVGSEMVKMLANRANIGYTTGGHTGEDVFLYSFGPSKLTGLVENTDVAHTMAQFMGFD
FT                   LKSLTDDLYVPATKAFTKKGFTTKIDLSDKENPIFIAQKADVTVKIPVNKNTMIYEQAS
FT                   KNTTKTHTFNTINVYNGSEFYVSKKVINAVK"
FT   gene            complement(495707..496417)
FT                   /locus_tag="Bsph_0476"
FT   CDS_pept        complement(495707..496417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0476"
FT                   /product="putative murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38101"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1HVT2"
FT                   /protein_id="ACA38101.1"
FT                   /translation="MHRAKVINDYVVQLATYTEKGSTEGQSVFELINEKTAVCQAYALL
FT                   TYRLLTASDLDAKYVYGYSEDQLHAWNLVNVDGNWYHLDTTWNDVAPTEPLTISYEYFL
FT                   VNDEKLSQDHLWANENYLAATSNDYDFMHDMWYANTVDHVIYYNSMSDSTVYSYDLTTN
FT                   ENKQITDTACYYLVTDQQSIYCSDYDNAGYLTKINVHDGSEEVLFEDEVLNLNIHDGIL
FT                   YYETLDGSKHQQNL"
FT   gene            complement(496639..496872)
FT                   /locus_tag="Bsph_0477"
FT   CDS_pept        complement(496639..496872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38102"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWE5"
FT                   /protein_id="ACA38102.1"
FT                   /translation="MTTLEETNETSETNAEVKMPESKALSDSFSPTDLFSTTLFKDDPA
FT                   LLQFAKKVEKQVAQFEEHFEISYTGKLDFEDF"
FT   gene            497189..497416
FT                   /locus_tag="Bsph_0478"
FT   CDS_pept        497189..497416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0478"
FT                   /product="secG, yvaL; preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38103"
FT                   /db_xref="GOA:B1HWE6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWE6"
FT                   /protein_id="ACA38103.1"
FT                   /translation="MHTVVLVSLVIVSLALIVVVLLQSSKSAGLSGAISGGAEQLFGKQ
FT                   KARGMDLILHRATIVLAILFFILAIAITKI"
FT   gene            497605..498351
FT                   /locus_tag="Bsph_0479"
FT   CDS_pept        497605..498351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0479"
FT                   /product="carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38104"
FT                   /db_xref="GOA:B1HWE7"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWE7"
FT                   /protein_id="ACA38104.1"
FT                   /translation="MNKSLSQPFFFQAGPRAVLLLHGFTGSSADVRMLGRFLEKKGYTT
FT                   LAPHYKGHGVEPEELITTGPADWWQDVVAAYKQLQDAGYEEIAVAGLSLGGVMALNVAL
FT                   NNPVKGIVTMCAPMTMRTTDVMFDGVLKYAKDYKKFQGKQEEQIETEVALIAEKGMPSL
FT                   QELREFIVRTRQEIDMIYAPIFVVQATNDEVIETESANIIYNQTESLDKHIKWYENSKH
FT                   VITLDQEKDQLHEDIYRFLESLNWAQ"
FT   gene            498373..500862
FT                   /locus_tag="Bsph_0480"
FT   CDS_pept        498373..500862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0480"
FT                   /product="Ribonuclease R"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38105"
FT                   /db_xref="GOA:B1HWE8"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWE8"
FT                   /protein_id="ACA38105.1"
FT                   /translation="MKEGICMKDQKDTLQGRLLVFFGQDDYEPLTVGEIEDEFGFEDAE
FT                   EFKELVKTLVRMEGQGLVVRSRSNRYGLPERMNLLRGKFIGHAKGFGFVAPDMEGMDDV
FT                   FIPPHEINGAINGDIVLIRVLKESFGDRREGTVTKVVERGQTSFVGTFQANRGFGFVVL
FT                   DDKKLPMDIFIAKGDTLGAVDGHKVVVEVATWPEDLKSATGYITKILGHKNDPGVDILS
FT                   ILYKHDIPPEFPDEVIAAAQRVPDDITEADLVGRRDLRHETIVTIDGADAKDLDDAVTV
FT                   TKNVDGTYKLGVHIADVSYYVTQGSVIDLEAYDRATSVYLTDRVIPMIPHRLSNGICSL
FT                   NPQVDRLTLSCEMIIDANGNVIAHEIFQSVIKTTERMTYKDVYKILEEQDEALMKRYEP
FT                   LVPMFKNMAELSGILRRKRESRGAIDFDFKESKVIVNEEGWPVDIELRERTVAEKLIED
FT                   FMLAANETVAEHFHWMNVPFLYRIHEDPKPEKLQRFFEFVTNFGILIKGTGNTVHPKAL
FT                   QDVLKAIEGMPEEPVISTMLLRSMQQAKYYPESLGHFGLSTDFYTHFTSPIRRYPDLIV
FT                   HRLIRTYLINKDTSRETVAQWGMAMDEIADHTSERERRAVDAERDTDALKKAQYMSDKI
FT                   GEEFEGIVSSITNFGIFVELPNTIEGLVHISNMTDDYYRFDDRQMIMIGERTNRQFRIG
FT                   DEVTVRVANVIIEESSIDFEIVGMVTSYGRTRKAAPTVIHARKNYNDNKGGRSSRSTRS
FT                   DDEKGGRGGSRRSSRHEEESGSRSTKRGERREGDRDPRGRRKDDSSSPGPKKRVKQKQK
FT                   FYEGIAKKNKKKKSKRK"
FT   gene            500934..501401
FT                   /locus_tag="Bsph_0481"
FT   CDS_pept        500934..501401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0481"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38106"
FT                   /db_xref="GOA:B1HWE9"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HWE9"
FT                   /protein_id="ACA38106.1"
FT                   /translation="MAKGSGKVLAQNKKAGHDYFIEDTIEAGMVLTGTEIKSIRAGKAQ
FT                   LKDSYVRITNGEAWISNMHVSPFDQGNRFNHDPLRARKLLLHKKQIGELVGAVKRDGYT
FT                   IVPLKMYIKDGYAKLLIGVGKGKKDYDKRNDMRKKEAKREMERTFKSKNQY"
FT   gene            complement(502433..503605)
FT                   /locus_tag="Bsph_0482"
FT   CDS_pept        complement(502433..503605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0482"
FT                   /product="prophage Lp3 protein 1, integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38107"
FT                   /db_xref="GOA:B1HWF0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF0"
FT                   /protein_id="ACA38107.1"
FT                   /translation="MAKKKVSPIKSYELKNGETRYEFPVYLGIDPLTGKQKRTMKRGFK
FT                   THKQAELALARIKLDVANGTYKQARAETYQELYDLWIPHYEKTVEESTFTKTVGIFRNH
FT                   ILPAMREYKIDKITVDVCQKHVDKWAEKLKKFRVVKAYAAKVLDFAIKRGYMQTNPFTH
FT                   VDMPIAASKKVTIIEEEEAENFYTREQLIQFLACLEQENNYKAYALFRLLAFSGMRKGE
FT                   ALALTWNDLNFTTNEMRINKALSRGKNNKLYVKSTKTGFARTIKMDDKTMAILKEWKKK
FT                   QKQEYLVLGFNTMQPKQLVFSNERNEFLQPTKTRKWILHVQKKYKLGTITTHGLRHTHC
FT                   SLLFEAGASLKEVQDRLGHSDVQTTMNIYAHVTKKAKEEAIQKFASYLEM"
FT   gene            complement(503714..503953)
FT                   /locus_tag="Bsph_0483"
FT   CDS_pept        complement(503714..503953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38108"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF1"
FT                   /protein_id="ACA38108.1"
FT                   /translation="MEYTNIQKIEDVILKTLNSALNNGLVKEWLSLSEAAKYIGVSYNT
FT                   FIKFRHMGLKVCEIDGIKRVSRKEIDSFLESHSF"
FT   gene            complement(503970..505940)
FT                   /locus_tag="Bsph_0484"
FT   CDS_pept        complement(503970..505940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38109"
FT                   /db_xref="GOA:B1HWF2"
FT                   /db_xref="InterPro:IPR003150"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF2"
FT                   /protein_id="ACA38109.1"
FT                   /translation="MSKKKSNNQKKNNIRDYFKQDEQDTVTSATDDLFNFTVRSGSKQI
FT                   PQSDFSELTEHNEQDTVTSATDDLFNFTVRSGSKQIPQSDFSELTEHNEQDTVTSATDD
FT                   LFNFTVRSGSKQIPQSDFSELTEHNEQHTVTSATDDLFNFTVRSGSKQIPQSDFSELTE
FT                   HNEQHTVTSATDDLFNFTVRSGSKQIPQSDFSELTEQDGDDQLVPKQSQRVTEMALSNK
FT                   KKSNEKSNYRLSEYELSKILLANNQFVMNKYGVLYYWDNLKGYYIALVNKNSDRIIRKI
FT                   IPENSKKYINSNKITEILVWIKSSDELVCAETNTLSSKYLISFSNYVYDIKNEITLDHS
FT                   SRYFITNKLNANFTIPLTSDSGIHFEKFLNTITQNDSVLYDRLQELFGYVLSEIRDIKY
FT                   IPILIGQKDTGKSVILKLLEYIIGEDNFSNISIDQFNNSVYLAELYGKRLNSCAEISEL
FT                   NLKRLDILKKLSGNDYVTARPMYSDPIKFINQSVLLFAGNNLPNIENLDSSSAFKERLL
FT                   LFPFNNPIPKEHQDNELIDKLIAEIDYIAHWSIKGIHRLLNNNFQFTTSFEIEDTFKPY
FT                   LSNSLEEFLLSECAYQTKYQIHTDDLYQAYIVYCENYSFKIISKKSFIQILKKQSNLSF
FT                   RRFRMRGTNKYGFIGIGLKNF"
FT   gene            506073..507356
FT                   /locus_tag="Bsph_0485"
FT   CDS_pept        506073..507356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38110"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF3"
FT                   /protein_id="ACA38110.1"
FT                   /translation="MDKPCFSRKILKTRIDEYTSNVDEFLQNYKGDMLSISLSNKDIQF
FT                   NGLKQIYQYMNIFNLANANNFYTKEAQLQALNIEEICALQDKFIEDLIIVKLAESIQNI
FT                   RGFFRKKKNQKEFKPIFEKMTFSEKEIEKISKNVFFSKFEKIRDYFEMYADEIAQNIER
FT                   AYLPIFIYSLYLRHNEDGFMDIEVKSVLKKRSMELRYTKSKKYDLDSETNVFETAQENL
FT                   AIFIEINTIFSEEYNLNWSLSLYEFNNYTNLLDIYELSNSISNSKLKNTLLDDKLYKIE
FT                   KKKQKKRLKKFIQNEKSLLLDLKEDKKFFNDNFYKLEPVSFKLYIGDALYNPIINDNSD
FT                   IWIICEKLFKHCKVEIERFVENNKMGILGNNKKFPSEIINDLIIIELFGKHNPYDIWKN
FT                   INFYKMDPIHKKVYRRIYKEAYSSINKK"
FT   gene            complement(507511..507762)
FT                   /locus_tag="Bsph_0486"
FT   CDS_pept        complement(507511..507762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0486"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38111"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF4"
FT                   /protein_id="ACA38111.1"
FT                   /translation="MHIGNLNASIVHPREVLKSAILSNSASIIVAHNHPSNNCEPSPED
FT                   IEVTKRLIKAAEIIGITLMDHLILSTDSFKSLKELGYI"
FT   gene            complement(508420..508728)
FT                   /locus_tag="Bsph_0487"
FT   CDS_pept        complement(508420..508728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38112"
FT                   /db_xref="GOA:B1HWF5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF5"
FT                   /protein_id="ACA38112.1"
FT                   /translation="MNQTEFAQHLGLSQSTLAMIEVGKRTFSDKHIKIICSTFNINEDW
FT                   LRNGKGEMFNSSLYEKELIEIFDSLTPETQEYLLVIAKELLNTQQKLLNSKYIDDNQ"
FT   gene            508950..509126
FT                   /locus_tag="Bsph_0488"
FT   CDS_pept        508950..509126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38113"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF6"
FT                   /protein_id="ACA38113.1"
FT                   /translation="MRNETIITEINEIVKQLSTENQRYFLTLVKVAAFAEDAAKKHECY
FT                   GKNKKPDANQQNE"
FT   gene            509563..509718
FT                   /locus_tag="Bsph_0489"
FT   CDS_pept        509563..509718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38114"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF7"
FT                   /protein_id="ACA38114.1"
FT                   /translation="MEKLKTPIYLYGLKYMNYDFYDKNGNQLATFESENGLDQFLNVDY
FT                   EINFEE"
FT   gene            509843..510874
FT                   /locus_tag="Bsph_0490"
FT   CDS_pept        509843..510874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38115"
FT                   /db_xref="GOA:B1HWF8"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF8"
FT                   /protein_id="ACA38115.1"
FT                   /translation="MGNLVLFLAVFVVFVLGSFFIIQSLIRQIKIRRAIQANKLLLNRM
FT                   RDKNEDGNFHTYNNLLHQTLVNLKGRIKNLPYKKLQSVIDKEINNLTGGYVRRFVSSIW
FT                   VLLKFTFALVFVFMSFMFALIVIDEFKVVENVQDVFDINSNNDVRDIESDDNPLTTQES
FT                   KDDRDKQIYEEGLTAYNEGRTSEAVEALNKINGKSEYYEKSQEMLKDIDKKIYWENIKY
FT                   PNYAEITKSPQNYIEKKVGFTGSILDVVEYNGKTMMIIGTDLINDYYKVYGGDILVLYG
FT                   NVTGYEEGDFVSIAGTMKGSYIETEQKGLIGSYLNNASSFSPSGYVNINQMPVIIADII
FT                   DYQ"
FT   gene            complement(511408..511554)
FT                   /locus_tag="Bsph_0491"
FT   CDS_pept        complement(511408..511554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38116"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWF9"
FT                   /protein_id="ACA38116.1"
FT                   /translation="MKYKNKRTFSVRTTNGQLSEIFSDSWLFCTFGLHSFDQDMYQFKN
FT                   SGC"
FT   gene            complement(511573..512892)
FT                   /locus_tag="Bsph_0492"
FT   CDS_pept        complement(511573..512892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38117"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG0"
FT                   /protein_id="ACA38117.1"
FT                   /translation="MAYNSKGGLPFESASKLGHLSLMNSEWINSLVKDFEAQFSSPSSS
FT                   VTSNWTEFNSSSQNLIDQIWVVDGSYVPVQSDATPPKEVAFIKTAILNISEASLKNIDK
FT                   YNPHPMDLQKIMKDNALFHSTVLPLRNIKSSKGTNFDTIRNIIFESIKIDEKGEYFETL
FT                   KWLAYQKWLVAPTNSPSFNCPYCETNLEFTADLEKMNCTTCSKELYLTDMIGFHLDMTE
FT                   DKATDAIASAYMSIMEHLMLFTIIRLYWSKQDKSLFINTLFIKDGPLSLNSQYVKLIPR
FT                   IRDFLEYAKQQGILINILGQEKSGKFVDHLSTIARYVKPLEKCDRLHYHVLSHKYVETE
FT                   VQDKPSTINYGQRSNWGEKVLVKVDPVTQLVINVPTGDYLDRKNAPLANELINLEVILT
FT                   VIPHIISRRFLGGLYPIELANGIASLSSYPSAKILQKLLE"
FT   gene            complement(512909..514894)
FT                   /locus_tag="Bsph_0493"
FT   CDS_pept        complement(512909..514894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38118"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG1"
FT                   /protein_id="ACA38118.1"
FT                   /translation="MSAIQGLVSNAVLSNNPLIMLKDFLDNQHQLHSAGVKQDYRFIGY
FT                   VLDLGYDTAKIITSDPYKIAVGGIPRGSFLILALDERDEQGNPIQTGLPPHFTLLRVKS
FT                   VSSTPLSNQVQQTYFELHKKSMPELDIWTQAELQWGALECDVIGMFYPNPSDNNLVEFS
FT                   GDVNNVVSAHKYKVFSPDKDLLDLILNGLVNKKNQQQLGVFRPTECQIGLSNNNYPEIN
FT                   ISIEDFKGRRTAMFGKTRLGKSNVVKVLADAIIRTSITTQSVGQLIFDINGEYANDNPQ
FT                   DGNRSLASAHPNDCVVYALNPRNSSFKELKINFSDQPDSAISILKSFLERDKKTSDYIK
FT                   SFANVELPSIMEIKSESDKGKQTRGIRKIQMFWAILKSAGFSMDESKLNSLNLSSGTSR
FT                   GFNPGYSKNLREAIYSGNVPNHPSSLNDLVNELKILSTFVQNNKDSKLLMGSSEPLFDQ
FT                   DALALLRFLNPSTGSGPQILTSYRQYHSPNAGDFINEIIQFLNDGKTVILDLGNAAQEI
FT                   RQYFSDMLSKAVFAAQENKFVSNTLGNHFIQLYFEEAHNLFPNSNKDNDTVYHRFAKEG
FT                   AKFHIGMVYSTQSPSTISQELLVQTENFFVGHLASTNEANALSKLQHTFSGLEEDIKKS
FT                   RTPGYMRTLTNSHRFVIPVQVKKFTV"
FT   gene            complement(514907..515746)
FT                   /locus_tag="Bsph_0494"
FT   CDS_pept        complement(514907..515746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0494"
FT                   /product="Modification methylase DpnIIA"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38119"
FT                   /db_xref="GOA:B1HWG2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG2"
FT                   /protein_id="ACA38119.1"
FT                   /translation="MELDRRCSMSNKEILPFLTWAGGKRWLVNNYPEIFPSDFNVYIEP
FT                   FLGSGSVFFHLKPQKAILSDINEDLINTYIALKTDWQNVYKHLKIHQRKHSPDYYYKIR
FT                   DYTPRKLETKAARFLYLNRTCFNGIYRVNKQGKFNVPIGSKQNVILNTDDFKEISDRLK
FT                   SVLILNHDYEAIINMATRDDFIFVDPPYTVNHNDNGFIQYNEKLFSWADQVRLCEALGR
FT                   ARDRGAKIIVTNANHESVRNLYEGHGFEYQIVSRFSGISSKAKGRKKYEEIIVKSNF"
FT   gene            516114..517886
FT                   /gene="sugR"
FT                   /locus_tag="Bsph_0495"
FT   CDS_pept        516114..517886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugR"
FT                   /locus_tag="Bsph_0495"
FT                   /product="ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38120"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG3"
FT                   /protein_id="ACA38120.1"
FT                   /translation="MTIVVGEVQMELFRQFIELREEQERLTNLINDIQENGFEINFIKK
FT                   KIYLYKNGIAYIGLDCQNIEREKLISVFLIKESKSRRIQEIDSYFIDYFNANLKDIVIN
FT                   LEIENLFLESKAYLLEELFMLEQLISEDLTVDFRINSIKFEEYKCFKDEEITFEERITV
FT                   LVGKNASGKTSILDAISVAIGAYLSGIDESTDTKSILKSDVRFTSKDVHGTKVVKHHAP
FT                   TRINFNSDFINKRFDWSRTRSKLKSTKLTTKDSKQVVNLSRFLYREINNNDLRNITLPV
FT                   FSYHGTGRVANFTKNMNQLEKTENISRFFGYKDCLKPASNYKTFISWYSKMQYRAFMLN
FT                   KRIEVLDQVTKCLKETFVFLTEEDKNKVSDVIYLEGSLHLKYSNGDMIPIEFLSDGYKD
FT                   IIGIISDIAYRMAILNPHLEKDVIKATPGIVLIDEIDLHLHPRWQQKIIKLLKNLFPKV
FT                   QFVVTTHSALVVSSTEYREAKELKVVEENLNENFTIVAEIIGDSKEWYIHDILRNVFHV
FT                   DPLLHTRLTSEYIDQDEVDDLINDLNEYVKKYLVSREEHILKKINTLNGKLNTCLTPNT
FT                   PKKRVVDALMEMVR"
FT   gene            517883..518614
FT                   /locus_tag="Bsph_0496"
FT   CDS_pept        517883..518614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38121"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG4"
FT                   /protein_id="ACA38121.1"
FT                   /translation="MKAYYRNPKEIPKKLIDDINKKKWYENLRDGKNNIRDRWNTTQED
FT                   KRPIIREKLYQITNGCCAYCGKKIKISEMDVDHFLPSHKFNYLSYCWLNYIPSCKTCNQ
FT                   SFKHQYYPKSIAEKQIIEHCCQGIVVPFDATYNQNILFTVTQDRIIDPFYDDISIHLTF
FT                   QPLTYSYKAHTDIGKEMNKIFFRRQEFIEYIEGISFAVKRLVKNNNPRNILDPFINLYG
FT                   SEFYYNAYWDFWSERKSDGLL"
FT   gene            complement(518937..520217)
FT                   /locus_tag="Bsph_0497"
FT   CDS_pept        complement(518937..520217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0497"
FT                   /product="Modification methylase BsuRI"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38122"
FT                   /db_xref="GOA:B1HWG5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG5"
FT                   /protein_id="ACA38122.1"
FT                   /translation="MEFKGKEKGRGKFKPAPDLDRETVRNVLLNKISEEKALIIDDPKD
FT                   LEVLKQVQYKSKKYNVVGLFSGCGGLDLGFELAGLIAEIGEENAMTAFKNKEKFDEIRH
FT                   KSVFNTIYTNDMFKEANETYKLNFPDHIIQHEKDIRKVANFPMCNLMLGGFPCPGFSEA
FT                   GPRLIDDERNFLYIHFIRALMQTQPEFFVAENVKGMMTLGKGEVLRQIVEDFSSAGYEV
FT                   TPYLVNSRDFGVPQLRERVFLIGVHKEKIAEKYGFKYPKPQPTHGDGLKPYVTLRDAIG
FT                   DLEESPGPYFEGTYSPIYLSRNRKKTWEEQSFTIQASGRQAPIHPSGEPMRYIEKNKWE
FT                   LVGENRRLSVKEIARIQTFPDWFEFSDGAKEKMSESGRLDKKYKQIGNAVPVLLAKEIA
FT                   KPIAEFAKMHLQNKDEQEEPMLQLSLF"
FT   gene            complement(520319..521068)
FT                   /locus_tag="Bsph_0498"
FT   CDS_pept        complement(520319..521068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38123"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG6"
FT                   /protein_id="ACA38123.1"
FT                   /translation="MSISLDNSKYLEFKISFKQDNADFLENKMTAERAEQIFGPNWQNI
FT                   IESFTSSIDQKFATRNYIFKNKEGRTSAGSITLGWRFELVNKSGGGLSGLANLTPEQVL
FT                   EVYAGRKLAASKKNAIVNGRIIEDSGVANCMINCDVSSLQSIQDAIDSIISIEDFAQNN
FT                   PNVYFVCKALNYRSFDDKIEGNRPLSVFINWEVVDNKLVPNLVYSNPLLTKGNEVRDKL
FT                   KESLNLLKISNTNDINEDNFASFQIVN"
FT   gene            complement(521772..523520)
FT                   /locus_tag="Bsph_0499"
FT   CDS_pept        complement(521772..523520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0499"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38124"
FT                   /db_xref="GOA:B1HWG7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG7"
FT                   /protein_id="ACA38124.1"
FT                   /translation="MMKKNLRLQSISGKLMLLITIIILVTVVIIGSTSYWVAKDQLLES
FT                   GQRELQSIVKGAYTSIELINEEVESGKITLEEGKEQARIILNGPVNEMGEYDYQKSNFT
FT                   YKENGYILAFDEDLVLQLHPSKIGGAPADDLNRSNREKIIAGGKSKNESDRFVIYSDKQ
FT                   PDGSFKDKTAYTEYFEPWGWTIGIAVFQDEFYEGLNILQYIIFGATVVLITLSSLVFYL
FT                   GIRKKLNTLKEVAEAATKISDGHIMVTHLPESNDEIGQLATAFNKMSQQLCTLVEKTKN
FT                   TSEHLLDSATNLSAVSEETSASSDEVGRAITEIATGTQEQAHDLDTINQTVELLSNSIE
FT                   TTEKQSKVMYDITKHAEKISSEGIEIVQQLQQSNTISLAASQEVSDEIKKLHDQINQIT
FT                   QVMETIETIAEQTNLLALNASIEAARAGEYGRGFSVVADEIRKLAEQSKMATHQVQGVV
FT                   SSIVSETTKTVETVEGTMETAKKLNDDVALTQSKFNQMSDSVKQIVESILAVNKEMDVM
FT                   TSYNKLMSEGIESASSVSEQTAASVQEIASSIDEHIKAITDVAHAAEKLTELNRELNTL
FT                   MERYTI"
FT   gene            524246..525607
FT                   /locus_tag="Bsph_0500"
FT   CDS_pept        524246..525607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38125"
FT                   /db_xref="GOA:B1HWG8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG8"
FT                   /protein_id="ACA38125.1"
FT                   /translation="MNDNHQDSQLKRGLSTRHMQLIALGGSIGVGLFYGSSSTIQMAGP
FT                   SILLAYLIGGLVIFTIMRALGEMAVAEPVSGSFSTYANKYLGRFAGFLSGWTYWFMWIV
FT                   VGMAELTVVGVYINYWFPDIPQWVTALVVLVMMTLVNLANVKAYGEFEFWFAMIKVVAI
FT                   IGMIVLGLTIIFFGVGNHGEAIGFENLWAHGGFMPNGFHGILMSLVLVMFSFGGVELVG
FT                   ISAGEAKNPSKSIPSAINNIVWRILIFYIGALGVMMVIYPWNEVGSEGSPFVQIFDYVG
FT                   IPAAAHIINFVVITAAMSAFNSGLYGSGRMLHNLSVQKNGPNYFKTVSKNGSPRRGILF
FT                   SSAVLLMAVVLNYVVPEKVFIYISAVATVAVITSWMIILFAQLKFRRAKTKEEVAELKF
FT                   KIPLYPLSTYIAIAFLLMVIVLMAFIPDMRVALYVAPIWFLILFVGYKGINIKK"
FT   gene            525749..525898
FT                   /locus_tag="Bsph_0501"
FT   CDS_pept        525749..525898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38126"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWG9"
FT                   /protein_id="ACA38126.1"
FT                   /translation="MGKYQLDTKGKVAVAKYHEKHKPAKFDKKQQLEKIRAEYLKKKQE
FT                   QTDQ"
FT   gene            complement(526048..526443)
FT                   /locus_tag="Bsph_0502"
FT   CDS_pept        complement(526048..526443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0502"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38127"
FT                   /db_xref="GOA:B1HWH0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH0"
FT                   /protein_id="ACA38127.1"
FT                   /translation="MELEYFRFYEKPIKAIELMKLYNDAGWWEERKEQDIEEMLKREIS
FT                   IGVWKDGTLIGFARAVTDGKFRAYIEDVVIHKAYQKSGIGKNLVSKLLDELSHIDVISL
FT                   FCEEHLIPFYKKNNFKYSKSQFVLHRK"
FT   gene            complement(526539..526742)
FT                   /locus_tag="Bsph_0503"
FT   CDS_pept        complement(526539..526742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0503"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38128"
FT                   /db_xref="GOA:B1HWH1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH1"
FT                   /protein_id="ACA38128.1"
FT                   /translation="MKGCPYDNAVAEAIFKVFKTEFANGAHFSTLEQLALELDDYVHWF
FT                   NNIRIHGTLGYLTPVEFKQQTL"
FT   gene            527070..528074
FT                   /locus_tag="Bsph_0504"
FT   CDS_pept        527070..528074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38129"
FT                   /db_xref="GOA:B1HWH2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH2"
FT                   /protein_id="ACA38129.1"
FT                   /translation="MARDQNSKRLSLAVLYRRAKRMKKKITIIGKILAGLVIAILLFLL
FT                   IVFLVNTICSKMEQGKIETYGQSVRVDGKNMNVFIQGEGEEIVVLLPGYGTAAPGLDFQ
FT                   PLVDELSPFYKVVVVEPFGYGLSDLTEKERSSENIVSEVHEALQQLHIERYILMGHSIS
FT                   GLYGLDYVNKYPNEVSGFVGLDSSVPTISEKKIGASIITTIKFLKQSGLARLQVKLGDD
FT                   PYAELSYDEKTKEQLRMLQHKNLYNSTQLNEAEIMYENFKAAENLSFPKDLPVIFFIQA
FT                   NHPVTDRWVPEHQRQIKNSVYGQVVTFDGDHYLYRAQAKEIVDSLREFMKVVR"
FT   gene            complement(528229..528600)
FT                   /locus_tag="Bsph_0506"
FT   CDS_pept        complement(528229..528600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0506"
FT                   /product="Deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38130"
FT                   /db_xref="GOA:B1HWH3"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH3"
FT                   /protein_id="ACA38130.1"
FT                   /translation="MNIAELKNNKNNMLVEKEISMIVNAVQGKALVKVIIEACLLTDEE
FT                   KIRACQIAVKAGADFLKTSTGFSLHGATAKDVAIMRQAVGPNVGVKASGGVSTMEDIKF
FT                   MIDAGASRIGTSSAVKILR"
FT   gene            528563..528808
FT                   /locus_tag="Bsph_0505"
FT   CDS_pept        528563..528808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38131"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH4"
FT                   /protein_id="ACA38131.1"
FT                   /translation="MLFLLFFNSAIFITTSISVAPLPMAFKVSNTFVSVVFAPKGNPIT
FT                   VHIFTSDSRNRSADKLTHVGFTHTDANPYCMASWHN"
FT   gene            529302..530540
FT                   /locus_tag="Bsph_0507"
FT   CDS_pept        529302..530540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38132"
FT                   /db_xref="GOA:B1HWH5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH5"
FT                   /protein_id="ACA38132.1"
FT                   /translation="MFVAVLFTYLLMASQRTAPGLITDQLMSDFGVMASTIGLLTSIQF
FT                   FVYTSLQIPMGVLADRFGPNLFLIMGAILTGLGTILYSLGTHEFILFFSRILTGIGDAT
FT                   IWVNMVLILAQWFQKKEFVRLIGFAGMTGSLGFLLATVPFATLILLLGWRISFFSTGLL
FT                   LCLCGVLLYFVLVKNAKRIFSVKSIVEAEVLQREKTSVLLRKIFLNRQAWALFFCHFGV
FT                   VGGYVGFISSWAVPYGIHMYEMTRSEASQLIMIGLFGALIGAPLTSWLAGRLETIKKPY
FT                   IGVQLAVLLSWLSFLLRKGHPSLYLLIILFFIIGFGYGASALTFAAVRQTFPISESGIV
FT                   SGFANTGGFLSAALLPIIFGYVLDYFQSTSGYLGDGYYYGFFTPVLFSAIGLMGVLLLK
FT                   EQRMRAGKKMSNR"
FT   gene            complement(530581..531039)
FT                   /locus_tag="Bsph_0508"
FT   CDS_pept        complement(530581..531039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0508"
FT                   /product="Cell wall hydrolase cwlJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38133"
FT                   /db_xref="GOA:B1HWH6"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH6"
FT                   /protein_id="ACA38133.1"
FT                   /translation="MVEVVKMPRVKYRDADVALMARMMRAEAEGEGQQGMLYVGNVIVN
FT                   RAVASCLDFNDVRTIEQVIYQVQGGNYSFEAVQKGNMFYQRARETEKRLAKQNLDFWRQ
FT                   HPAKYALWYFNPYAPCPPTWYGQPFTGQFKNHCFYEPAPDTCESVYMG"
FT   gene            complement(531163..531714)
FT                   /locus_tag="Bsph_0509"
FT   CDS_pept        complement(531163..531714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0509"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38134"
FT                   /db_xref="GOA:B1HWH7"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH7"
FT                   /protein_id="ACA38134.1"
FT                   /translation="MQNIQRSSYTRPRTKTFDLVITAILAALVFVATMFINLKLPFGQG
FT                   GLIHLGTSMLFISAILFGPKKGALAGAIGMGLFDIVGGWLIWAPTTIISRALQGFIVGK
FT                   IAWSKGYKGDHIGLNILGAVVSMPVMIAVYYIGQAIMFNSWIAPLASIPGDVIQNMVGL
FT                   IIAIPVCVVLKKTPYFKRNF"
FT   gene            531890..532738
FT                   /locus_tag="Bsph_0510"
FT   CDS_pept        531890..532738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0510"
FT                   /product="pyridoxal kinase, putative"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38135"
FT                   /db_xref="GOA:B1HWH8"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH8"
FT                   /protein_id="ACA38135.1"
FT                   /translation="MMKKVAVIQDMSSFGKCSLTAAMPVLSVMGMQAVPLPTAILTAQT
FT                   GYSSFYCEDLTSRMDYFMDEWSKLGASFDGIHTGFVTGKEQIDNIFRFLGVFHSTDTTL
FT                   LVDPVMGDHGEVYKMFTGDLLERMKELVKCADIITPNVTECCLLTGLSFERMQSYQHEI
FT                   DYIQVLEEAGQQLQQATGAKVIITGLNPPTAAGKRYVGNMFVDAERSFHSIRDYNGESY
FT                   SGTGDLFASVIMGGMMRGQDLVESMKLAETFLAAAIEATSKEQVPREAGVHFEQFLRML
FT                   L"
FT   gene            532802..533311
FT                   /locus_tag="Bsph_0511"
FT   CDS_pept        532802..533311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0511"
FT                   /product="acetyltransferase, GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38136"
FT                   /db_xref="GOA:B1HWH9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWH9"
FT                   /protein_id="ACA38136.1"
FT                   /translation="MEIRLLTAQDATSYRTLRLEGLQTNPEAFGSSFEEEKDMGLELFA
FT                   SRLEAQGSFTFGAFDQNELCGVATLVQESKMKLKHKASIFAVYVSPKKRGHGLGKRLMQ
FT                   EIIKQGKQLADVEQINLTVVSSNESAKGLYTSLGFLMFGTEKRALKIDHQCFDEDYMVL
FT                   YVKPLK"
FT   gene            complement(533342..533605)
FT                   /locus_tag="Bsph_0512"
FT   CDS_pept        complement(533342..533605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38137"
FT                   /db_xref="GOA:B1HWI0"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI0"
FT                   /protein_id="ACA38137.1"
FT                   /translation="MITHNTMVSADIAITIFFMLGITYNYFYDSFPIQIEYLGNLVFWL
FT                   ILPLSIIIVALSLWLLKKKVSMVSTLLALFIAVITLFIVLFF"
FT   gene            complement(533713..533886)
FT                   /locus_tag="Bsph_0513"
FT   CDS_pept        complement(533713..533886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38138"
FT                   /db_xref="GOA:B1HWI1"
FT                   /db_xref="InterPro:IPR024419"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI1"
FT                   /protein_id="ACA38138.1"
FT                   /translation="MKEEDVMLTPENIQMWMNLIGNSGFPMAITIYLFMRFEKKMENLE
FT                   AVIIRSLNKHEE"
FT   gene            534086..534592
FT                   /locus_tag="Bsph_0514"
FT   CDS_pept        534086..534592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0514"
FT                   /product="possible RNA polymerase sigma-B factor (sigma-37)
FT                   (general stress protein84) (GSP84)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38139"
FT                   /db_xref="GOA:B1HWI2"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI2"
FT                   /protein_id="ACA38139.1"
FT                   /translation="MEQIKNPIIKSFLANAKNLYLVEKAILYPTDCNMKLVDETFQLHY
FT                   INVQKIKYVSNLIYFYSLDFDKKRRRLHDRFLLIVDDGLFETGMVRKDEIIQEGLLDAV
FT                   ENEELFQSLKSLTDKQLQILEMIYAHDYSIKAVAETLQTTPQNISNLHRKALKKLQQKL
FT                   RKEEG"
FT   gene            534596..534793
FT                   /locus_tag="Bsph_0515"
FT   CDS_pept        534596..534793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38140"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI3"
FT                   /protein_id="ACA38140.1"
FT                   /translation="MERENSYHEESLQFIENFSPKIKQCLHQTSYQEREDLEQEIKLKI
FT                   IEKLATKEFINTPSFWDFFT"
FT   gene            complement(534844..535743)
FT                   /locus_tag="Bsph_0516"
FT   CDS_pept        complement(534844..535743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0516"
FT                   /product="Hydroxyacyl-coenzyme A dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="similar to Hydroxyacyl-coenzyme A dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38141"
FT                   /db_xref="GOA:B1HWI4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI4"
FT                   /protein_id="ACA38141.1"
FT                   /translation="MNYQNITVAGSGVLGSQIAYQSAFKGFQVTIYDINDEALKNAQDR
FT                   ITKLKPLYQQDLGATQEEVDAAYARLTFKSDLAQAVADADLVIEAIPEVVQIKTEFYTN
FT                   LGKVAPAKTIFATNSSTLLPSQFAEATGRPEKFLALHFANTIWKNNTAEIMKHPGTDMK
FT                   VFDEVVAFARAIGMVPLPLYKEQPGYILNSLLVPFLDAAESLLVKEVADPETIDKTWMI
FT                   GTGAPLGPFAILDIVGINTAYNIVEAKATATGDENMKKLANLLKTEYIEKGKLGRATGE
FT                   GFYTYPNPSFAKPDFLKG"
FT   gene            complement(535970..536866)
FT                   /locus_tag="Bsph_0517"
FT   CDS_pept        complement(535970..536866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0517"
FT                   /product="Copper resistance protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38142"
FT                   /db_xref="GOA:B1HWI5"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI5"
FT                   /protein_id="ACA38142.1"
FT                   /translation="MVITPGISDLPYRIQVDGTKLFTLTAEEITWELVNGIFIQVWGYN
FT                   GSTPGPTIRVFPGDRVCIRVINRLPEKTSVHWHGLMVPNAMDGVPPIEPSPFIEPGHYF
FT                   DYHFTIKNPPGTYMYHSHVNVAVQDNAGLLGGFIVEDPSKQNLSQHKDYLCLLQEWAVD
FT                   QLPWGALTKGTYPLNFKKPEFNFFTMNGKCYPFTKSLSVNFGDTVKIRFGNIQMHHHPI
FT                   HLHGHQFHVVGADGFPIARHTQIAKNTILVASGETWDIEFLANNPGIWPLHCHMPHHVT
FT                   NNGAPDVGGMFTTVDYC"
FT   gene            537202..538263
FT                   /locus_tag="Bsph_0518"
FT   CDS_pept        537202..538263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0518"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38143"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI6"
FT                   /protein_id="ACA38143.1"
FT                   /translation="MMKIMLAGALSIVCFTGGLGGQAYAQEAVDVANLIHQKQTVAAAD
FT                   QLQAMSYQDIYKILLLSKVGYENNEVTIVTTNTNITVKISLEAILQSYKDGTNLYPEGE
FT                   KDFTENYEEIKKLFGNAIQIRITQTGNGFKSEIFTANKWEAISAADLNSMLVVFARADV
FT                   ELKPGGYFKDAIGHWAESYIQLLYQADIINGSSATTFNPNGQVTRGELAAIIFRASGLD
FT                   VNEDYEGPATYTDLNGFWGAKEVAILEEYGLIDIFDGSKFEPKKPVTREEMAYVTARYL
FT                   EAMEVDLSKVSKANTFTDKNQMRKETVESIGLLQQLGILNGTNGKFNPKGNLTRAEVSK
FT                   ILTLTLMELSDEE"
FT   gene            complement(538414..539133)
FT                   /locus_tag="Bsph_0519"
FT   CDS_pept        complement(538414..539133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0519"
FT                   /product="zinc transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38144"
FT                   /db_xref="GOA:B1HWI7"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI7"
FT                   /protein_id="ACA38144.1"
FT                   /translation="MMRRGILQVSAMILGGFLFFSVSFGGAIAWIFSKLFQHTTQGLSL
FT                   LCGGFLVGLLVLDIIPSSFQIYQSFGIILGIFIGYFIFQLLDTLFHASHAQNPSVSLLT
FT                   LAMIIHTIPISLTVGNLLGNAALSISLTASIILHHVPEGFALSTALISQGERLWRLFIY
FT                   FFIFSVFFSIFIWFGQYWALPEKAQGILMGISIGLIATASISEFILHQLRYVSFRSFFM
FT                   YLILGYLLSYIFHTLVE"
FT   gene            539330..541018
FT                   /locus_tag="Bsph_0520"
FT   CDS_pept        539330..541018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0520"
FT                   /product="3-oxosteroid 1-dehydrogenase"
FT                   /EC_number="1.3.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38145"
FT                   /db_xref="GOA:B1HWI8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI8"
FT                   /protein_id="ACA38145.1"
FT                   /translation="MKWDASFDVVVVGSGAAGLTAGLSAKLQGLKSLVIEKTDRYGGAS
FT                   AISGGALWIPNNHVIKGEGVPDTHELARQYLDATIGDRVPEALKEAYITKGPEMLRFLY
FT                   NKTNHMRFQYAKGYSDYYPEKLGGLSQGRSIEPLIFDLTKMGSLADHMRRATLSTKGFT
FT                   MNSYEFHKVNMITRTFKGKTTALRLGIRLVKSKVTKSEPVALGEALVARLRLSLAEANG
FT                   ELWLSTAFKNFIMDNERVVGVIIERDGQEQRIEAKRGVVLSSGGFSHHQALREKYLPAP
FT                   TNAAWTSSPVGQTGDIIEPSVTIGATLDLMDKVWGAPSVIDPQGQPFFLVADRGVPNMV
FT                   VVDSAGQRYVNEAAPYHEFVDTMYKHQEETKQAVPSWILIDAAAKSRYIFTGLFPGQAF
FT                   TKSWYDHGIVKSAETIEDLARQMDVPKENLVETVNRFNIFAHNGHDDDFNRGDSAYDNY
FT                   YGDPTLPNPNLAELKKAPFYALRLYPGDIGTKGGVVVDEFARVVKKDGQPIEGLYASGN
FT                   CSASIMGETYPGPGATIGPGMTLSYIATTHMANAVTKIEEPLIKV"
FT   gene            541187..542773
FT                   /locus_tag="Bsph_0521"
FT   CDS_pept        541187..542773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38146"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWI9"
FT                   /protein_id="ACA38146.1"
FT                   /translation="MLEPYRSTWSGILEQEKNNNPFIEYEWVTTWWATLGIHDNVEIFI
FT                   VEHQGTAVAFFPLVHTVGFGKIHYFGFLGQGYATYMEVIAEKQWMERAIHYILKVFTQK
FT                   YKRYLLVFQGLIESKDTSQQLEKYAIEYQMPYSIFRTVTSFIDFQSMTVDDFLKKHRKT
FT                   FKSIKRYEKKLKLFGRLDFQDVGVNHFHKMFTLFMRRWRKKLDKSRFTEAQTRLFYERL
FT                   ADVSNEAFRVEVDSLQFEGHWISFTIDLCCRDRNFCQAMGHEPDFNRFGPGSLIEKENM
FT                   LKAHDSGFRYYDFGSGYEPYKFQWYTDIDFTRKFIMSTKGTTERFIRSWMVLRDRVKGK
FT                   LTNNHQLVKLKRDRLGELLYFLKHARTREWLRLMKGVLQRIVAIHRIDIYIAEQKYDQG
FT                   YMPFEELHMKDIMTLNERPAYIAHFYKGNRFFGDGDQIVYRRHDHIAYEEVSGYTYELS
FT                   ANMSFIREYDTQLLKEIVVEVQREGRSVCTIAPWYEGRRRRKLKQAGFHKVSQITLVRL
FT                   FKWRKEFHAKQ"
FT   gene            complement(542822..543445)
FT                   /locus_tag="Bsph_0522"
FT   CDS_pept        complement(542822..543445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38147"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ0"
FT                   /protein_id="ACA38147.1"
FT                   /translation="MILTKQEAIQALKKNKFIGFTITTGNIIMKKMNKTDYNIFVFEEG
FT                   KEKPLRYVGSIMNVMATMSDKASNKDFVIVEQLPTQNNVAETQTSENEATLEEKAVAAE
FT                   VAEVAVVDETEESRAIAGYEDLYKMTVSGRIITVRENRPLARCNDEYGFHIARLTKDGK
FT                   ASSHNVFELWKQTFPEVEQTQFKGALKAKYGTGCKLIDKPGIHF"
FT   gene            543725..544174
FT                   /locus_tag="Bsph_0523"
FT   CDS_pept        543725..544174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38148"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019905"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ1"
FT                   /protein_id="ACA38148.1"
FT                   /translation="MVQHKFTMDLTWSDGRNGTGTINASNLKTQISIPQEMDGPGIGTN
FT                   PDEMLLGASATCYLITLAALLERSEVAVHDLSLQSEGYVSVVNGVFTYEKIIHKPKIVI
FT                   LNLTEHLETKITRFAQKAEQTCMISKALKGNVEIECDAQILGARI"
FT   gene            544315..544950
FT                   /locus_tag="Bsph_0524"
FT   CDS_pept        544315..544950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0524"
FT                   /product="Galactosyl transferase cpsE"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38149"
FT                   /db_xref="GOA:B1HWJ2"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ2"
FT                   /protein_id="ACA38149.1"
FT                   /translation="MHVSTTKNLTFYGQYGKRIFDITGALLLLFMTIPLMLAVFLILLF
FT                   TTGRPIFFKQIRTGLDHHRFVIWKLRTMCIQAVPINMPAICTNGIPDDYFFKVEQDTRI
FT                   TKVGAILRKLSIDEIPQLLNVLKGEMSIVGPRPEVPTITNAYNNLQARRLEVKPGLTGL
FT                   AQINGRSNISHGQKISYDIEYVDHYSFWMDVQIVLKTLYVVLARTGAY"
FT   gene            544961..546091
FT                   /locus_tag="Bsph_0525"
FT   CDS_pept        544961..546091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0525"
FT                   /product="second mannosyl transferase"
FT                   /EC_number="2.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38150"
FT                   /db_xref="GOA:B1HWJ3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ3"
FT                   /protein_id="ACA38150.1"
FT                   /translation="MAILKIVQLITRMDKIGGAQKHVEALAIQLKQDGHEVTVVTGSYQ
FT                   PSLWRLQEEKITVIRIPAMQRAIHLAKDFRTFWQLRAVIKRLHPDVVATHSSKAGVIGR
FT                   IVGSLLHIPTVFTAHSWSFTEGVPQRKQMLYYRMEKSVQRFSTKIITVSDYDRELALMK
FT                   KVAPAHKLLTIHNGIAPIDSNPSTEKTYTEQPVIVMVARFEVPKRQDLLLEALAELTDV
FT                   PWQLQLVGDGSLRPALEEFVAQHNLTDRIIFLGDQLDVHTYLEKSHVFVLLSDWEGLPI
FT                   SIIEAMRIGLPIVATNVGGVKELVVDHGNGFLVEREDKELLKQRLRHLLLDATLSQKMG
FT                   NASERRYLQYFTFTPMYQKTLMVYQQAVSEFGKKGD"
FT   gene            546129..547766
FT                   /locus_tag="Bsph_0526"
FT   CDS_pept        546129..547766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38151"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ4"
FT                   /protein_id="ACA38151.1"
FT                   /translation="MWYKEIWDGILEEEDNDNPFIEFAWFYNWWQIVGRKERVELFAIE
FT                   HEGVILAFFPFTVTSRWGIRVYSFAGEGIANYTGVVVKKEWLMNTTTFVFDELIRKHRH
FT                   VIFSLHGLLESKVSTKVIEQYFVERQLRANIFRVVTPYLAFSEVDFLQHFQQRRKLHGV
FT                   DRRERKLRKLGTVTRRVPAQDELWQMFRLFDRRWAKKLDTSDFTKGKKRDFFERLTMLN
FT                   GEALQVEVDALVFENQWIAFTYGLFCRGRYVTYALAHEPTFNVFGPGRIVNQESIQRTF
FT                   AANYRLFDMSIGYEPYKFDWRTNIDFTRRMLASSGTKRAKLVTGLMLLKERFKEYVKSN
FT                   QRIVDWKRNTLGRFRYLVKYGKLRDWLEYGQQFVDRFIRLKHVELYELSPTEDVFPQQP
FT                   VGNLFEEMTIQEAMQLDQEEVIALYYKGYTVYKDSFAETNKPAFALHATNWRVDSLQII
FT                   EALPKQTYFLAYDMFKQIEIITAYFRKVKPRQTLWVTASFWQWRKRKRLGQLGYKPIIR
FT                   MKHYKVARFERQHVQKNTESGGDVHSVH"
FT   gene            547789..548493
FT                   /locus_tag="Bsph_0527"
FT   CDS_pept        547789..548493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38152"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ5"
FT                   /protein_id="ACA38152.1"
FT                   /translation="MQHFYFLEKPANVRKSMKVIGYTNSLVPSRKLVKSEAIHIDLQGH
FT                   ELSLYLALSEGNRKILRRAHKEYYQVILYKEPSVENLRAFQQFYNHFAKRKKLEAIGKS
FT                   QMETIMLLNKQGALLLSEIQSICGQTLCYRLDIVHENKAMSYYEATCAASAISTHLKRP
FT                   YRYANRFLIWHNLLHFKEQGFVLYDMGELTDNRNVRAFKLSFGGQVVNVYSGYITQSKI
FT                   RALLLGVQKWRK"
FT   gene            548498..549490
FT                   /locus_tag="Bsph_0528"
FT   CDS_pept        548498..549490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0528"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38153"
FT                   /db_xref="GOA:B1HWJ6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ6"
FT                   /protein_id="ACA38153.1"
FT                   /translation="MNGGGLVISLDFELNWGVHDVFRYGQYNKNLYGVRKALPSILALF
FT                   EQYDIHATWATVGLLFAESKAEMAHYLRGIPVKYDNMRYAAHSQLAKVGENEQEDLLHF
FT                   GKSLIEEIKRTPHQEIGSHTFSHYYCLEKGQTEAAFCADLDATKTIIEGYISPMKSMVF
FT                   PRNQVNKDYFKACVEAGYVCYRGTENHPLYDAQKFTKKGRFLGAKKWLDSYINLTGHHM
FT                   ATLEEMRDEQLINIRSSAFLRPYFRPLHVFEGSKVKRIKESMLEAAKAQAFYHLWWHPH
FT                   NFGKNTAKNLAMLEELLRYFQELRSQYNFESYSMYEVAELCENISKQQK"
FT   gene            549785..550723
FT                   /locus_tag="Bsph_0529"
FT   CDS_pept        549785..550723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0529"
FT                   /product="Formimidoylglutamase"
FT                   /EC_number="3.5.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38154"
FT                   /db_xref="GOA:B1HWJ7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ7"
FT                   /protein_id="ACA38154.1"
FT                   /translation="MHQWIKQQTNPNPNDVDIVVYGALLSYAEEASGKAQYPTAFRKVW
FT                   PSFQSYNLDEQINLRALSVVDIGDVAIHEQDRMLSESAIEAAAENLSIAFQKSFTCLIG
FT                   GDHAITACSLKGIKNAFPQDRIGIIQIDTHLDARNQEEIGLAQDSPIHQLIASGIVEGR
FT                   HIYNVGLHGFFNSPEMIHYAREQGIHMITLKQMRRDGIQLTIHEMLRQLMYEVDRIYVS
FT                   VDLDALDIMFARDVPAATPGGLTAYELFDILKLIGENEGVRHIDFVYADPKEGTLRPET
FT                   VKIGVTAFLQWLTGIQLDHRNRISNKGKVTL"
FT   gene            550829..551719
FT                   /locus_tag="Bsph_0530"
FT   CDS_pept        550829..551719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0530"
FT                   /product="Probable 5'-3' exonuclease"
FT                   /EC_number="3.1.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38155"
FT                   /db_xref="GOA:B1HWJ8"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ8"
FT                   /protein_id="ACA38155.1"
FT                   /translation="MMTTVPKLLIVDGMALLFRSFFASAAMGHFIRLADGTPTNGAQGF
FT                   VRHVLTAQSLMKPTHMAVCWDMGAHTFRNELFDGYKANRPAPPEEMLPQFDMAKNLSLQ
FT                   MGWQNFGVKGMEADDLIGSMIAKWQDDADITVISGDKDLLQLLRPSTEIAFMKKGYTEY
FT                   DIYTHGRFKEEYSIEPAQFAQVKAFMGDTSDGYPGVKGIGPKQALTLIQTYGSIDSVLA
FT                   SLGELKPGQRTKIQDQIDMLKLSHELATIQTDVPIEADLSSLVLPNYEPQIFKEMEESG
FT                   YTLIAKHARSLYSLI"
FT   gene            complement(551810..552367)
FT                   /locus_tag="Bsph_0531"
FT   CDS_pept        complement(551810..552367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38156"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWJ9"
FT                   /protein_id="ACA38156.1"
FT                   /translation="MRAAFLHEMQLFLKGDTIMRQQLGLLGKSQYDASIAPNYRNSACG
FT                   PTTVHVILNYLNGSAPSINELYKQLGSTKIGLFKWRLIRKLRQLYPSWDVRTCSLKEAL
FT                   QEIDAGRPVAMRFDRYFSFRWRDQTSTFAYHWVPLIGYDIKNNQLWLIFHDNGTSNRDS
FT                   IIRQVLYQNNEKVLSFVKMVPH"
FT   gene            complement(552373..552717)
FT                   /gene="ydbP"
FT                   /locus_tag="Bsph_0532"
FT   CDS_pept        complement(552373..552717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbP"
FT                   /locus_tag="Bsph_0532"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38157"
FT                   /db_xref="GOA:B1HWK0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK0"
FT                   /protein_id="ACA38157.1"
FT                   /translation="MVNKESEYLMKTITTAEQFNELINGDQKVLVKFYAGWCPDCTRMN
FT                   MFIDPIIEEYNQFDWYELNRDELPEIADKYDVMGIPSLLIFQNGEKLAHLHSANAKTPQ
FT                   QVTEFLSAQQ"
FT   gene            553067..555451
FT                   /locus_tag="Bsph_0533"
FT   CDS_pept        553067..555451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0533"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA
FT                   hydratase/isomerase family protein"
FT                   /EC_number="1.1.1.35"
FT                   /note="KO:K00022 K01692"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38158"
FT                   /db_xref="GOA:B1HWK1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK1"
FT                   /protein_id="ACA38158.1"
FT                   /translation="MTYNIKKAAVLGSGVMGSGIAAHLANIGIPTLLLDIAPKELTHEE
FT                   EAKGLSLEHPAVRNRLVNGALQKLLKQKPAPLTSKKNLSLLTVGNFEDDLGKLKDVDWI
FT                   IEVVVENLPIKQSLYEKIDAIRTPGTIISSNTSGISINAMAEGRSEDFKKHFLGTHFFN
FT                   PPRYLKLLEVIPADTTAPEVVSFMKTFGEDVLGKGVVLAKDTPNFIANRIGTYGLLITL
FT                   QEMLKGGYSVGEVDSVTGPLIGRPKSATFRTLDVVGLDTFIHVAKNVYDQTTGEEQQVF
FT                   AVPEFLQKMVTNGWLGAKSGQGFFIKQGKEIHEIDPMTLAYSPVKKLKTPSIEMAKQTR
FT                   GLANKVKALTYAKDRTGELLWGIFAPTLIYSAQLYGEIADDIVAIDNAMKWGFGWQQGP
FT                   FEIWDAIGVKEAVAKMETEGREVPAFVKEMIANGFETFYSDIDGDLAYYNGSDYVKVPI
FT                   NEKEIDLKRYKKKHGVIKSNTGASLIDLGDGIALLEFHSQSNAIGLDIIQMINFAIDEV
FT                   EANYKGLVIGNQGKNFCVGANLGMILVEAQDDNIFELDFVIKAFQDAMQKIKYSRKPVV
FT                   AAPFAMTLGGGAEVCLPAAHIQATMETYMGLVEVGVGLIPGGGGNKALYQKFLKGLPNG
FT                   VEIDYQHIANKVFETIAMAKVSTSGEEARENNFLNFADGISVNPDHQLYDAKQAALALY
FT                   EAGYQPPVPTKVPVVGASGYGTLLIGAQGMYESGFISKHDLKIAKKLAYVIAGGKVPYG
FT                   TLVDEQYLLNLEREAFLSLVADPLSQQRMQHMLLKGKPLRN"
FT   gene            555500..556672
FT                   /locus_tag="Bsph_0534"
FT   CDS_pept        555500..556672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0534"
FT                   /product="3-ketoacyl-CoA thiolase 1, peroxisomal precursor"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38159"
FT                   /db_xref="GOA:B1HWK2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK2"
FT                   /protein_id="ACA38159.1"
FT                   /translation="MREAVIVAGARTPIGKAKKGSLATVRPDDFGAAVVKETLKRAGYE
FT                   GPIDDLILGCAMPEAEQGMNVARSIGALAGLPDTTPALTINRFCSSGLQAIAYAAERIM
FT                   LGHSKAILAGGVESMSMVPMVGNTPRLNPTLAETAPQYYMGMGHTAEEVARQYNVSRED
FT                   QDAFAVRSHVLAEEAIKEGKFNDEIVPIEVEQHYVDENNKPQVKKFTFSMDEGVRSGTS
FT                   VEGLAKLRPAFHVKGSVTAGNASQTSDGAAAVLVMEREEAVKQGLTPMAKFLGFAVGGV
FT                   PPEVMGIGPIVAVPKALEIAGLSIDAIDLWEINEAFASQSLQVVRHLGIDQDKVNVNGG
FT                   AIALGHPLGATGAILTLKLIHELKRQGKKYGVVTMCIGGGMGAAGVFEIL"
FT   gene            556929..558713
FT                   /locus_tag="Bsph_0535"
FT   CDS_pept        556929..558713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0535"
FT                   /product="butyryl-CoA dehydrogenase-like protein"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38160"
FT                   /db_xref="GOA:B1HWK3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK3"
FT                   /protein_id="ACA38160.1"
FT                   /translation="MTEKTTDFIKGGGFLIEDVELDRVFTPEDFTDEHKMIAKTTEEYV
FT                   ANEVLPVVENLEHHEFEHSVRLLKSAGELGLLGADVPEEYEGLGLDKVSSALIAEKMSV
FT                   AGGFSITHGAHVGIGSLPIVLFGDENQKKKYLPKLASGELIAAYALTEPGSGSDALGAK
FT                   TTAKLNDAGTHYILNGEKQWITNAGFADVFVVYAKIDGDKFSAFIVERTFNGVSVGPEE
FT                   KKMGIKSSSTRTLVLEDAEVPVENLLGEIGRGHVIAFNILNIGRYKLGVGTIGGSKRAF
FT                   ELAVQYTNQRQQFKTKLSDFNLTKEKLSTMASHLYASESLNYRTVGLFEDRLSQLSPEE
FT                   QKEGKVIAGAIAEYAIECSIAKVFGSETLDYIADEAVQLHGGYGFMAEYEVERIYRDSR
FT                   INRIFEGTNEINRMIVPGTFMKKALKGELPLLQVAQNLQQELLMLMPEDIGTEPLAQEK
FT                   YLVKNAKKIAVLAAGLAAQRFGAKLDQEQEVLVNIANIANQLFAMESAVLRTEKAIARD
FT                   GVEKAHQKLLYTQIFCQEAFAEIEKEAKDTILASADGDAARMTLSALRKLTRNNPYNLI
FT                   TKKREASVKLIEAEKYIV"
FT   gene            558762..559256
FT                   /locus_tag="Bsph_0536"
FT   CDS_pept        558762..559256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0536"
FT                   /product="Hypothetical yusI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38161"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK4"
FT                   /protein_id="ACA38161.1"
FT                   /translation="MPNKLFVKVTDKNTKWMDRLTEMSEVPPFSMIMMVYYRKRQQRSI
FT                   LMTIQFFHYPKCTTCKKAQKWLNDHDVSYEEVHIVEQPPTKDEITALWQVSGLPLKKFF
FT                   NTSGMKYRDLGLKDKLADMTEEEQLELLASDGMLIKRPLVTDGKKVTLGFKESDFEQAW
FT                   I"
FT   gene            559452..559718
FT                   /locus_tag="Bsph_0537"
FT   CDS_pept        559452..559718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0537"
FT                   /product="Glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38162"
FT                   /db_xref="GOA:B1HWK5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK5"
FT                   /protein_id="ACA38162.1"
FT                   /translation="MFVELPQVGDEIKTDDPFGSVESVKTVSELYAPISGTVVEVNADL
FT                   EDSPEFVNESPYEKAWMIVVEPADASEVDKLMTAEQYEEMTAE"
FT   gene            559810..560001
FT                   /locus_tag="Bsph_0538"
FT   CDS_pept        559810..560001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38163"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK6"
FT                   /protein_id="ACA38163.1"
FT                   /translation="MFDGKCLIVEGRSDKLQIEPILNENVTILCTNGTIGVHQLEELID
FT                   PYEGYELFTFFDAAYFRR"
FT   gene            559958..560152
FT                   /locus_tag="Bsph_0539"
FT   CDS_pept        559958..560152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38164"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK7"
FT                   /protein_id="ACA38164.1"
FT                   /translation="MSYLPFLMPHTSGDKLRALMDRHYPEAEHLRTMPTYKEVETTPRK
FT                   VLAMILLRAHFSIHNEYIL"
FT   gene            560168..560479
FT                   /locus_tag="Bsph_0540"
FT   CDS_pept        560168..560479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0540"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38165"
FT                   /db_xref="GOA:B1HWK8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK8"
FT                   /protein_id="ACA38165.1"
FT                   /translation="MEEWSKEQWETALQSGEKAAFYLYTPMCGTCAVASKMMSIVEQLL
FT                   PHLKLGKANINFLEQIAFEHQIESVPCLLVCDGGKVTEKIYAFQSVPFLYELLKKSID"
FT   gene            560684..560941
FT                   /gene="metN"
FT                   /locus_tag="Bsph_0541"
FT   CDS_pept        560684..560941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="Bsph_0541"
FT                   /product="Methionine import ATP-binding protein metN 2"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38166"
FT                   /db_xref="GOA:B1HWK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWK9"
FT                   /protein_id="ACA38166.1"
FT                   /translation="MEGFFYIRKGVFAMIQLQNITKKYKTANGELTAVKDVNLTINKGE
FT                   IFGIIGYSGAGKSTMIRLLNGLEKPTSRNSNSEQSGFFID"
FT   gene            560913..561752
FT                   /gene="metN"
FT                   /locus_tag="Bsph_0542"
FT   CDS_pept        560913..561752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="Bsph_0542"
FT                   /product="Methionine import ATP-binding protein metN 3"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38167"
FT                   /db_xref="GOA:B1HWL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL0"
FT                   /protein_id="ACA38167.1"
FT                   /translation="MNNQAFSSIKGQKLRAARQKVSMIFQHFNLLWSRTVAENIAFPLE
FT                   IAGVSKAQREARVKELIALVGLEGRDQAYPSQLSGGQKQRVGIARALANNPEVLLCDEA
FT                   TSALDPETTDAILDLLVDINERLGLTIVLITHEMHVIRKICHRVAVMEAGEIVERGEVL
FT                   QVFQAPQAAITKKFVAQITNTKETQDTVEQIKANYPTGQLVKLIFVGEKTEQPVISHLV
FT                   KQFDVEVSIVHGNISQTKNGAYGTLIVQIDGSKANVTEALSYLNTVEVQTEVIADAN"
FT   gene            561781..562410
FT                   /gene="metI"
FT                   /locus_tag="Bsph_0543"
FT   CDS_pept        561781..562410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="Bsph_0543"
FT                   /product="Probable D-methionine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38168"
FT                   /db_xref="GOA:B1HWL1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL1"
FT                   /protein_id="ACA38168.1"
FT                   /translation="MWQATYETLYMTAISTVITFILGLAIGIVLFLTSPNQLWANKIVS
FT                   FLTGSLVNIFRSIPFIVLIILLIPFTKFLLGTIRGANAALPALIIGAAPFYARMVLIAL
FT                   REIDKGVIEAARSMGAKTATIIWKVLIPESLPALISGITVTAVALVGYTAMAGIIGAGG
FT                   LGNLAFLDGFQRNRQDVTLMATILILVVVFIIQWIGDFITEKIDKR"
FT   gene            562477..563328
FT                   /locus_tag="Bsph_0544"
FT   CDS_pept        562477..563328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0544"
FT                   /product="amino acid ABC transporter (substrate binding
FT                   protein) (lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38169"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL2"
FT                   /protein_id="ACA38169.1"
FT                   /translation="MKKLLTGLFLSILVLALAACGTDKKEDSNAASGDKTDSKENVTLT
FT                   VGASNTPHAVILDKAKPILAEKGIDLKVETYTDYVLPNQDLESKELDANYFQHIPYLEL
FT                   QIKDNGYDFVNAGGVHIEPIGIYSKKYKSLEDLPEGATILLSNSVSDHGRMLSLLEAKG
FT                   LIKLKDGIDKTAAEIKDIEENPKNFKFDANTAPEMLVQMYENNEGDAVLINSNFAIDNG
FT                   LNPIEDAISLEDKESPYVNIIAVRAGDESRPEIKTLLEVLTSKEIQDFILEEWKGAVVP
FT                   VQ"
FT   gene            564019..565323
FT                   /gene="vipA"
FT                   /locus_tag="Bsph_0545"
FT   CDS_pept        564019..565323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vipA"
FT                   /locus_tag="Bsph_0545"
FT                   /product="Vi polysaccharide biosynthesis protein vipA/tviB"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38170"
FT                   /db_xref="GOA:B1HWL3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL3"
FT                   /protein_id="ACA38170.1"
FT                   /translation="MSSALLNKIQLKKATIGVIGLGYVGLPFAIEIVQKGFHVLGFDKN
FT                   QEKIAMLQNGESYIADIPKENIQQILKDQHFEATFDFSKLASVDVVIICVPTPTTVDGT
FT                   PDISYIEEAAHDIGRYIKANALVILESTTYPGTTEEIVQPILQKHGFAVGQDLFLAYSP
FT                   ERVDPGNSNFSVSNTPKVVGGVTSNCLEVSKGFYETVIHTSVFTVTSPKVAEMEKLLEN
FT                   TFRQINIALVNELSQMCYKMNIDVWEVIDAASTKPYGFMPFKPGPGVGGHCIPVDPKYL
FT                   LWAGQQHGISATLIEAADKINDSMPNFVVERLEQYLRIQNIELCHAKIVIIGVTYKPDI
FT                   NDSRESPALRVIQQLLDSQSSLQIIDPYIQTFPVEQTLLNTVPLTEKSVKDADAVLILT
FT                   NHSNIDYSLIDQEASLIFDTRNTHFLFKNKNYYRL"
FT   gene            565376..566770
FT                   /locus_tag="Bsph_0546"
FT   CDS_pept        565376..566770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0546"
FT                   /product="Probable polysaccharide deacetylase pdaA
FT                   precursor"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38171"
FT                   /db_xref="GOA:B1HWL4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL4"
FT                   /protein_id="ACA38171.1"
FT                   /translation="MFLAGCQSTPQKTIQPIDSSIEIKESDGTMSDSISHVDIIKPKVA
FT                   LTFNGFADNQTMELLLAKLDESNMKATFFLEGLRVAQEPELVRDILKRGHDVQNGTLSF
FT                   PDVTALNYDQTYEEIYLTNQIFEEHLGYKPKFVRSRSGDITDNMRLAAAALDMKAVIGL
FT                   SINPLDRKMQSAQDLIDYIDKYIDRGSIIHLNTYINPAIIDAIPLLAQLAEKHDYTITT
FT                   LSDVIDERYLTKSLEEIAGYDAVKPNLNYENVEPHLYYRKETSKKEIAITFDDWAHEQQ
FT                   VKAVLDVLKKYNIKSTFFLIGSGVEKNPQLAKLILEEGHEVASHSYYHLDVTKMTPEEI
FT                   QDDLVKAHNALTYALQEPPLLYFRPAQGIMDERTAKVITAAGIKTIAMYDIASFDWNLD
FT                   YSAQDIYDRVISRAAPGKVIVMHILDGTKTVEALPLIIEKLQQDGYSFSKMSNWIEEDA
FT                   NGDVNK"
FT   gene            566767..568638
FT                   /locus_tag="Bsph_0547"
FT   CDS_pept        566767..568638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0547"
FT                   /product="Hyaluronan synthase"
FT                   /EC_number="2.4.1.212"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38172"
FT                   /db_xref="GOA:B1HWL5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL5"
FT                   /protein_id="ACA38172.1"
FT                   /translation="MIKTKKEVLTVPRSDRRILSNIPDPENVRNLVNRRGASYQKEEID
FT                   PTDVNEIYRLQQLSLRYETHFEVQVRRARHKMSSDKYYAEDISVTGILVYSQQPQQLLI
FT                   DEILEMNFTIPGGAMPEGYEAKVKLKAKVVRHFTKEVDGQTLYYFACEFLQPLNKYMVK
FT                   KRWGISVFMASLFLLVVSLIVMLMRAESVIYFRFNKFLYLYSIIAATFLLSRYLFGIFY
FT                   KNVPINPNYEPGVSIIIPVFNEEEWIHRTISSCINQYYPVDKLEVIVVDDCSTDRTEEK
FT                   AKEMIDLIHFEGGRFKTTDRLKFSKLPQNGGKREALVAGVHQAKHDLVVFVDSDSFLEP
FT                   HAIRNLVQPFQDPKMGGVAGRTEVENKFTNALTKLQTVRYYIAFRIMKAAESWFDTVTC
FT                   LSGPLACYRKELILKNETAWLNQKFLGQPATFGDDRSMTNYILKTHRTGYQDNAICSTI
FT                   VPSDTKVFLSQQMRWKRSWLRESLRAFLFMWKKEPFMFLFFIIGLIVPIAAPIVVVYNL
FT                   IYVPIMYGVFPTTFLLGLLLMAMLMSLAHLFFRKSKLWLFGFIFVLYYEFILLWQMPVA
FT                   WVTFWKSTWGTRETPQDVLAKEKKIEKQKLRKSRFSMLKIRKMGEKE"
FT   gene            568635..570386
FT                   /locus_tag="Bsph_0548"
FT   CDS_pept        568635..570386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38173"
FT                   /db_xref="GOA:B1HWL6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL6"
FT                   /protein_id="ACA38173.1"
FT                   /translation="MKEKNVILQPAKKNRRKIIRSIIQLVVVIFLAVVLIKAVFLTDKR
FT                   FAEAVPLNNKDGFIALSYFGVSRNDSSKYVSKKNLEEQLTLLEKQGYQTITQKDILDFY
FT                   QKNKPLPEKALFLSFEDGRTDSSIFAQNVMEKLNYKATMFTYANKMDTRDHKFLKPKDL
FT                   KLMEKSGYWELGSNGYRLTYINIFNDKGQSLGMIDENNIPNKTTIEYYNHYLMDFIRNQ
FT                   YMIPSETRQEMEARIKKDYKLMQEIYQQEFGEVPKAYAIMHANSLYNNMDPLVQSVNDK
FT                   EIKDKFRMHFNLELSAYNDKDSDLYNLNRLQVSPYWSTNHVMMKIKQASNQNIEFKIGD
FT                   PQLAQKWQTINGAAEFDNNEVTLTSAPSSEGRILLKEMMPQQYNVNFTFKGNVVGEQAL
FT                   YVNYDEKTNSYLRIALVDNELVVSEKLPASDIVEKARFPLNEIKWNEEEYAFNKATVYT
FT                   YQDTQKGSRIVEEEYPRNLTKNRVFNITVNKDKIKVDVDHVLSETIQINPGLHGSQIGF
FT                   GALFSHKDTSHEQYADDIYDTIIEDILITDRKDQTIFTNQYTNFEKVKHKSTTLFNHVV
FT                   DFFIETF"
FT   gene            570400..571470
FT                   /locus_tag="Bsph_0549"
FT   CDS_pept        570400..571470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38174"
FT                   /db_xref="GOA:B1HWL7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL7"
FT                   /protein_id="ACA38174.1"
FT                   /translation="MKQVKNFILFICIALLFITACSNSKEPPAIAKEELKDKAKLRLSM
FT                   WLPEWQNQSALEDVQNSQQGLQDMRVFGAYFNHKDELLLTDNAVDMLRQTQQQFNESHH
FT                   VILTLINDYVTDNASSVQKDSTLLHRLVQDSSARKKHINNILQVVEQYQPDGIEIDYEK
FT                   IAKEDLSKYVQFLKELYRELAKKNVTLHVVLEPSFPFDVKLPNGPSYTVMAYNVHGYHS
FT                   GPGAKATFSFLNDLIKNIKKSNQKLAIAFATGGFDWVAQGNTVALTELEAEKVLAETNA
FT                   KKQRDKASGAVYFTYTDTSNMSHEIWYADQETLEKWVKYVQRKSYHDVVLWRAGGLGVK
FT                   TLQWINEQETGERLSP"
FT   gene            complement(571794..572702)
FT                   /gene="gltC"
FT                   /locus_tag="Bsph_0550"
FT   CDS_pept        complement(571794..572702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltC"
FT                   /locus_tag="Bsph_0550"
FT                   /product="GltC"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38175"
FT                   /db_xref="GOA:B1HWL8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL8"
FT                   /protein_id="ACA38175.1"
FT                   /translation="MLVELRQLRYFVEVAEREHISEAAEHLHVAQSAISRQIANLEDEL
FT                   GTPLFERVGRNVKLTPIGKTFLEHTITALKAIDFAAKQVEEYLDPAKGSIKIGFPTSLA
FT                   SYVLPTVISAFKREYPNLQFQLRQGSYRFLIDAVKNRELNLAFLGPLPPKDESIESTIL
FT                   FTENIAALLPANHPLAKRESIQLAELRNDLFVLFPNGYILHKVAMDACRAAGFMPNIIS
FT                   EGEDLDALKGLVAAGIGVSLLPESSLYDSAARFTVKVPIESPSIPRTVGIISPVNREIA
FT                   PSEAIFLNFVKDFFSRLSQFQ"
FT   gene            573178..573996
FT                   /locus_tag="Bsph_0551"
FT   CDS_pept        573178..573996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0551"
FT                   /product="Vegetative protein 296 (VEG296)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38176"
FT                   /db_xref="GOA:B1HWL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWL9"
FT                   /protein_id="ACA38176.1"
FT                   /translation="MVDPFTEHYGGIFMSTLVIKDLHVAIDGKEILKGVNLTINTNEIH
FT                   AIMGPNGTGKSTLASAIMGHPKYEVTSGTVELDGEDVLEMEVDERAQAGLFLAMQYPSE
FT                   IAGVTNADFLRSAINARREEGDEISLMKFIRELDKNMEFLEMNEDMAQRYLNEGFSGGE
FT                   KKRNEILQLMMIKPTFAILDEIDSGLDIDALKVVSKGINAMRGEGFGCLMITHYQRLLN
FT                   YITPDHVHVMMQGRVVKSGGAELAQRLEAEGYDWIKKELGIEEETEEQEA"
FT   gene            574015..575322
FT                   /locus_tag="Bsph_0552"
FT   CDS_pept        574015..575322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0552"
FT                   /product="UPF0051 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38177"
FT                   /db_xref="GOA:B1HWM0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM0"
FT                   /protein_id="ACA38177.1"
FT                   /translation="MTVELNLPVTVQDVRSFSEANGEPTWFTELRAAALDKVTGLDLPK
FT                   PDRTNITKWDFMNFPAFTVHSEAFPSLDALPEEAKGLIDLEAQENLYIQRNNTPAYIKI
FT                   SQELVDKGVVFTDIFTAVREHGELVQKYFMTEAVKVDEHKLTALHTALVNGGVFVYVPK
FT                   NVVIEQPLQVVFLNDNAEASLYNHVLVVAEANSAVTYVETYVSTVEQAKGQANIIAEVV
FT                   VQDNAQVTYGAVDVLAKGFTTYVNRRARLARDAKVDWALGLMNDSDTISENITHLIGDG
FT                   SHADTKTVVVGRGEQKLNFTTEVRHWGKNSNGHILKHGVMKDAAQSIFNGIGYIEHGAT
FT                   KADAQQESRVLMLSEKARGDANPILLIDEDDVTAGHAASVGRVDPLQLYYLMSRGISKA
FT                   EAERLVIHGFLAPVVTQLPIEGVQKQLTEVIERKVR"
FT   gene            575322..576551
FT                   /locus_tag="Bsph_0553"
FT   CDS_pept        575322..576551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0553"
FT                   /product="Probable cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38178"
FT                   /db_xref="GOA:B1HWM1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM1"
FT                   /protein_id="ACA38178.1"
FT                   /translation="MMNKDIKSYFPILNQDVNGHRLVYLDSAATSQKPVQVIEAIKAYY
FT                   EFDNSNVHRGVHTLGNRATDKYEGAREKVRKFINAQSTQEIIFTRGTTTSLNTVAASYG
FT                   RANVAEGDEIVITQMEHHSNIIPWQQLAKEKKATLKYIELEADGTISLEKVRATITPQT
FT                   KIVSVSMASNVLGTINPIKEIAQIAHANGAVMVVDGAQAAPHMKIDVQELDVDFLGFSG
FT                   HKMCGPTGIGVLYGKKEHLEKMEPIEFGGEMIDFVGLYDSTWKELPWKFEGGTPIIAGA
FT                   IGLGAAIDFLTEIGLDNIAEHEHKLVGYAMDQLETIDGLKIFGPRDPMKRCGLVTFNLD
FT                   DVHPHDVATVLDMNGIAVRAGHHCAQPLMKCLQQVATARASFYLYNTEEDIDRLVAGLR
FT                   SAKEYFGDVF"
FT   gene            576541..576966
FT                   /locus_tag="Bsph_0554"
FT   CDS_pept        576541..576966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0554"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38179"
FT                   /db_xref="GOA:B1HWM2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM2"
FT                   /protein_id="ACA38179.1"
FT                   /translation="MSFNNLDQLYRSVIMDHYKNPRNKGSLEGEAVTIDMNNPTCGDRI
FT                   HLTLKVTDGVVEDAKFEGEGCSISMSSASMMTQLIKGKKVDEALELADIFSKMMMGEEY
FT                   SDKYDLEDVEALQGVSQFPARIKCATLAWKAMEKGVK"
FT   gene            577047..578462
FT                   /locus_tag="Bsph_0555"
FT   CDS_pept        577047..578462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0555"
FT                   /product="yurU; ABC transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38180"
FT                   /db_xref="GOA:B1HWM3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM3"
FT                   /protein_id="ACA38180.1"
FT                   /translation="MNGGETMAKKMPDIGDYKYGFHDKDVSIFRSKRGLTEEIVREISN
FT                   MKQEPEWMLEYRLKALETFYTKPMPQWGGDLGDLDFDEITYYVKPSEATQKSWDEVPDE
FT                   IKATFDKLGIPEAEQKYLAGVSAQYESEVVYHNMKQDLEDLGIVFKDTDSALRENEDIF
FT                   KQYWGKVIPYTDNKFAALNSAVWSGGSFIYVPPGVKVETPLQAYFRINSENMGQFERTL
FT                   IIVDEGAHVHYVEGCTAPVYTTNSLHSAVVEIVVRKDAYCRYTTIQNWANNVYNLVTKR
FT                   TVVEENGTMEWIDGNIGSKLTMKYPACILKGEGARGMTLSIALAGKGQHQHAGAKMIHM
FT                   APNTSSTIVSKSIAKQGGKVTYMGQVRFGPKASGARANIECDTLIMDNQSTSDTIPYNE
FT                   ILNDNVSLEHEAKVSKVSEEQLFYLMSRGISEEEATEMIVMGFIEPFTKELPMEYAVEM
FT                   NRLIKFEMEGSIG"
FT   gene            578652..579620
FT                   /gene="feuA"
FT                   /locus_tag="Bsph_0556"
FT   CDS_pept        578652..579620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuA"
FT                   /locus_tag="Bsph_0556"
FT                   /product="iron-uptake system (binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38181"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM4"
FT                   /protein_id="ACA38181.1"
FT                   /translation="MIAVFMLSLAACGEKKTTEEDRSTESMKEEVAQTQDSTTNENLTR
FT                   TIDYLGESYEVPEKVERIVVTGAMEAMEDMVVLDVHPVGAIAVGGKFPELYAAVTDKAE
FT                   SIGEKIKPNFEKILELDPDVILGSTKFPEEVQSKLEKIAPTILVSHISTNWESNLNLLA
FT                   ELTGKQAEAEKILSTYKADIEAAKSSLTKKLEDKKVAAIRIRRGQAYVYPKEVFLNPVL
FT                   YGELGLEVPAEIAKATSQEAISVEQLADMNPDFLFVQFSTDENADAPNALEDFKQNPII
FT                   QNINAFKNEQVFVNVVDPLMEGGPAFSRITFLEAIQQNLDK"
FT   gene            579755..580612
FT                   /locus_tag="Bsph_0557"
FT   CDS_pept        579755..580612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38182"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM5"
FT                   /protein_id="ACA38182.1"
FT                   /translation="MIVVGLTGWGDHPSLYSGVTSSKDKLFDYTGHFLAVEVDTSFYAI
FT                   PSKDNVRKWCENTPENFRFVVKAYQGMTGHLRGDIPFESKNDMFNAFIECAQEFKRFGK
FT                   LGMILAQFPPWFDCQSKNVQYLLYIRQQLKDFQVAIEFRNQTWYADNVVQQTMDFLREH
FT                   QFIHTICDEPQAGVGSVPFYPVVTADKALVRIHGRNIHGWRNTGNAENWRKVRFLYDYN
FT                   KEELQQLGQQILKLEPEVQELFILFNNNSGNHAAKNAKELQGVLNIKDVGLAPKQLNMF
FT                   EGEL"
FT   gene            580612..581436
FT                   /locus_tag="Bsph_0558"
FT   CDS_pept        580612..581436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38183"
FT                   /db_xref="GOA:B1HWM6"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM6"
FT                   /protein_id="ACA38183.1"
FT                   /translation="MAFILLVIIALFSGLLGSLVGLGGGVVLVPATLYIGLNLGMIPDI
FT                   TPQKVVGLSVVMMIFTGLASTLSYMKSKTVDYKTGYIFFIGSIPGSILGAWVNKGLDLP
FT                   SFNLYFGILLIILSIILLVRDKLKPVEWFVKNGLQQEFTDAQGKTFVYGYPIWFAILFT
FT                   FGVGFASGLFGIGGGSMIVPAMIILFLFPPHVAIATSMFLVFLTSVVNTASHIYLGHVP
FT                   WLYTIPVIPGAYIGAKLGAALNKKIKSDTLVLVLRIILLLLGIRSIVEGILA"
FT   gene            581463..582836
FT                   /locus_tag="Bsph_0559"
FT   CDS_pept        581463..582836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38184"
FT                   /db_xref="GOA:B1HWM7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011240"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM7"
FT                   /protein_id="ACA38184.1"
FT                   /translation="MALMLEKIHIFHTNDLHSHFKYWPRMQSYVKEKRSSLAKIGETSY
FT                   LFDVGDHLDRSNIYTEATIGKGNVQLLNEAAYDVVTIGNNEGITLSHDELFHLYDDANF
FT                   DVVVGNIDAYQGRNPAWLKPYVVLTTEKGTKLGIIAATAMFEVYYQALNWQMVEARSTL
FT                   LRLAHQLRKEVDIVLCLSHLGITEDELLAEECPEIDVIFGSHTHHVLPEGKLVNGVLLT
FT                   GGGKFGQYTGHLVIEYDKKMRKIVEKKDALIHNKDLPNIQNEQQIVQSLEDEGIRILDT
FT                   PVFTTKKSYNKEWFHYSQLSDLFAHAILEKSGADCALFNAGIFLDGLPKGTVTALDLHR
FT                   IFPHPINLCTIELSVMEMKEIYMQSKNEEWPYIELKGLGFRGVIFGKMLTYGFSMNDNR
FT                   QLLINGNLADDNHIYKLVTLDLFTFGYFYPSFKYAKKQYILPEFLRNIMIDYGQSFFK"
FT   gene            582873..583982
FT                   /gene="rpfG"
FT                   /locus_tag="Bsph_0560"
FT   CDS_pept        582873..583982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpfG"
FT                   /locus_tag="Bsph_0560"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38185"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM8"
FT                   /protein_id="ACA38185.1"
FT                   /translation="MRLISIDVLKEGMVLGRTIWNEAGHPLLKKDVIINDRIIQRLQQL
FT                   NTHYLYIDDDISEGIEVEETVPPAMRNKVITTIKDSFQSIDGLNSVNASYILDQQSKTI
FT                   VSIVDELLSAVTGNDEILTILTDAYLFDEYLYQHSFQVTLYSIAIAKELGYSAEDLRLV
FT                   GIGALLHDVGKLMVPKDILTKPGRLTNEEFEAMKMHARYGFDLLRNLHSISLLVAHCAF
FT                   QHHERIDGSGYPRGLVDFEIHPFAKIIGVADVFDAVTTNRVYREKMLPSQGLAIVEAGS
FT                   GTLYDARIVNALKRAVVHYPNGVILKLSDGRRGIVSRQNPLDAALPWIRIFEEQNQLLA
FT                   ATYEINLVDFPSILIENVETDYMVPAKVE"
FT   gene            584006..584803
FT                   /locus_tag="Bsph_0561"
FT   CDS_pept        584006..584803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0561"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38186"
FT                   /db_xref="GOA:B1HWM9"
FT                   /db_xref="InterPro:IPR014197"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWM9"
FT                   /protein_id="ACA38186.1"
FT                   /translation="MEQEEIFLFFPRKRMKLRSYHKRGIRLNRLTILIVSMVVCLILFI
FT                   YYLNERLMPTYLQYAEVQTTKIASYVVSKAINSRTSNVLDVNDIIEDIPPGSSDMMTTK
FT                   FNTEIINRVRAETLELVKMYLEQAEQGELSHLPELDNVEYDINRIQEGDGIVFFVPLGQ
FT                   AANIPLLGNLGPKIPIRFHVIGNVHSNVTSSIQEFGINSAYVEVGIHLEVNVQIIVPFA
FT                   SKSSTVAQDIPVAMGLTRGPVPNIYTNSSDAPQPSIEIPVPFK"
FT   gene            584880..585827
FT                   /locus_tag="Bsph_0562"
FT   CDS_pept        584880..585827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0562"
FT                   /product="Lipoyl synthase"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38187"
FT                   /db_xref="GOA:B1HWN0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN0"
FT                   /protein_id="ACA38187.1"
FT                   /translation="MHIFDRGDIRMTSCKPTSKEEHLRKPDWLKIKLNTNDEYKGLKKL
FT                   MREKNLHTVCEEARCPNIHECWGERRTATMMILGSVCTRACRFCAVKTGLPNELDLAEP
FT                   ERVADSVAIMNLKHVVITMVARDDLKDGGAEVLAETVRAIRRKSPFTSVEVLPSDLGGM
FT                   KENLQMLMDAKPDILNHNIETVRRLTPRVRARAKYERSLEFLRLAKEMQPEIPTKSSLM
FT                   IGLGETHEEILEVMDDLRANNVDIMTIGQYLQPTKKHLPVKKYYSPIEFGKLRKIAMEK
FT                   GFKHCEAGPLVRSSYHADEQVNAATKERQLQAEL"
FT   gene            585860..586138
FT                   /locus_tag="Bsph_0563"
FT   CDS_pept        585860..586138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38188"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN1"
FT                   /protein_id="ACA38188.1"
FT                   /translation="MIIVEGLEYELLEDFREAFQEEVFQERYSDILARYDYIVGDWGYN
FT                   QLRLKGFFDDKNQKSTFDTKISTLQDYLYEYCNFGCAYLSYVKQGKL"
FT   gene            complement(586371..586948)
FT                   /pseudo
FT                   /locus_tag="Bsph_0564"
FT                   /note="This region contains a gene with one or more
FT                   premature stops or frameshifts, and is not the result of a
FT                   sequencing artifact; transposase; identified by sequence
FT                   similarity; putative"
FT   gene            587205..587732
FT                   /locus_tag="Bsph_0566"
FT   CDS_pept        587205..587732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0566"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38189"
FT                   /db_xref="GOA:B1HWN2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN2"
FT                   /protein_id="ACA38189.1"
FT                   /translation="MKRAVFLDRDGVINEVLTKRVKFVNKPRDLYFLPQVPEAIRKLNK
FT                   HFDYIFVVTNQGGVGLGFMSESGLQKIHEHMVKELKKKGAIIHEVVYCPHKPKSGCACR
FT                   KPNSKLIIDLGKKYNIDLSKSYMVGDTDTDIIAGKQAGTKGVFLGEDDPLADAIFPDLM
FT                   RAARWIIKDATA"
FT   gene            587783..587977
FT                   /locus_tag="Bsph_0567"
FT   CDS_pept        587783..587977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38190"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN3"
FT                   /protein_id="ACA38190.1"
FT                   /translation="MEVMMLTKDKRNKKHLDREEYGYGFDISVDDLGVIGQNNEAKKQN
FT                   DNENKDKPHNKDNPSTLNK"
FT   gene            complement(588106..588372)
FT                   /locus_tag="Bsph_0568"
FT   CDS_pept        complement(588106..588372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38191"
FT                   /db_xref="InterPro:IPR021415"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN4"
FT                   /protein_id="ACA38191.1"
FT                   /translation="MERFFLYDDVEDTKTRFVSFAGKKLRYDLAILQSGRFFGKVLVMD
FT                   IQFGRFAIIGPDDVEEPGYLEHVYNRTEDETEELREYLRELLN"
FT   gene            588446..588913
FT                   /locus_tag="Bsph_0569"
FT   CDS_pept        588446..588913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0569"
FT                   /product="Hypothetical yutE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38192"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN5"
FT                   /protein_id="ACA38192.1"
FT                   /translation="MGAFLVYFVDRNKITKNLQYLDGLLAILETENNWSQNDIKKLAIE
FT                   RIGHNIMESMMDVGNLMIDGFIMRDPGSYEDIIDILIDEKVVVAEMEAPYKAVVGLRKM
FT                   LVREFIEVDIDEVIHVLTANLSALKQFSPAVHHYLTNELGPVSAFLPEDHQ"
FT   gene            588910..589662
FT                   /locus_tag="Bsph_0570"
FT   CDS_pept        588910..589662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0570"
FT                   /product="NagD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38193"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN6"
FT                   /protein_id="ACA38193.1"
FT                   /translation="MRAYKAYCFDLDGTVYRGKEGIPSAIAFIHRLQQAGIEPFYVTNN
FT                   SSKTREQLQDALLSIGIRAPLEHIYSSASVTAKYVALHYAGKKVAMMGSDGIRQALLSE
FT                   NIVPVEDEADVFVMGIDRTLDYMALARAAIFVQKGAIFIATNQDIKFPTEYGFLPGNGS
FT                   FARLVGEVAGVDPIYIGKPSPAILEVIATEHNFSKEDMVMIGDNYDTDIMCGINFGCDT
FT                   IHVNTGVTPTKVVQEKVLQPTYVVDALQ"
FT   gene            complement(589744..589989)
FT                   /gene="yuzB"
FT                   /locus_tag="Bsph_0571"
FT   CDS_pept        complement(589744..589989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yuzB"
FT                   /locus_tag="Bsph_0571"
FT                   /product="UPF0349 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38194"
FT                   /db_xref="InterPro:IPR009910"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN7"
FT                   /protein_id="ACA38194.1"
FT                   /translation="MTWMNPMVEFCISNLANGSQATYEVLERDPNIDVLEYGCLSYCTK
FT                   CSESFYAIVNGELVEADSPEALTKAIYQFIEENPLW"
FT   gene            590250..590393
FT                   /locus_tag="Bsph_0572"
FT   CDS_pept        590250..590393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38195"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN8"
FT                   /protein_id="ACA38195.1"
FT                   /translation="MGKLVLLGGGYGNMRVMLRLLNNLPLDREVVIVDRAPFHSLKTEF
FT                   MR"
FT   gene            590618..591313
FT                   /gene="yutJ"
FT                   /locus_tag="Bsph_0573"
FT   CDS_pept        590618..591313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yutJ"
FT                   /locus_tag="Bsph_0573"
FT                   /product="NADH dehydrogenase-like protein"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38196"
FT                   /db_xref="GOA:B1HWN9"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWN9"
FT                   /protein_id="ACA38196.1"
FT                   /translation="MGQSRATLQALCGLPAGSTVGIVGAGLSGIELASELRESRSDLKI
FT                   KLFDRGPRILKDFPEKLSKYVKDWFVKHNVDVIANSNITKVEQGKIFNHEEEILLDKVV
FT                   WTAGVQPVKIVRDMDVEKDKHGRPLVTQYFNVLDDEHVYIVGDCASSDLPPTAQLAEEQ
FT                   AELIVKVLRMRWKGEQLPEKMPEIKLKGFMGALGKKQGFVYLADTTVTGRIARLMKSGL
FT                   LWYYKRQND"
FT   gene            complement(591360..591695)
FT                   /locus_tag="Bsph_0574"
FT   CDS_pept        complement(591360..591695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38197"
FT                   /db_xref="InterPro:IPR009190"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038218"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP0"
FT                   /protein_id="ACA38197.1"
FT                   /translation="MQPTKPMIEIYGTAVICASCVNAPSSKDTYEWLQSAIDRKYPDQQ
FT                   YDIRYIDIEGPIENERDQDYATRIQEDEFFYPLVLINNEVVGEGYVQLKPVFTALEGLG
FT                   FVPDETV"
FT   gene            591780..592016
FT                   /locus_tag="Bsph_0575"
FT   CDS_pept        591780..592016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0575"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38198"
FT                   /db_xref="GOA:B1HWP1"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP1"
FT                   /protein_id="ACA38198.1"
FT                   /translation="MAEATINDQVQEVLDKLRPFLLRDGGDCELVDVEDGVVKLRLLGA
FT                   CGSCPSSTITLKAGIERALLEEVPGIVEVEQVF"
FT   gene            complement(592064..592756)
FT                   /locus_tag="Bsph_0576"
FT   CDS_pept        complement(592064..592756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38199"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP2"
FT                   /protein_id="ACA38199.1"
FT                   /translation="MDISPYYEKQIQCLNCKKDFPTLKVRSKFIKVEHTETDFHPIYTD
FT                   DVNALYYNVFVCEHCGFSFTEDFTKYFAPGIQDEIHTQITKKWVHHDFKGERTVFQAIQ
FT                   AYKLAFLCGTIKKEKHVAIAGLALRLAWLYRSLKNSGQEERFMKLARDHYMESYSTEDY
FT                   SSTQMSAVRIMYMIAELSRRIGDIENATRFFSRVIEKQSSGGEAKIVDMAKEQWAIIRE
FT                   EKEHARHI"
FT   gene            592934..593317
FT                   /locus_tag="Bsph_0577"
FT   CDS_pept        592934..593317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0577"
FT                   /product="Hypothetical yutM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38200"
FT                   /db_xref="GOA:B1HWP3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP3"
FT                   /protein_id="ACA38200.1"
FT                   /translation="MMGMTSTKQVIEITQAAGFHINEMMEHNEEQGSFLRVVVNGGGCS
FT                   GLSYGMHFDQEKKEDDFVDVQHGLTILVSREDAPILMGTKIDYKQSLMGGGFTIDNPNA
FT                   IASCGCGTSFKTAKREGTPEICE"
FT   gene            complement(593558..594103)
FT                   /locus_tag="Bsph_0578"
FT   CDS_pept        complement(593558..594103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0578"
FT                   /product="Hypothetical yyaR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38201"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR008125"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP4"
FT                   /protein_id="ACA38201.1"
FT                   /translation="MNTERESKMIIKMTSSNMKDYNKSNHGFIVSGKIIPTYKNKVWTF
FT                   TEEIGTEPFFKKYEDDEIDLSYINDMEKAVFFYYIESNCVGQIKLCSNWNGYALIEDIA
FT                   VAKDYRKDGIGTALIKKAIEWAKERNYCGLMLETQDINVSACHFYAKNQFVIGAVDTML
FT                   YSNFPTANEIAIFWYYRF"
FT   gene            complement(594239..594652)
FT                   /locus_tag="Bsph_0579"
FT   CDS_pept        complement(594239..594652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38202"
FT                   /db_xref="GOA:B1HWP5"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP5"
FT                   /protein_id="ACA38202.1"
FT                   /translation="MTPPSNFIMLLIALGLIFLVLLVLGLKRNTKIYILACVIILGSIV
FT                   LGYYSLLSYSAIKKEEIVYQQYHHQTIYKWQDIKEVTYEYEIGTVGTYFFLTTNNEQFM
FT                   IVENGQFGLDEKRAIYKLAVLNGVKFTEREKLD"
FT   gene            594968..595465
FT                   /locus_tag="Bsph_0580"
FT   CDS_pept        594968..595465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0580"
FT                   /product="MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38203"
FT                   /db_xref="GOA:B1HWP6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP6"
FT                   /protein_id="ACA38203.1"
FT                   /translation="MRKDRGKIWLGVSGVTVNELGPWLVVKKAYSGLKGRWSLPAGFVN
FT                   AGETVDEAVIREIKEETGIDCSVSGLIGFRTGVIRDDISDNMAIFYCRMLDEQQQVCIQ
FT                   EKEILEAKWLYPQELAQDEATSVMLKEMATNQFQKHQLEAIEGINPGDIFGYTSYRLFF
FT                   KK"
FT   gene            595487..595780
FT                   /locus_tag="Bsph_0581"
FT   CDS_pept        595487..595780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0581"
FT                   /product="GAF:ATP-binding region, ATPase-like:Histidine
FT                   kinase internal region:5TM Receptors of the LytS-YhcK type,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38204"
FT                   /db_xref="GOA:B1HWP7"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP7"
FT                   /protein_id="ACA38204.1"
FT                   /translation="MMELFLFMLERVGLIIVFAFLMSRWRLFREKLFQEQGTKEKIWLI
FT                   ITFSSLCIISSYTGIKIESGTIHPLNQMIHSTITAEEAMANTRLIGVAIAGI"
FT   gene            595987..597237
FT                   /gene="lytS"
FT                   /locus_tag="Bsph_0582"
FT   CDS_pept        595987..597237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytS"
FT                   /locus_tag="Bsph_0582"
FT                   /product="Sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38205"
FT                   /db_xref="GOA:B1HWP8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP8"
FT                   /protein_id="ACA38205.1"
FT                   /translation="MILAVAKPFEQALQLVTLIAMPMILMNAFGIFLFFMIIKTFIDEE
FT                   ERTKALQTHQAFSIAQQTIEHFRKGLNEESCQTVAEIIKREIKVEAVAITDKNGVLAHV
FT                   GVGEDHHLIHREIMTALTKRVLEEGKILMATSATEIQCPHEDCPLSAAIVLPLMVQHRT
FT                   VGSLKLYFTKADSLTGVQKELAEGLSRLFSSQLEYAEIEQQRKLLKDAEIKALQAQVHP
FT                   HFFFNSLNTISSLIRTDADEARALLIKLSTFFRSNLQGARQMLIPLKNEIDHVEAYLSI
FT                   EQTRFPNRYEVEFFMDESLFDVQIPPFTLQPLVENAIYHAFKNRKEGKIFVQVQRVNDK
FT                   LVLLTEDNGCGMRKEQVKQLGKRIMQSEQGTGTALWNIYQRIHEIYGTEADFHITSTLD
FT                   VGTKIMIQLPLKATRWE"
FT   gene            597244..597987
FT                   /gene="lytT"
FT                   /locus_tag="Bsph_0583"
FT   CDS_pept        597244..597987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytT"
FT                   /locus_tag="Bsph_0583"
FT                   /product="Sensory transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38206"
FT                   /db_xref="GOA:B1HWP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWP9"
FT                   /protein_id="ACA38206.1"
FT                   /translation="MNVYIVDDEPLARAELRYLLEQTALVNICGESESLDEFYHTTQYE
FT                   QVDCLFLDIELGMNNGLDLAKQLLLHEQKPEIIFATAFDEYALQAFEVNAFDYILKPFE
FT                   AQRVQAAVEKLVAKRRAAQVKTIEEIKVSQLDKLDKLTVYVNDRILLMKIQDILYCTSE
FT                   DSKTVVVTEQGRFFASESLAALEKKLTLKGFVRVHRAFIVNLEHIVELEPWSSSKYNLI
FT                   LYNRHSIPVSRLYMKDVRKIFDLSR"
FT   gene            598148..599899
FT                   /locus_tag="Bsph_0584"
FT   CDS_pept        598148..599899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0584"
FT                   /product="Carbon starvation protein A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38207"
FT                   /db_xref="GOA:B1HWQ0"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWQ0"
FT                   /protein_id="ACA38207.1"
FT                   /translation="MISYRLYGIFFTKKVLKIKDDTPTPAHALEDGKDYVPTNKWVTFG
FT                   HHFAAIAAAGPLVGPILAAQFGYLPGLLWLLIGAVIGGAVHDAVVLFASMRHGGKSLSE
FT                   VMKEELGPIAGFCTGLAMLFIITITMAGLSMVVLGALERNPWGTFAVGITIPIAMLVGI
FT                   AYRKTGNLLATSAVGFILLMIGVFIGPLIQGTAFGDFLTFDRDTLAIILPIYAFFAAAL
FT                   PVWLLLAPRDYLSSFMKIGVFIALIIGVFFVNPAIQFPPFTEFIHGGGPVIAGPVWPFV
FT                   SITIACGAISGFHAFVGSGTTPKMIDRWEDIRIVGFGAMLVESLVGVMALIAATALHPA
FT                   DYFAINSAPAVFATLGMEPVHLQALSQSIGMDLEGRTGGAVTLAVGMTDIFTGIPWFAE
FT                   LSSYFYQFVIMFEAVFILTAIDAGTRVARYLIQDFGGNVYKPLKRTNWIPGTIFASALA
FT                   CFMWGYLLYSGDISSIWVLFGVSNQLMAAIGLVCGVTMVLKVADKRIYALTCFIPLTYL
FT                   YITVNVAGYWMIKNVYWNPAAAGFNMLNGILSVIMLMLGLLIVISAFKKWAQLWKSQKF
FT                   VLTQSTS"
FT   gene            600102..600431
FT                   /locus_tag="Bsph_0585"
FT   CDS_pept        600102..600431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38208"
FT                   /db_xref="GOA:B1HWQ1"
FT                   /db_xref="InterPro:IPR025917"
FT                   /db_xref="UniProtKB/TrEMBL:B1HWQ1"
FT                   /protein_id="ACA38208.1"
FT                   /translation="MDGPVSLVQLIISILLFFVMFFGIGFLLNMLLRMTWLMAIVYPIV
FT                   VIFIVDEVSFLDYIFKPGSAFPALIDKLQALQFVDIAILSGGLAGSIVAGIVMIYLRKS
FT                   GYRMF"
FT   gene            complement(600529..601014)
FT                   /locus_tag="Bsph_0586"
FT   CDS_pept        complement(600529..601014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38209"
FT                   /db_xref="GOA:B1HXB4"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXB4"
FT                   /protein_id="ACA38209.1"
FT                   /translation="MMNMSLLQNTPLLIALFSVIFAQFVKIPIHFLMTRQVKWSLFTST
FT                   GGMPSSHSASVTGLATSIAYETGLASPIFAVAAMFSIIVMYDASGVRYQAGQHAAILNQ
FT                   LRKDFQTLLHDLKKWPQMDGQEKMEELKTLLGHKRSEVFFGALTGIFIAIITYEFFI"
FT   gene            601193..602644
FT                   /locus_tag="Bsph_0587"
FT   CDS_pept        601193..602644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0587"
FT                   /product="Probable cytosol aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38210"
FT                   /db_xref="GOA:B1HXB5"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXB5"
FT                   /protein_id="ACA38210.1"
FT                   /translation="MGVTKHREQMQNWTSFSSFYGESLDMWVSAGDVSTELKKLTKLPF
FT                   VKEHANLKRILFVGLDERKNLTEGDVRAAFGLVGKELRALKVKEYSIWLESFTTETISV
FT                   TDVAFLAGEGIGLGYYSIPHYKTTSNEVDKRIEAVHLVTTAGDLDEVVAGFEVGVIYAD
FT                   AVNEARSLINLPPNLLTATDLANYAESLASEYNFEVEILGKAQLEELGMGGILSVNQGS
FT                   YEEPRLITLKYKATDDFENPIGLVGKGVTYDTGGYSLKPKDSMVGMKGDMGGAAAVLGA
FT                   MKIIGELRPNKNVVAVIGSTDNMVSDTAFKPDDVITTYSGKTVEVLNTDAEGRLVLADA
FT                   TTYAKQQGAASLIDVATLTGGVITALGMDKTGALSNDDEFFAAFMEAAGETDEFVWRMP
FT                   LTESDKKRIRKSDVADLNNSPGRDGHMIFGGGFVGEFVGETPWIHLDIAGTSDAVAAHD
FT                   LGPKGGTGVMVRTLANFVQRLGEEK"
FT   gene            602779..602982
FT                   /locus_tag="Bsph_0588"
FT   CDS_pept        602779..602982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38211"
FT                   /db_xref="GOA:B1HXB6"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXB6"
FT                   /protein_id="ACA38211.1"
FT                   /translation="MRNFGGYPGGGFGGFIWPFGAPFFGGFLGSFLGSQFNQYPYNPYY
FT                   PNYRPYPPGPFYRPGPRYRRPW"
FT   gene            603378..604151
FT                   /locus_tag="Bsph_0589"
FT   CDS_pept        603378..604151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0589"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38212"
FT                   /db_xref="GOA:B1HXB7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXB7"
FT                   /protein_id="ACA38212.1"
FT                   /translation="MGKVYIVGAGPGDVDLITVKGLRCIECADVILYDRLINKELLNYA
FT                   KQDAQLIFCGKLPQQHAMIQEHINQTLVSYAQQGLIVTRLKGGDPFVFGRGAEEAEVLV
FT                   KHHIPFEIVPGITSGIAAPAYAGIPVTHRDLGSSFAMVTGHMQEGKDDAIRWESLAKGI
FT                   DTIAIYMGVGNLPYIRQQLLQYGRGEETPVAVIHWGTFTAKQKTVTGTLATIEEIVQTE
FT                   NIQNPSIILVGEVVRLRETIQWFEHNGPQPIQVTG"
FT   gene            604164..604904
FT                   /locus_tag="Bsph_0590"
FT   CDS_pept        604164..604904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0590"
FT                   /product="Sirohydrochlorin ferrochelatase"
FT                   /EC_number="4.99.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38213"
FT                   /db_xref="GOA:B1HXB8"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXB8"
FT                   /protein_id="ACA38213.1"
FT                   /translation="MQAILYIAHGSRVKAGVDQAVAFLQGVQQEVQVSIQEICFLELAT
FT                   PTIGEGIANCVRQGATRIAIVPILLLAAQHAKEDIPIEIAKAQKLFPHILFSYGEPLGI
FT                   HERIIDSLQARILEKQQPKHEASVLLIGRGSSDPAVKRDLAEIAARLRMKYNYQTVDTC
FT                   FLYGMGPSFDDWLQQEKERQHQVFIVPYLLFTGILRQSIAKRLQGLSNNNMVLCESLGY
FT                   DVNVKKVLVERINELLHFKEEGVS"
FT   gene            604904..605053
FT                   /locus_tag="Bsph_0591"
FT   CDS_pept        604904..605053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38214"
FT                   /db_xref="InterPro:IPR018743"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXB9"
FT                   /protein_id="ACA38214.1"
FT                   /translation="MVDKRLENVNLALDNVRQMLNTVNHGSITLIVQNSYVVQIEKKEK
FT                   IRLR"
FT   gene            605099..606883
FT                   /locus_tag="Bsph_0592"
FT   CDS_pept        605099..606883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0592"
FT                   /product="Sulfite reductase [NADPH] flavoprotein
FT                   alpha-component"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38215"
FT                   /db_xref="GOA:B1HXC0"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC0"
FT                   /protein_id="ACA38215.1"
FT                   /translation="MKLQVINSPFNEEQVKLLNELLPQLTLEQKIWLNGYLSAAQATQE
FT                   PIVVTAPATTQSITKTMTILYGSQTGNSQGLAEKYASLLEAQNVDVTVSSLGKFKASNL
FT                   KKITNLLLIVSTHGEGDPPDQAIQFYEFLHSKRAPKLEHLQYSVLALGDSSYEFFCKTG
FT                   KDFDEQFAKLGATRMVPRTDCDVDYDDAAAQWFSAVQQEFLKQATAISVTSTESDEILG
FT                   ATTYSRKNPFYAEVLENINLNGRGSNKETRHLELSIEGANFQFEPGDSIGIQPENSELL
FT                   VDALLGALQFDPATEVTVFDEILSLKNALQKRLEITVLSKPVLEKIKAYTEHNEFSRLL
FT                   EEPNAWKDYAKGRDLLDVVEDFAPFTWSAQQFVDILRKIPSRLYSIASSQLANNDEVHL
FT                   TISKVSYETNGRQRLGVCSGSVADLQIGDTLPIYVHKNPNFRLPEQKETPIIMIGAGTG
FT                   IAPYRAFLEEREELGVVGKAWLIFGDQHFVTDFLYQTDWQRWLASGTLSQMHIAFSRDT
FT                   DKKIYVQHKIEENAANFYEWLEQGAVIYVCGDEKSMAADVDATIHRIIEQQGQKSSEQA
FT                   KAFVQELKQQKRYQRDVY"
FT   gene            606971..608689
FT                   /locus_tag="Bsph_0593"
FT   CDS_pept        606971..608689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0593"
FT                   /product="Sulfite reductase [NADPH] hemoprotein
FT                   beta-component"
FT                   /EC_number="1.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38216"
FT                   /db_xref="GOA:B1HXC1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HXC1"
FT                   /protein_id="ACA38216.1"
FT                   /translation="MTEKIVLPPQSGKPSDVERIKTESNYLRGTLERTMNDPLSSGIPE
FT                   DDNRLMKFHGSYLQDDRDLRNERQRQKLEPAYQFMVRVRTPGGAATPAQWLVMDEMARK
FT                   YGNGSLKLTTRQAFQVHGILKWNVKKYMQEINEVLLDSLAACGDVNRNVMCNVNPNQSA
FT                   LHEEVYNWSAKLSEHLLPRTRAYHELWLDGEKVIDSQDDEIEPIYGAQYLPRKFKIAIA
FT                   IPPSNDVDVFSQDIGLIAIVEDEKLIGFNVAVGGGMGMTHGDHATYPQLAREIGFITPD
FT                   KLLETAEKIITIQRDYGNRSVRKNARFKYTIDARGLEWFNEELTRRLGWSIQEARPYTF
FT                   ERTGDEFGWIKGAEGKWHYTLFIQNGRIKDFQDYKLLTGLREIAKVHTGDFRLTPNQNL
FT                   MISNVTPQKKKKIAAIIEQYKLTDGAHYSALRRNSIACVSLPTCGLAMAEAERYLPSLI
FT                   TKIETIIDETGLNDTEIVIRMSGCPNGCSRAAMAEIGFIGKGPGKYNLYLGASFTGNRL
FT                   NKIYRENIGEEEILAELRPILVHYAKERLVGEHFGDFVIRAGYVTAVYDGREFHV"
FT   gene            complement(608730..609800)
FT                   /gene="cysA"
FT                   /locus_tag="Bsph_0594"
FT   CDS_pept        complement(608730..609800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="Bsph_0594"
FT                   /product="Sulfate/thiosulfate import ATP-binding protein"
FT                   /EC_number="3.6.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38217"
FT                   /db_xref="GOA:B1HXC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC2"
FT                   /protein_id="ACA38217.1"
FT                   /translation="MSIQIQNVSKIYGSFQALEDISIHIQSGELVALLGPSGSGKTSLL
FT                   RVIAGLETTDTGDIFFDGHSMTDRHPKERNVGFVFQHYALFRHMTVFENVAYGLKVRPR
FT                   KTRPTKQEIRDKVMELLPLVKLENFSDRYPTQLSGGQRQRVALARALAVEPKVLLLDEP
FT                   FGALDAKVRKELRRWLRKLHDEFHITSIFVTHDQEEALDVADRIVVMNNGKIEQIGSPD
FT                   EVYTHPKSPFVYDFLGNVNLFKGRLHNGKLMHGEVALDVPDVQSHSKDNVIGYVRPHDI
FT                   QIEKVNIPGTVPVKINHIHLLGPIVQIELRREDLDEFLEAELSKEQFLHLQLEVGDHIF
FT                   VRPKQLKVFIPEDYSI"
FT   gene            complement(609816..610688)
FT                   /gene="cysW"
FT                   /locus_tag="Bsph_0595"
FT   CDS_pept        complement(609816..610688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="Bsph_0595"
FT                   /product="Sulfate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38218"
FT                   /db_xref="GOA:B1HXC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC3"
FT                   /protein_id="ACA38218.1"
FT                   /translation="MEQSAFIQQASPEKNKVPKSVALQEPRVIRYTLTCIALVFLAFFI
FT                   VLPLASIFITAFQKGVDVYLAAITHPDALAAIKLTLTVVAIAVPLNAIFGVMAAWTLTK
FT                   FNFKGKNLLLTIVDLPFAVSPVIAGLVFILLFGSQGLFGDWLFAKDIKIVFALPGIVLA
FT                   TIFVTLPFVARELIPLMQAQGTSEEEASISLGASGFKTFWYVTLPNIKWGLFYGLILCN
FT                   ARAIGEFGAVSVVSGHIRGMTNTMPLHIEILYNEYQFSAAFAVASLMSVIAIFTLILKD
FT                   IIAWKSKSS"
FT   gene            complement(610699..611532)
FT                   /gene="cysT"
FT                   /locus_tag="Bsph_0596"
FT   CDS_pept        complement(610699..611532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysT"
FT                   /locus_tag="Bsph_0596"
FT                   /product="Sulfate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38219"
FT                   /db_xref="GOA:B1HXC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC4"
FT                   /protein_id="ACA38219.1"
FT                   /translation="MSSLTLTKKSRRIIPGFHLSLGYTMLYVSLLVLLPLSMIFFHTMS
FT                   LSWTVFLDIITDPRAVASYKVSFSTALIAGLLNVLFGTIIAWVLVRYQFPFKRMMDGLV
FT                   DLPFALPTAVAGIALTSLYAPNGWIGQFFDFKIAFTPLGIIIALTFIGLPFVVRTVQPV
FT                   LQNISAEVEEASASLGANRLQTFRKVILPELLPAILTGFSLAFARALGEYGSVVFIAGN
FT                   MPMKTEITPLIIMTKLEQYDYAGATAIAVVMLVTSFILLLTINVIQWLANRRFVH"
FT   gene            complement(611544..612644)
FT                   /locus_tag="Bsph_0597"
FT   CDS_pept        complement(611544..612644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0597"
FT                   /product="Sulfate-binding protein precursor (Sulfate
FT                   starvation-induced protein 2) (SSI2)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38220"
FT                   /db_xref="GOA:B1HXC5"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC5"
FT                   /protein_id="ACA38220.1"
FT                   /translation="MGMAFCILQPERERHRMKKRKNVFQSLALLAVLTLSVTGCSSANS
FT                   NEDTSGQEGNKSVELLNVSYDPTRELYDEFNQDFIKKWKDETGQDVTIKQCHGGSGKQG
FT                   RAVIDGLEADVVTLALAYDIDEIAQTRELLNKDWQTEFDHNSTPYTSTIVFLVRKGNPK
FT                   DIQDWDDLIKKDVSVITPNPKTSGGARWNYLAAWGYAGKLYNNDETKIKEFMKSLYSNV
FT                   EVLDSGARGATTTFVERNIGDVLIAWENEAYLSLHELGKDEFEIITPSLSILAEPPVAI
FT                   VDKIVDKKGTREVAEAYLQHLYSDTGQEIAAKNYYRPRNEAVLAKYKDQFPQLELVSID
FT                   DFGGWTKAQATHFKDGGTFDEIYLPQ"
FT   gene            613051..613752
FT                   /locus_tag="Bsph_0598"
FT   CDS_pept        613051..613752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0598"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38221"
FT                   /db_xref="GOA:B1HXC6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HXC6"
FT                   /protein_id="ACA38221.1"
FT                   /translation="MLTHANWQEPNINFQVDEMYRGALEVLRWSYQEYGNEIVYACSFG
FT                   IEGIVLIDLISKVKPNATIVFLDTDVHFKETYETIRRVKEKYPQLNIVMKKSALTLEQQ
FT                   AAQYGEELWKSDPNQCCAIRKIKPLHEALSGTKAWISGLRREQSPTRQQTNFLNRDDKF
FT                   KSIKVCPLIHWTWKDVWRYVSKNNLPYNPLHDQGYPSIGCEHCTKPAFTMDDLRSGRWQ
FT                   GSGKTECGLHE"
FT   gene            613765..614829
FT                   /locus_tag="Bsph_0599"
FT   CDS_pept        613765..614829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0599"
FT                   /product="Putative phosphate permease"
FT                   /note="similar to Putative phosphate permease AF_1798"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38222"
FT                   /db_xref="GOA:B1HXC7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC7"
FT                   /protein_id="ACA38222.1"
FT                   /translation="MLEYFAIAISLFFAMNIGASGAAASMGVAYGAGAIKKAWQALLLC
FT                   AIGVYSGAVLGGGEVVKTISSGIMPQEYITVKIVIIILISATSSLFFANLLGIPLSTSE
FT                   VTVGAVVGVGIAYKVLFVQSLLVIMSFWVIVPLIAFVMALILGKLLYKLQLRGLLKDHP
FT                   ILTILLVLAGFFEAFSAGMNNVANAVGPLVGAGMMDVTIGIMLGGGFVAAGAILLGKRV
FT                   LETNGKKIMRFQKAEGILISSTGALLVGISSIFGLPVPLTQVTSSSIIGMGMAKNGKQI
FT                   FHKHIVKKIIRIWVVSPIFSLAISYFLVQLFLEKDLYAVIINGSIIVGTLGVISLMRTI
FT                   REEEQSIYDAGEGI"
FT   gene            614908..616047
FT                   /locus_tag="Bsph_0600"
FT   CDS_pept        614908..616047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0600"
FT                   /product="Sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38223"
FT                   /db_xref="GOA:B1HXC8"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1HXC8"
FT                   /protein_id="ACA38223.1"
FT                   /translation="MSLQPHGGFLVQAFHPDKEITSIHKEIELDAISLSDLELIAIGGY
FT                   SPIQGFLTQADYESVVEKSRLVSGIVWSIPITLPVTEEKAATLQPGEEVKLVYQGETFG
FT                   VIQVADIFEPNKRKEALLVYGTEDLAHPGVHKLHERPAIYVGGKITLIKRLAQKFPTYS
FT                   FDPVETRQLFASKGWQTIVGFQTRNPVHRAHEYIQKAALETIDGLFLNPLVGETKSDDV
FT                   SAAIRMESYEILLKNYYPENRVQLGVFPAAMRYAGPREAIFHALVRKNYGCTHFIVGRD
FT                   HAGVGDYYGTYDAQKIFEQFKEDELGIIPLKFEHSFYCQQCEGMATTKTCPHDSSAHII
FT                   LSGTKVREMLRNGEVPPSTFSRKEVVDVLIKGMQKEVVK"
FT   gene            616044..616637
FT                   /locus_tag="Bsph_0601"
FT   CDS_pept        616044..616637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0601"
FT                   /product="Probable adenylyl-sulfate kinase"
FT                   /EC_number="2.7.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38224"
FT                   /db_xref="GOA:B1HXC9"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXC9"
FT                   /protein_id="ACA38224.1"
FT                   /translation="MSSNIVWHEASVTKDERRSQNKHQSFILWFTGLSASGKSSIANAF
FT                   ARQLYERGNQAFVLDGDNVRHGLNKDLGFDESGRKENIRRIGEVSKLFIESGQIVLTAF
FT                   ISPYREDRQVVRELVEDGEFIEVFVKCSVETCEKRDPKGLYKKARKAEIANFTGISAPY
FT                   EEPENPEIILDSEHHTVEECVEQLTSILTAKGYI"
FT   gene            complement(616694..617062)
FT                   /locus_tag="Bsph_0602"
FT   CDS_pept        complement(616694..617062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0602"
FT                   /product="mrpG, yufB; multiple resistance and pH
FT                   homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38225"
FT                   /db_xref="GOA:B1HXD0"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD0"
FT                   /protein_id="ACA38225.1"
FT                   /translation="MTILANSLVIFFISVGVLFIVVTAIGLIRLPDLYTRAHAASKSAT
FT                   LGVMCVLIGVFFHFWLIEDHFNPRILLGILFLFITGPVGGHIMTRSSYIAGVKPWKGTV
FT                   RDELGPEIDRMKKEQDVR"
FT   gene            complement(617046..617327)
FT                   /locus_tag="Bsph_0603"
FT   CDS_pept        complement(617046..617327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0603"
FT                   /product="mrpF, yufC; efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38226"
FT                   /db_xref="GOA:B1HXD1"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD1"
FT                   /protein_id="ACA38226.1"
FT                   /translation="MTTFIIAVIVVICLSMIAVIYRMIKGPSASDRVVALDSLGVSLIS
FT                   LIGLFSILVETSFFLEIILLLAILSFIGTVAFSKFIEKGDIIKRDNSR"
FT   gene            complement(617324..617803)
FT                   /locus_tag="Bsph_0604"
FT   CDS_pept        complement(617324..617803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0604"
FT                   /product="Na(+)/H(+) antiporter subunit E (Multiple
FT                   resistance and pH homeostasis protein E) (Mrp complex
FT                   subunit E)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38227"
FT                   /db_xref="GOA:B1HXD2"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD2"
FT                   /protein_id="ACA38227.1"
FT                   /translation="MAFQMILNFVLAFVWMFLSSNYTATGFIIGFLMGIILLIIMRRFF
FT                   KSRLYVYRLWAILKLTSLFFKELVLANVQVLKVVLKPKLDMQPAFFAYPTVLTEDWEIT
FT                   LLSSLITLTPGTVVVHVSDDAKTLYVHAIDINDVDEAVASIRDSFEKAILEVSKS"
FT   gene            complement(617808..619295)
FT                   /locus_tag="Bsph_0605"
FT   CDS_pept        complement(617808..619295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0605"
FT                   /product="mrpD, yufD; electron transfer"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38228"
FT                   /db_xref="GOA:B1HXD3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD3"
FT                   /protein_id="ACA38228.1"
FT                   /translation="MNNFLLLPIIIPFFFGMILMFGQKNLMYQRTFSLLGIGISLITAI
FT                   SLLLKVKHDGIQKVTFGDWPVPYGITMVSDMVSALLVTTTLLIAFFVVWYGFGSITKER
FT                   ERFFYYPGIMFILTGVNGAFTTGDIFNLFVFFEVLLMASYLLIVLGGEKGQLKGSIKYI
FT                   LINVISSALFVITVAFLYSVVGTLNMADIAVKIAEINQPGIITVIAVLFLMVFGLKAAI
FT                   FPLYFWLPTSYAAAPIPVLTLFGALLTKVGVYAITRTYTLFFVHDLSYTHDLLMVLAIA
FT                   TIVAGCIGALAYFDVKLIIIYNIVIAVGVILFGVSQMNEASLKGAMFYLVHDMLIKAAL
FT                   FMLIGIIIYITGTSDLRKMGGLMKKYPVLGWCYLIAAFGLAGIPPLSGFVGKLLIVQGG
FT                   FEAGNMWSSIFILASSLLVLLSVIRIFIYAFWGEEKETKGTVDKSIYKMLFMPSALLVL
FT                   ISVVYGVGSEWMTPFMDDAAKLLNDPSIYIDAVMKGD"
FT   gene            complement(619288..619629)
FT                   /locus_tag="Bsph_0606"
FT   CDS_pept        complement(619288..619629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0606"
FT                   /product="Na(+)/H(+) antiporter subunit C (Multiple
FT                   resistance and pH homeostasis protein C) (Mrp complex
FT                   subunit C)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38229"
FT                   /db_xref="GOA:B1HXD4"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD4"
FT                   /protein_id="ACA38229.1"
FT                   /translation="MEIIMAFVIGFLFMAAVYLILSKSLLRIIIGTGLLSHGAHLLILT
FT                   MGGLGGEAPPVLNEGAKPFADPLPQALILTAIVISFGVTAFFLVLAYRSYQELQTDDIS
FT                   LMRGSDEDE"
FT   gene            complement(619629..620051)
FT                   /locus_tag="Bsph_0607"
FT   CDS_pept        complement(619629..620051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0607"
FT                   /product="mrpB, yufU; Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38230"
FT                   /db_xref="GOA:B1HXD5"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD5"
FT                   /protein_id="ACA38230.1"
FT                   /translation="MKTNDVIIQFTAKIVFFIIFFFSIHIFLAGHYTPGGGFVGGLLTS
FT                   SAIVLLVLAFDIRTVRHILPINYTYLTAIGLLLALATAAFPMFVGEPFFTHFFNYFDLP
FT                   LLGKQSLHTAMLFDSGVYLVVVGVTMTIIQTIGEDE"
FT   gene            complement(620038..622449)
FT                   /gene="mrpA"
FT                   /locus_tag="Bsph_0608"
FT   CDS_pept        complement(620038..622449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpA"
FT                   /locus_tag="Bsph_0608"
FT                   /product="multiple resistance and pH homeostasis (Na+/H+
FT                   antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38231"
FT                   /db_xref="GOA:B1HXD6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR005663"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD6"
FT                   /protein_id="ACA38231.1"
FT                   /translation="MLQVLYIFIPMLAAIFVPFLYKSIKNIHTGWFVLAVPATLVVIYA
FT                   SYIAQVAKGGVFTAKLPWIPSLDISFVSYLDGLSLLFSLLITGIGSLVVLYSIFYLDKH
FT                   KEKLHNFYVYLLLFMSAMLGVVQSDHLITLYFFWELTSISSFLLIGYWYNRDASRLGAL
FT                   KSMMITVGGGLMMLGGFVLLYLMGGTYSIRELMVMAPNLVDHPLFTWSLVLLLLGAFTK
FT                   SAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGIYLVARFTPIFAASELWVWLVTGIGI
FT                   LTLFWGSFFAVKQTDLKGILAFSTVSQLGLIMSLLGASAVAFHANESVDTIKFAAFAAI
FT                   FHLINHATFKGSLFMIAGIIDHETGTRDIRKLGGLMSIMPISFTVAAIGSLSMAGLPPF
FT                   NGFLSKEMFLTAMLALQKFEFFGFDTWGVLFPIVAWVASIFTFIYSFYFVFRTFNGNYK
FT                   PEQLPHKPHEAPIGMLVSPMLLAGLVVLIFFIPNFIGDTFVKPAVLAIQPFLYEVPQDI
FT                   DIHVSAWHGINPELLMTIGIIIIGVLLFVSLPKWQGMYQRFPKAFTLNNAYDKIMQGLD
FT                   VGLNRLSRLYMTGSMRHYLLYMFSGIAIIVIGSLFVKNAFSFSFQETAPIRPYEIILVV
FT                   VLLIGTAITILAKSRLTAIIGLGSVGYTVALFFVIFNAPDLALTQLVIETISVALFLMA
FT                   FYHLPKLGKREERMRFQLNRAVVSITIGAMVTLVALSAHSQKLIPSISKYYEETVYSLA
FT                   GGGNIVNVILVDYRGFDTLFEITVLGIAGMAILAMIKLRMNRKEKTHENK"
FT   gene            622604..623167
FT                   /locus_tag="Bsph_0609"
FT   CDS_pept        622604..623167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0609"
FT                   /product="Hypothetical yufK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38232"
FT                   /db_xref="GOA:B1HXD7"
FT                   /db_xref="InterPro:IPR035289"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD7"
FT                   /protein_id="ACA38232.1"
FT                   /translation="MKNPYIYGYLPLITILLFSLTFGMYAVGESLQIFRAIGVYSGMRE
FT                   FLSDVELRVFLLIVFAIVFFMLFSALKLVGETIHELGMLFFSKDNDGATVSQARGGYII
FT                   LFIGAMCSAFAIQFIYVLIGIFVLTVFTYFIYLIYKMSHFMSMGGTIGLLIFELFMWTI
FT                   LLTFIVYVVLKLYNGILASLPFAQ"
FT   gene            complement(623316..625178)
FT                   /locus_tag="Bsph_0610"
FT   CDS_pept        complement(623316..625178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0610"
FT                   /product="Penicillin-binding protein 4 precursor (PBP 4)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38233"
FT                   /db_xref="GOA:B1HXD8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD8"
FT                   /protein_id="ACA38233.1"
FT                   /translation="MEAHMKKAFGFFIILLSLPVLWWISTNIRTEINTAQAHEEQISQA
FT                   IHLPEVQPQLPITLKDQNGQTFSEEYVEWRQPLTLQEIPQIAQEIFIASEDADFYEHIG
FT                   FDLSAIMRAVVANSSTSTSSQGGSTITQQLVRMRYLSDEKTYERKLTELFYAYELEKEF
FT                   DKEAILTMYLNESYFSNQVYGIGGAATYYFQRPLQQLSIAEIAFIAAIPNNPSLYNPLK
FT                   NFEQTKARQERLLDTLAVKGSITKEEATTYKAKPITLHIKDKIQSYPMYSTYVLQELKW
FT                   LVAEKEGYADRLNHTDNEEEKKKIKTQLDNRLDSLFQNGLIINTALDPQKQRHDEQQMT
FT                   ATLGAGSLQAAGAVIQNQSREIVSLYAGKSYEKFDYHRAFQGTRQPGSAFKPLAVYAPF
FT                   FETTTHTPDSIVNGGSYCVGSFCPHNYGGYKYGDVSLRTAFRHSYNTSALRLFQTVGID
FT                   TAFQYLDRFHFRSIVEKDHNYAASLGGLTYGVTALELADAYTSFIDGSYVLAHSIRKVT
FT                   ALDGTELYSWDTQRDQIWSPKTVKYMRELLADVVTNGTGQGVYSNSSYVGAKTGTTNDY
FT                   RDYWLAGLNDTYTAAVWIGYDKPQSMQKLEEYKIHHQLFNVLLE"
FT   gene            625404..625991
FT                   /locus_tag="Bsph_0611"
FT   CDS_pept        625404..625991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0611"
FT                   /product="Peptidylprolyl isomerase domain and WD
FT                   repeat-containing protein 1"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38234"
FT                   /db_xref="GOA:B1HXD9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXD9"
FT                   /protein_id="ACA38234.1"
FT                   /translation="MFPQLTTDVQAGEVLVEMNTTLGAVKIKLFPEFAPKTVENFLGHA
FT                   KSGYYNGIIFHRVIQDFMIQGGDPTGTGMGGESIWGDSFEDEFSDKLFNLRGALSMANA
FT                   GPNTNGSQFFIVQMKHLPSDMLRQLQGAGFPEEIIEAYAQNGGTPWLDHKHTVFGHVVE
FT                   GMDIVDKIADVEKDPRDKPLEDVKIESITVFE"
FT   gene            626014..626226
FT                   /locus_tag="Bsph_0612"
FT   CDS_pept        626014..626226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38235"
FT                   /db_xref="GOA:B1HXE0"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE0"
FT                   /protein_id="ACA38235.1"
FT                   /translation="MENLMYQFLYFPEDKSGYIPAAFEFLIMLILCVIVFTLFRKISKK
FT                   QEMKSKEIEARILAEKKSTNNQQNV"
FT   gene            complement(626267..627688)
FT                   /locus_tag="Bsph_0613"
FT   CDS_pept        complement(626267..627688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38236"
FT                   /db_xref="GOA:B1HXE1"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE1"
FT                   /protein_id="ACA38236.1"
FT                   /translation="MDLVPLTIERAYMTFLFPFAYQIKDRQKIGHTLLEEGFSFFELNN
FT                   ANLEHAFYGDITIIHEELAQFFYPFLEDKLFPNKMDSPDFLRFSKAFYTQGALHHHENC
FT                   INYELMSIDVTLCPFGNGIVTVRTSIDSQYDISDILNFIHYFRVLEAKLREEKGASHHF
FT                   SFGHCDSTSELLFNYFIPFLKPFLQHHQDHTYEGLPFFEDERMFSSAYLICDEKAELLP
FT                   EHLFRLGQVDGRTPDGKPFISSTNSQYISNYVQEHAHTRWAPNSFIISSAQSQMTLTNR
FT                   PFEHCSHSIQEFMGTHYYNLFIHYFYKMMLLKLSYEYSEIKWGKDKQIVNELIELITEF
FT                   SARYYFEEVVVRTEGREIAQMLRKHFRINEHYVGTKATLNSLYRTQEDQSDNRSNNLLF
FT                   ILTVFTVISGIYGMNLVIEEWKDSNDLDSVWSYTPFEWVAFITALSGIGLSIVLVCFHA
FT                   FKTIQNMVRRSKRKI"
FT   gene            complement(627800..628723)
FT                   /gene="patB"
FT                   /locus_tag="Bsph_0614"
FT   CDS_pept        complement(627800..628723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="patB"
FT                   /locus_tag="Bsph_0614"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38237"
FT                   /db_xref="GOA:B1HXE2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE2"
FT                   /protein_id="ACA38237.1"
FT                   /translation="MANDKDSIVFCNGVVAALANSIVAFTNPGDKVLISTPVYPPFFNI
FT                   PKSNGREVVSCPLVEKNDGKFIVDFEAFEQALAQNVKAYILCNPHNPGGYVWDEATLKE
FT                   IVRLCAQYDVLIISDEIHADLMINGEKHIPIAKIAGDEINRIVTCMAPTKTFNLAGIQV
FT                   SYMIVPDKKKRLQLEAVNMASGQGSLNTFASVALQAAYTEGTPWLDELLPYISANMDYV
FT                   KAELEQIPGIRIIKPQSTYLIWIDYRELKLEEKDIMKRLLEIGQLALEPGTKYGEEGRG
FT                   FLRMNVACSFETVRDGVERFKKAFEQ"
FT   gene            complement(628713..628868)
FT                   /locus_tag="Bsph_0615"
FT   CDS_pept        complement(628713..628868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0615"
FT                   /product="Putative Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38238"
FT                   /db_xref="GOA:B1HXE3"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE3"
FT                   /protein_id="ACA38238.1"
FT                   /translation="MWVADMDFAAPTAVSKALQEHAERTVLGYSFMSEEAIQSIVDWQN
FT                   TRHDGK"
FT   gene            629063..629272
FT                   /locus_tag="Bsph_0616"
FT   CDS_pept        629063..629272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0616"
FT                   /product="Hypothetical protein YugE"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38239"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE4"
FT                   /protein_id="ACA38239.1"
FT                   /translation="MNQAAVHLLEEWDPFHLGPDHYDTDTADVVAALQGIDDPSTLAKV
FT                   IQETYEHSFEQWIPFEECVAILTN"
FT   gene            complement(629390..630730)
FT                   /gene="yocR"
FT                   /locus_tag="Bsph_0617"
FT   CDS_pept        complement(629390..630730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yocR"
FT                   /locus_tag="Bsph_0617"
FT                   /product="putative neurotransmitter:Na+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38240"
FT                   /db_xref="GOA:B1HXE5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE5"
FT                   /protein_id="ACA38240.1"
FT                   /translation="MSSRDQFTTKIGFILAAAGSAIGLGAIWKFPYMAGTNGGSVFILL
FT                   FVLCTFFIGLPVLIAEFMIGRRGQKDAVTSFKEQAPGKPWYLIGWGGMVIAGLILSFYS
FT                   VVGGWILSYLGRAFTFKLTNAGSDINFADLFGNIIASPFEAVLVQGLFMLLTVVIVSAG
FT                   IKGGIEKASTWMMPLLFIFFIILVIRSLTLDGAMEGVKFMFVPDWSYLNAETFLMALGQ
FT                   AFFSLSVGIAVMITYASYLSKTEKIGNSAINVASMNIIISLLAGLVIFPAVFALGYTPD
FT                   QGPGLVFIILPAVFEQLPLGALFLTIFFILLLFATVTSSISMLEIVVAIAIGDKPEKRK
FT                   KIAWIGGIIIFIVGIPSALSFGILSDVKILDRSIFDFVDFMTNSIGMPIGALLISIFAG
FT                   YYYTKDISRKELAASSWIFTIWYMLIRYVSPIAILIIFIQGILPLFK"
FT   gene            630940..631488
FT                   /gene="sigY"
FT                   /locus_tag="Bsph_0618"
FT   CDS_pept        630940..631488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigY"
FT                   /locus_tag="Bsph_0618"
FT                   /product="RNA polymerase sigma factor Y"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38241"
FT                   /db_xref="GOA:B1HXE6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE6"
FT                   /protein_id="ACA38241.1"
FT                   /translation="MVEADLIARAQQGDKDAYIDLIRIHQQTVERFAFQCGVHSNDLAD
FT                   VSQEVFVKLYRFLHQFKQDRFTTWLYKITLNATRDYYRKEQRELAKGDKLNAHRQTIFL
FT                   SAEDDVLLFEEDRTLHNAIQSLDEKYRYPIVLYYFHELKYEEIAEVLNISLSTVKVRLL
FT                   RAKEKLKAALMQEGSVENG"
FT   gene            631481..633112
FT                   /locus_tag="Bsph_0619"
FT   CDS_pept        631481..633112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38242"
FT                   /db_xref="GOA:B1HXE7"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE7"
FT                   /protein_id="ACA38242.1"
FT                   /translation="MDDKQFNQRIALLKKSYERMESKLDPQHVLQQIENEDAIRDSQET
FT                   INTILKSSAKWQKPAVWIASIASVLLVGLLISSFMLHPSTLVHSNEEKIESSYEEWFSS
FT                   LQKKYQEKREKTRVELDIPEEDFKKLSFVESADYKYNDKAKNKKIVLNKMAYDPKYLTQ
FT                   LEQEILDSLQTPRELIERIETYENPMSFAESRYFFSIYYPTKDVLQYYTNELSQYNKVL
FT                   SQKKKDYPKELNQLIATAKKQYFELSYDGQNYSFRTNPIFMKDAPVSIDRLHPDILGYF
FT                   KYLATGSLFNGEDLRFSAEESARILKLYERTLVNDLSNSYLDFQLRNLNKEFENTWLVL
FT                   LKGDDKTRYSPEHIELLNDTANGKYGESMRLTAQFILEEFKREGTSKTIDKLTRQDIRM
FT                   ELSYLSNEVYIEIYDGSTGLQIDNRWIIQTEGLYNAYVSSKDDTILDSLNPMNVVSLFL
FT                   YAQGKGDQETVKQLVSQAVDVDKLVQFDGMQHFTVLYATDTSQTTIKVGVKPESIQMIG
FT                   QRLTFQLGTVPIEKGEKRFIITAIPE"
FT   gene            633197..633574
FT                   /locus_tag="Bsph_0620"
FT   CDS_pept        633197..633574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0620"
FT                   /product="General stress protein 13 (GSP13)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38243"
FT                   /db_xref="GOA:B1HXE8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE8"
FT                   /protein_id="ACA38243.1"
FT                   /translation="MVKKYELGDVLTGKVTGIQPYGAFVALDDNTQGLVHISEITYGFV
FT                   KDVSEFLAVGQEVAVKILEIDEEAEKISLSMRALQERPVTVRKKESPPRKSLQDRVDES
FT                   DANGFNSLKDKLQDWIEQSGQ"
FT   gene            complement(633619..634926)
FT                   /locus_tag="Bsph_0621"
FT   CDS_pept        complement(633619..634926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0621"
FT                   /product="transcriptional regulator (NtrC/NifA family)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38244"
FT                   /db_xref="GOA:B1HXE9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXE9"
FT                   /protein_id="ACA38244.1"
FT                   /translation="MKNSEPLLPFYEFIATNVSVGIHAVDLSGKTIIYNTKMKEIEGFH
FT                   FDELADRSIIEMFSFRQHESTLMRVLQTGKKEINVKQTYWNKNGHEITTINDTFPLIVE
FT                   GKLIGAIEFARDITSLEKLVYQPLRRYDEPLTFDMIKAKSEAMKQVIENAKKAAAVKLP
FT                   VLLIGESGTGKDLVAEGIHHAASPDPEAFMTLVSRRSAQSVLDKLNQLLEEDKDYTFFF
FT                   ERIDFLSLDIQEQLLDILQSLPQSKYMLIGSVGSDPITLIAEKKLSKSLYYFFATMAIT
FT                   IPNLTDRKEDILPFVDDYFSRHRERFASQVTELAPDVQELFLQYDWPGNLKELELLLDE
FT                   IVSFMTIESTVTSDLLPLHFRFKVQQQDTNNREPEFFMFHQNHDVMPLDAYLREAESYY
FT                   VQNVLNLYEGNITKAANALGMSRQNLQYRIRKIKKQ"
FT   gene            635072..636616
FT                   /locus_tag="Bsph_0622"
FT   CDS_pept        635072..636616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0622"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38245"
FT                   /db_xref="GOA:B1HXF0"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF0"
FT                   /protein_id="ACA38245.1"
FT                   /translation="MIPYKHEPFTDFSQEANYNAYVEALNKVEGYLGQDYPLIIGGERI
FT                   TTEDKIVSYNPAKKTEVIGRVSKASKDLAEKAMQAADETFKTWKKVDPAIRADVLFKAA
FT                   AIIRRRKHEFSALLTKEAGKPWAEADADTAEAIDFLEYYGRQMLRIKNGQPVESRPGEY
FT                   NRYDYIPLGIGIVISPWNFPFAIMAGTTVAALVTGNTVLLKPASTTPVVAYKFIEVLEE
FT                   AGLPAGAVNFVPGSGAEVGDYLVDHPKTRFISFTGSRDVGLRINQRASVLNDGQIWIKR
FT                   VIAEMGGKDTIVVDKEADLELAAQSIVKSAFGFSGQKCSACSRAVIVEDVYDQVVNRVE
FT                   ELTNALTVGDPTDFSNFMATVIDQAAFNKITEYIEIGKGEGRLVAGGTADDSVGYFVQP
FT                   TVFADVEPSARIMKEEIFGPVVAIAKAKDFDHAIEIANDTEYGLTGAVITTNRMNLEKA
FT                   REEFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLQLHMQAKTTSEML"
FT   gene            636858..638051
FT                   /locus_tag="Bsph_0623"
FT   CDS_pept        636858..638051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0623"
FT                   /product="Ornithine aminotransferase"
FT                   /EC_number="2.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38246"
FT                   /db_xref="GOA:B1HXF1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF1"
FT                   /protein_id="ACA38246.1"
FT                   /translation="MTKTQQVIEQTQNYGAANYHPLPIVISEAEGAWVKDPEGNKYLDM
FT                   LSAYSAVNQGHRHPKIIAALKEQADKVTLTSRAFYSENLGEWYELVGKLTNKEMVLPMN
FT                   TGAEAVETAFKAARRWAYDVKGVEEGKAEVIACNGNFHGRTMLAVSLSSDEEYRRGFGP
FT                   MLPNVKLVDYGNLEALKAAITPNTAAFLIEPIQGEAGIVIPTEGFLKAARELCRENNVL
FT                   FIADEIQAGLARTGKMFACDWEEVEPDMYILGKALGGGVFPISCVAANRNILGVFNPGS
FT                   HGSTFGGNPLACAVSIASIKVLLDEKLAERSHDLGEYFKGKLKEINNPVIKEVRGRGLF
FT                   IGMELTEAARPYCEKLKELGLLCKETHDTVIRFAPPLVISQEDLDWSIEQIEKVFKL"
FT   gene            638136..639380
FT                   /locus_tag="Bsph_0624"
FT   CDS_pept        638136..639380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0624"
FT                   /product="NAD-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38247"
FT                   /db_xref="GOA:B1HXF2"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF2"
FT                   /protein_id="ACA38247.1"
FT                   /translation="MSENLNLFTSTQDVIQDALNKLGYDEAMYELLKEPLRMLQVRIPV
FT                   KMDDGTTKVFTGYRAQHNDAVGPTKGGVRFHPQVSEEEVKALSMWMTLKCGIVDLPYGG
FT                   GKGGVICDPRQMSMGEIERLSRGYVRAVSQIVGPTKDIPAPDVFTNAQIMAWMMDEYSR
FT                   MDEFNSPGFITGKPLVLGGSQGRDRATAQGVTIVIEEAAKKRGIDIKGARVVIQGFGNA
FT                   GSFLAKFMHDLGAKVIGISDAYGALHDPEGLDIDYLLDRRDSFGTVTTLFENTISNKEL
FT                   LELDCDILVPAAIENQITADNAHNIKADIVVEAANGPTTAEATKILTERGILLVPDVLA
FT                   SAGGVTVSYFEWVQNNQGYYWTEEEVEERLYKKMVEAFDNVYTTATTRNINMRLAAYMV
FT                   GVRRTAEASRFRGWV"
FT   gene            639620..640783
FT                   /locus_tag="Bsph_0625"
FT   CDS_pept        639620..640783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0625"
FT                   /product="Probable NADH-dependent butanol dehydrogenase 1"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38248"
FT                   /db_xref="GOA:B1HXF3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF3"
FT                   /protein_id="ACA38248.1"
FT                   /translation="MDSFTFFNPVKLHFGEDALEKLPKELEQYGKKVLVVYGGGSIKTN
FT                   GVYDAVIDKLQQADKTIFELSGVEPNPRVETARRGIEICKTEGIDLVLAVGGGSVIDCS
FT                   KLIVAGAKYDGDAWDIVKRKVLVEQALPLGTVLTLAATGSEMNSGSVITNAATEEKLGW
FT                   GSPAAFPKFSILNPAYTVSVPKNHTVYGIVDMMSHIFEQYFHNTTNTPITDEMCEGVLR
FT                   TVIKTAPKLLEDLENTQLRETILLAGTIGLNGFLSIGSRGDWASHNIEHAVSAVYDIPH
FT                   AGGLAILQPHWMRLSVPVNPERFAGIATRVFGVDATDKTVEEVAYEGIDRLSAFWSSLG
FT                   APNRLADYNIDDSKFQQIVEHAMHNGPFGNFHQLQEKDVRTILQNSL"
FT   gene            complement(640848..641021)
FT                   /locus_tag="Bsph_0626"
FT   CDS_pept        complement(640848..641021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0626"
FT                   /product="probable transposase for IS150"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38249"
FT                   /db_xref="GOA:B1HXF4"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF4"
FT                   /protein_id="ACA38249.1"
FT                   /translation="MGKVSVEQRIQAVQRYLNGYETMLEIAKDIGVTEWVRRYQKNGVE
FT                   TFLKSYTNYSAD"
FT   gene            complement(641105..642082)
FT                   /locus_tag="Bsph_0627"
FT   CDS_pept        complement(641105..642082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0627"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38250"
FT                   /db_xref="GOA:B1HXF5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF5"
FT                   /protein_id="ACA38250.1"
FT                   /translation="MGELFKLLKDGNKPSLMAACVNAFLGIIKGIAFFLTGNVAMFAEM
FT                   MHSLGDAANQLFVYIGSALSKKAPTKKFPSGFGRIVNLVCLFAVIIVAILSYETIKEGW
FT                   HHFIHPTGESSGVLIALGVLFIGIVLEGTVLAKAAVEVLHEAGQEKAGITTIPKAFNYL
FT                   NRAKPATKLVFMEDLVATSGNILAFIAIVIAHFTGWTRIEGLVSMIIGAMMFYVVGKVF
FT                   LDNARGVIGETDEEMLNHIAHLVMDDPNIKDIVRLEVIKEGEFLHVELVAEADPKLSLA
FT                   FLDDVRDHLTEVILSQKGVSKVAILFDEDDGKASWIHLGERPDH"
FT   gene            complement(642097..642819)
FT                   /locus_tag="Bsph_0628"
FT   CDS_pept        complement(642097..642819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0628"
FT                   /product="Protein sapB"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38251"
FT                   /db_xref="GOA:B1HXF6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF6"
FT                   /protein_id="ACA38251.1"
FT                   /translation="MGTLLENMITYEVGIKLVLAATLSLVIGIERELKKKPVGLKTSLV
FT                   IATFSCLLTIISIETAYSTPSREDINITMDPLRLAAQIVSGIGFLGAGVILRRGNDSIS
FT                   GLTTAAMIWGAAGIGIAVGAGFYMDATLAVIIIVFGIEILSPFLMKIGPKRIRMREILL
FT                   KVQIDDDKHTESFLLFLKNNNIIIENIRIKDVPLKNDTVLHELDLRLSLIVSDNLLSFY
FT                   RSLRTLSYIEKIEMEILN"
FT   gene            644576..646119
FT                   /locus_tag="Bsph_rRNA0716S"
FT   rRNA            644576..646119
FT                   /locus_tag="Bsph_rRNA0716S"
FT                   /product="16S ribosomal RNA"
FT   gene            646442..649347
FT                   /locus_tag="Bsph_rRNA0723S"
FT   rRNA            646442..649347
FT                   /locus_tag="Bsph_rRNA0723S"
FT                   /product="23S ribosomal RNA"
FT   gene            649540..649648
FT                   /locus_tag="Bsph_rRNA075S"
FT   rRNA            649540..649648
FT                   /locus_tag="Bsph_rRNA075S"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(649841..650452)
FT                   /locus_tag="Bsph_0632"
FT   CDS_pept        complement(649841..650452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38252"
FT                   /db_xref="GOA:B1HXF7"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF7"
FT                   /protein_id="ACA38252.1"
FT                   /translation="MDDYLQTRGKLTMSNELNSCTKDILEQYITMLRDWIPTDSSVAIA
FT                   VDNSYIFIHPRHHSVHLEVGQQVLPGSIADQVLRTQKKTETILDNLSCDTPFYGIGYPI
FT                   LIQDEPAALVVILPSTFTTKKTEAFEFITGKQDEEWNPVAINKVSHIESLQKKTWFYVE
FT                   REQFKTNITLKELQIRLPSYFIRIHRSYIVNIYFIKKNGA"
FT   gene            650631..651914
FT                   /locus_tag="Bsph_0633"
FT   CDS_pept        650631..651914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0633"
FT                   /product="Isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38253"
FT                   /db_xref="GOA:B1HXF8"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF8"
FT                   /protein_id="ACA38253.1"
FT                   /translation="MSTRQERIQTLEKQWAENPRWAGIERTYSAEEVVKLQGTVVIEQT
FT                   LARKGATRLWNSLHEEPFINALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGQMY
FT                   PDQSLYPANSVPAVVKRINQALQRADQIDHAEGRVDQFDWFAPIVADAEAGFGGPLNVF
FT                   ELVKGMVEAGAAGVHLEDQLASEKKCGHLGGKVLLPTQNAVRNLVAARLAADVMGVDTI
FT                   LIARTDADAADMVTSDIDPRDAEFITGERTPEGFFRTKAGIKQAIARGLAYAPYADLIW
FT                   CETSKPSLEEAREFAEAIHAEFPGKMLAYNCSPSFNWKANLSEEEIAEYQRELGKLGYK
FT                   FQFVTLAGFHALNHSMFELAHDYKDNGMAAYSKLQQAEFASESKGYTATRHQREVGTGY
FT                   FDEISQVISGGTSSTTAMAGSTETEQFV"
FT   gene            652003..653616
FT                   /locus_tag="Bsph_0634"
FT   CDS_pept        652003..653616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0634"
FT                   /product="Malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38254"
FT                   /db_xref="GOA:B1HXF9"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXF9"
FT                   /protein_id="ACA38254.1"
FT                   /translation="MGKQLMKQATTGKLKIVGEQNEQTNEILTPEALEFVLALHEKFDA
FT                   RRKELLNARQKRQKRLDAGEKLDFLPETKHIREGDWSIAPLPQDLQDRRVEITGPVDRK
FT                   MVINALNSGAKMFMACFEDASSPTWENMIGGQINMRDAINKTIEFTQASNGKTYKLNAE
FT                   TAVLLVRPRGLHLLEKHVLVQGEPISGSFFDFGLYLFHNAKNALAKGTGPYFYLPKLES
FT                   HLEARLWNDVFVFAQDYIGIPQGTIKATVLIETILAAFEMDEILYELREHSAGLNCGRW
FT                   DYIFSYIKRLRNQADVILPDRGQVTMTVPFMKAYTSLCIQTCHKRNAPAMGGMAAQIPV
FT                   KNDDEANAVAFAKVAEDKRREATEGHDGTWVAHPGMVATAMEQFDAIMPTPNQIHKKRE
FT                   DVHVTAEDLVAVPEGTITLEGLRVNCSVGVQYIASWLRGNGAAPINNLMEDAATAEISR
FT                   TQVWQWIRHPKGILDDGRGITLAFVLEILEEELTKIKEAVGEQAYNCGRFDEAAELFKS
FT                   LIAQDEFAEFLTLPGYEKLA"
FT   gene            complement(653839..654507)
FT                   /locus_tag="Bsph_0635"
FT   CDS_pept        complement(653839..654507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0635"
FT                   /product="O-methyltransferase mdmC"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38255"
FT                   /db_xref="GOA:B1HXG0"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG0"
FT                   /protein_id="ACA38255.1"
FT                   /translation="MMTELNSWHNVDNYFTNKLLPENSCLNAALLANKAAGIPEIDVSP
FT                   TQGRFLYLLTKLKGAVNVLEIGTLGGYSSICLAQALSKEGKVVTLEINEDYASVARQNI
FT                   RHAGLEEKVEIIVGHALDTLPDLKKRGQFFDVIFIDADKPNNPEYLKWALKLANSGAII
FT                   IADNVVRNGAVTDINSEDERVRGVQQFIDLLKLEPRIEATAIQTVGVKGYDGFVLAIVD
FT                   "
FT   gene            654632..655525
FT                   /locus_tag="Bsph_0636"
FT   CDS_pept        654632..655525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0636"
FT                   /product="Putative HTH-type transcriptional regulator
FT                   ycf30"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38256"
FT                   /db_xref="GOA:B1HXG1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG1"
FT                   /protein_id="ACA38256.1"
FT                   /translation="MMNIHGLKLFYHVATTGSFTKAAELLCISQPAVSSQIKRFEHEIG
FT                   VQLFKQQGRGVVLTEFGKALAEKAQHFMALEQHIKSFVEDYRLAKAGDLHIVATYLPAN
FT                   FLIPKWAAAFKAMNEHVNLMITTTNTKDAFEQLIHYKADIAIYGGGISERPKEIWWEEI
FT                   YEDELWFVVSPHHRYAHQTITLIEMFQEPFIMREKGSSMREHLFSLCQTYQVEPPKIAL
FT                   QFNGINETIRSVIAGYGANFISSLAVREYVESGQLARVIIKDIHPVKHKISICTRKNEK
FT                   QNLLVQNFIETIKRSL"
FT   gene            655599..655994
FT                   /locus_tag="Bsph_0637"
FT   CDS_pept        655599..655994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0637"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38257"
FT                   /db_xref="GOA:B1HXG2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG2"
FT                   /protein_id="ACA38257.1"
FT                   /translation="MFIQIETQSEVPIYEQVTRQIIEGIARGDMKQGETLPSVRSLAAD
FT                   LGVNMHTVNKSYHELEAKGIIVIRAKSGAIIRSTEERALTPEQLRQIEKNLKPVVAEGM
FT                   VLGATVEQIEHMMKKVFADLHIPAEGV"
FT   gene            656031..657092
FT                   /locus_tag="Bsph_0638"
FT   CDS_pept        656031..657092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0638"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38258"
FT                   /db_xref="GOA:B1HXG3"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG3"
FT                   /protein_id="ACA38258.1"
FT                   /translation="MTLVLQMIVPFIVRDTIVFGVTVPDQNIKHPALANLKKRYAQIVG
FT                   GTGIVFLIVMIISYNLFTSESVRGIFLLGCLWSMLTVSMGLYWVYHQKISVLKRQEQWG
FT                   VNIKQVRAVDLTARSRDEMLPWSFFAVPLVISGFLIIYTILHYDKMPANIAVHWGPSGE
FT                   ADAWRNKTYLTAISLPLIMLMIQFMMWGIIDSIKRSAIKIAVNRKEESLEDQLKTRKYI
FT                   SWQILLVSYAITVLLTVLQLSNIYPAMTVGYKLLPLFILFLAVVLGSLLIYVVKKRKYR
FT                   VRYEKNSDSQVMDVDEDRYWKGGLIYMNRQDPSVFVEKRFGVGWTMNLANPRGYIVIGL
FT                   PFLLLLLICIFSL"
FT   gene            657166..657837
FT                   /gene="mtrA"
FT                   /locus_tag="Bsph_0639"
FT   CDS_pept        657166..657837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA"
FT                   /locus_tag="Bsph_0639"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38259"
FT                   /db_xref="GOA:B1HXG4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG4"
FT                   /protein_id="ACA38259.1"
FT                   /translation="MRILVVDDDVHILQLVNIYLTREGYQVLRAENAQQALALLNGNLP
FT                   DLAVVDVMMPGMDGFTLTETLTQDYDIPVLLLTAKGELEDKERGFLAGSDDYVVKPFEP
FT                   KELLFRIAAILRRMDKKNQITIQVGQLVIDRRSFEVIIGEETLILPLKEFELLALLASR
FT                   PNQVFTRSYIMEQVWGYDYDGDEQTLNTHVKRVRERLNRFDTAVEIITVRGVGYKLEAT
FT                   S"
FT   gene            657861..659207
FT                   /locus_tag="Bsph_0640"
FT   CDS_pept        657861..659207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0640"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38260"
FT                   /db_xref="GOA:B1HXG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG5"
FT                   /protein_id="ACA38260.1"
FT                   /translation="MTTLLVMIGSLCIGFLATNTYYHQVVKEKNDTKNVIIAQGIAQYI
FT                   ETAKPEDLNSYFMTLGEIGYQIYVTTGEQGNFFGGEYRDKTLSESVVEHVLNGEVYHGM
FT                   RDFPKETFMTGFFANELVNTIGVPFTYENKSYALFIRPDIRLLFSEVHTLLGGLMLAMI
FT                   VLSLLAMLLFAKALIRPITKLTAATRQLAHEKFDTVLDIDRNDELGQLATSFNIMTEKL
FT                   QENDRVRKEFISNVSHDFQSPLLNIQGYVDLLKNPLLKERERQEYAAIIELETKRLSTL
FT                   TKQLLLLTSLDQSTRIVKRERYRLDEQLKESVRKYRWQMEEAQLQITYKLEQVIFNGDA
FT                   GLLQNVWDNLLTNAIKYNIQGGQIHLYLQQKPASLEILVEDKGIGMTAAQLAKVYDRFY
FT                   RADTSRTKQGTGLGLAIVKQIVELHGGTVHIESTVNAGTKVYINLPILS"
FT   gene            659281..659685
FT                   /locus_tag="Bsph_0641"
FT   CDS_pept        659281..659685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38261"
FT                   /db_xref="GOA:B1HXG6"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG6"
FT                   /protein_id="ACA38261.1"
FT                   /translation="MEQKWSIRLIRLAAIFALIGTYLGSHMSGSGSYEYRPIHAHILLV
FT                   GWLSMFAWGIFYRAFKVKSQKLVNIHGWTAILGVFGLTLGMWFYNINPFHFGSTFTLVF
FT                   FIVGGTTLLISFALFIVVTFMIKQQEDLKN"
FT   gene            complement(659738..661597)
FT                   /locus_tag="Bsph_0642"
FT   CDS_pept        complement(659738..661597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0642"
FT                   /product="Suppressor of lin-12-like protein (Sel-1L)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38262"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG7"
FT                   /protein_id="ACA38262.1"
FT                   /translation="MSYAALAKNLQEASFFAISNPQVSLQKSLLVVEEILYEVYQLEMH
FT                   TTPKLKNVRMLLNNRSFTAHIHPRRISLLMNLVYKMTSHTSNELVEAKAAKIVLDYTSD
FT                   IVEWFIKRYDRSFNSNVAEEKDLMLDNTLYQRDHSPDAYKHAAEWFEIAAQNGDASAQY
FT                   NLGALYNQGRGVKKDYALAKMWYERAADQNDPNAHYSLGVLFHLGQGIEQNYTEAAHHY
FT                   QIAADLGNADAQYNLGVLYNQGLGMSQNFLEAAKWYTLAADQGNTSAQNNLGFLYHNGT
FT                   GVEQSYVEASTYFEMAALAGDASAQYNLGYMHLKGRGIPQNFTEAAKWFHMAALQDHMN
FT                   AEFQIAMLYNTGQGIPMDHLEALKWFKLAAHKGHLHAQFYLGLLYEKEQDMVLAEKWLL
FT                   LAAEKGHISAGFELGRLYVYQLHQPDKALPYLKAAAEKGYVDAQYELGLLLTAGDGVPV
FT                   NYPEAVQWWRAATDQSHIQAEYQLGLVYEQGLGVSIDLEEARRCYRLAAIQGHAGAQYQ
FT                   LGNLFDKGKGVTQDYTEAAKWIEQAAAQEHIKAQYQLAQMHIHGQGVPKDFAKAAQLYR
FT                   LAANQGHQKAQFQLGLLYKKGQGVAQDYQEATKWLKKSLQDIQ"
FT   gene            661824..662537
FT                   /locus_tag="Bsph_0643"
FT   CDS_pept        661824..662537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0643"
FT                   /product="putative dolichyl-phosphate mannose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38263"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG8"
FT                   /protein_id="ACA38263.1"
FT                   /translation="MKNIAAIIPAYNPQQSLITYVHQLLATTITQIIIVNDGSDQKYKE
FT                   IFEDLNNIEGCQVLQHRDNIGKGGALKTAFTYIREQKRIFHGVLTVGAHGQHTLQDVKL
FT                   VLTMTKVFSEGIVLGVRNFHSVDSTFLSYWGNRATSLFFELLYHRKLMDTQTGLRYISM
FT                   NELPWLMKVEGERYDYDTNMLIAALKRKCPIFEVEIGQLRIKKNSIIQYDEVINARSII
FT                   TRMLMNYLRPRNNNN"
FT   gene            662623..662883
FT                   /locus_tag="Bsph_0644"
FT   CDS_pept        662623..662883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0644"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38264"
FT                   /db_xref="GOA:B1HXG9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXG9"
FT                   /protein_id="ACA38264.1"
FT                   /translation="MEYSDQVKNRVKRMEGQLRGILKMMEEEKDCKAVITQLSAVRSAV
FT                   DRTVGVIVSTNLLECVQNAEGDGEKMNEAIQEAVNLVVKSR"
FT   gene            663310..664248
FT                   /locus_tag="Bsph_0645"
FT   CDS_pept        663310..664248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0645"
FT                   /product="protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38265"
FT                   /db_xref="GOA:B1HXH0"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH0"
FT                   /protein_id="ACA38265.1"
FT                   /translation="MSDFKKEIMEALDQAKKQTVYASGHMESIKISADSVGNVSYKIKY
FT                   LTNQTQEAAVQKKIGQVLKNIIKPSMTEFDKVKAINDYIVSNTSYGTKTKASPHSAYAL
FT                   LFEGQAVCQGYALAAQAMLSQSGIETKYVVGFVNGNEAHAWNLVKVDGKWYHLDTTWND
FT                   PLPNRIGAASYDYFLVTDEVLKKDHSWIQTDYPAASSTKYNFMQNVHFAYPLNNVVYFS
FT                   NTADHDKLYKLEMATGKKTKVLDKRALYITGMGQNLYYSDYSNSGYLTKLNLKTLKAEV
FT                   LVKQPVTNLKISDNYLIYNMNAKEHKLKLNQ"
FT   gene            664423..665634
FT                   /locus_tag="Bsph_0646"
FT   CDS_pept        664423..665634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0646"
FT                   /product="S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38266"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR032485"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH1"
FT                   /protein_id="ACA38266.1"
FT                   /translation="MADWTNNDEIETMLLSTKDKIVDVTARLSDNASIETAIPIEDMHD
FT                   MEVAPTAQAIQKPETKLVVTNVKEMTDAMYAYYSSFSPKFEIQYKGNTQRIEQIVEEAY
FT                   NNAIERDDYVYGHISKHSIRFEYGRNQATIFGEQSYLMTPEQAAYVEMNVQEIIAKISN
FT                   KSMSDVEKVRAVNDYIVANTAYTDQTNSSPHSAYTVLAEQGGVCQGYALLAHSMLQKLG
FT                   IETKYIVGYVGQEGHAWNLVKLGGQWYHLDTTWNDPVPDRKGAIRYQYFLVDDRTMAKD
FT                   HSWIAEDYPKATSTLYSYYHDIDFPAQVDDQLYFSNISDDNKLYVLDMKTGKTKRVTNS
FT                   RVQYVVYADGWLYYSNYSRGAYLTKIRPDGSGEQPLNREETKDLFVKDGYLYFTTNELK
FT                   KMAL"
FT   gene            complement(665660..666616)
FT                   /locus_tag="Bsph_0647"
FT   CDS_pept        complement(665660..666616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38267"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH2"
FT                   /protein_id="ACA38267.1"
FT                   /translation="MEPMMKWLLVIDGGATKTACAVVHAETGIMEYSASTKGSNYQAIG
FT                   MEAATAILQELLAKVDTFLQKHAGSQIAVATFALAGIDSPKDKEMVTAIIQNALSATQL
FT                   SIANLIIENDAEATLLGVTAGQAGALLIAGTGAIAYAYDGQQMVRAGGWGHRAGDEGSG
FT                   FWLGQEVVRAIFKMEDGRGETTILKEAVFHSLGIQNVTELAEWLFHPSYTNAQLAKMGS
FT                   FVAQAVEQQDACAIHISRQAAQELAFLAKAVLKKVGYQNGLFPLYCNGGAIKHNPLILK
FT                   TFTDILALTYPQVSISLCEQPPIAYLIERTKRASDCL"
FT   gene            complement(666604..668118)
FT                   /locus_tag="Bsph_0648"
FT   CDS_pept        complement(666604..668118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0648"
FT                   /product="Argininosuccinate lyase 2"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38268"
FT                   /db_xref="GOA:B1HXH3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH3"
FT                   /protein_id="ACA38268.1"
FT                   /translation="MFEDFRNKTQQEDGMIFPSNIYRKIVLQPAYEEAKKNFLTIMLQI
FT                   NIAHLKMLEEQGLVKKEEAKQIGAALKKIDLNYYRLEDYSPQYEDLFFRIENKLIELAG
FT                   DVAGNLHIGRSRNDMGIAIYRMTLRQKLLLLMRELLTLRDDLIAAAEEHVDTIMIGYTH
FT                   TQQAQPTTFAHYLKAVIDQLERDFERMQHVYKTVNRSSMGAAALTTTGFNINRERMRDL
FT                   LAFDDIIENAWDAVAGADYIAEAASIVQLAALNLGRTSQDFLLWATQEFNAFTLASPYV
FT                   QISSIMPQKRNPVSIEHTRSLLSAVVGDASTVLQMVHNTPFGDIVDTEDDMQPYLWRAI
FT                   DRLVGIYKLFGSLVVTMDVNKKKLRNRAENSFANVTELADTLVRSEDISFRQAHSIVSK
FT                   CIKVLLAHSEESLASLTWGLVNTQSKLITGKELNISEEDFYKTLQPESFVGVRTLPGGP
FT                   APATMKAALEQAKMNTKNLYEWIQLKENSIIEAEKELTVFLEEWSQ"
FT   gene            complement(668146..669867)
FT                   /locus_tag="Bsph_0649"
FT   CDS_pept        complement(668146..669867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0649"
FT                   /product="Probable ABC transporter permease protein y4fN"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38269"
FT                   /db_xref="GOA:B1HXH4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH4"
FT                   /protein_id="ACA38269.1"
FT                   /translation="MKKQTANASQESIRTRIFHSNWFIYVLISPLFLVLFAYVVYPFYQ
FT                   TFTQSFAGDERFLHYKKFFNLASPANLEALWTSIYISIISVLCCAIVGVTMAFLLERYN
FT                   FPGRRILAILVLVPMALPPLVGVLSFSFLYGDSGIFPRIFQHLFGLDHVPFSLKGIWGV
FT                   IVVHTFTMYTYFYLTASAAIKGLDPALEEAATSLGAGRIRVWTKVILPMLTPSIVASSL
FT                   LVFMISMASYTAPLMFGVERTMTMQIYLSRTNGNLEMAATQSMILSFVSITFLIIMRWY
FT                   QNRRNYQNLSKGISVHRSEVSSKKIKIAATIASFIGTLILILPILVLILISFSVDGAWK
FT                   TQILPTDYTMDHYMALFTDERTWRPIWNSIQMGIVATFGNIIFGVAAAYAMVRLNFKGK
FT                   TLLDMLIMVPWALPGTVVAVNLIAAFSTENIFAFNQVLIGTFWILPLAYFIRHLPLVFR
FT                   STSASLVQLDPSIEEASRGLGANWWYTFRRIVVPLTFTGILAGTLLALVQSFGEFVASI
FT                   LIYSTSTIPLSVAIFQKLYAFKFGTACAYGVLQICLILVVLIISEKLSKGSAGTAI"
FT   gene            complement(669880..670980)
FT                   /gene="fbpC"
FT                   /locus_tag="Bsph_0650"
FT   CDS_pept        complement(669880..670980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpC"
FT                   /locus_tag="Bsph_0650"
FT                   /product="Ferric cations import ATP-binding protein"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38270"
FT                   /db_xref="GOA:B1HXH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH5"
FT                   /protein_id="ACA38270.1"
FT                   /translation="MNPLLERSFLLKRVTIENVSKQFGQLYGVKDVDLEIKAGEFFTFL
FT                   GPSGCGKTTTLRMIAGFYYPTKGKILFDEQDVTRLQPNKRNIGMVFQNYALFPHMTVDE
FT                   NIAFGLQVRKFSKAEIQHKVDRIRGQVKLSNYGNRKINELSGGQQQRVALARALVIEPD
FT                   ILLLDEPLSNLDAKLREETRIEIKRIQSELGVTTIYVTHDQMEAMAMSDRIMVMENGYI
FT                   KQIGTPQEIYHRPVDRFVANFIGETNLIEGTIEAMEDEELQVKTANGHIFTGRKQQSSP
FT                   ALTHMIGDKVFISIRPESIHLGTGDNTLTGKITFVEFTGISVNYIVDCNAFSLKVMLIN
FT                   SYDQIKKIGEDITITISHDSLYFLGE"
FT   gene            complement(671046..672152)
FT                   /locus_tag="Bsph_0651"
FT   CDS_pept        complement(671046..672152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0651"
FT                   /product="iron ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38271"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH6"
FT                   /protein_id="ACA38271.1"
FT                   /translation="MKKTHILSFFLVFILFALAACSGNDDQKTTNDAANNDKTTDGDKT
FT                   EVAATTPSGKLVIYTGRDEEMVQNVIDQFNKKYPDIEVEFLTMGAQQILERLRGEKANP
FT                   QADFWWGGTQSALIVGANEDLLHAWQPSFIDSLDATHKDVEGRWFGEMLLPEVIMINSD
FT                   LLTKEDGPQDWDDLLDSKWKDQILIRGVLASGTMRTIYSSMIVRQDAHSPDKGYEWLLK
FT                   LDANTKEYTQDPNALYLKLTRQEGSVSLWNLQDILLKKYTTDYPFDYIYPKSGAPILVD
FT                   GVAVVNHAKNLENAKLFVEFLFEKEMVTQLANDYYQIPTRSDIDKASMPEWYQELDLKT
FT                   FDIDWQQMSDKETEWMEYWDNNIKGRGK"
FT   gene            complement(672352..673281)
FT                   /locus_tag="Bsph_0652"
FT   CDS_pept        complement(672352..673281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38272"
FT                   /db_xref="GOA:B1HXH7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH7"
FT                   /protein_id="ACA38272.1"
FT                   /translation="MKIVLKKTNLIYPLLIVIASSSYGILSTIVKVAMQHGFTSAEAVS
FT                   SQYIIGFILVLVMFMLTDRKLPKPSKKGIFILLFAGIFTGTTGIVYGESLKYLPASLAV
FT                   VMLFQFTWIGLLIDCALHKRLPSRPEVISIIILFVGTILAAGVLNVDLSGIPLQGWLFG
FT                   FAAAVTFACFIQFNSRPVEGVTTTSRVLIVSFVALMMISIFLSPEVIWNGKLFMEGLWK
FT                   FGLALGLFGIILPIYLFSIAIPKIGGALASILSAIELPVAVTVSVIVLHEPLTALQIMG
FT                   IVLVIVGMLLPTIIAQRRQNDSLLDVQT"
FT   gene            complement(673285..673848)
FT                   /locus_tag="Bsph_0653"
FT   CDS_pept        complement(673285..673848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0653"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38273"
FT                   /db_xref="GOA:B1HXH8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH8"
FT                   /protein_id="ACA38273.1"
FT                   /translation="MSITIRQAQPQDAHAVVPLIIDAIGDIANRLTGEQSTEAVHQELT
FT                   TLFQRDDNRHSYLNTYVATEDGQILGILVYYYGSHAIVMDANLVKWLEAKNAPSIIVDQ
FT                   EAHEDEAYIDTVCVTPEARGKGIGTLLLQYAEELTKQRGYTKLSLNVEIQKEDARRLYE
FT                   RLGFVITEPWSIIDEPFHHMVKQF"
FT   gene            673994..674941
FT                   /locus_tag="Bsph_0654"
FT   CDS_pept        673994..674941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0654"
FT                   /product="Fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38274"
FT                   /db_xref="GOA:B1HXH9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXH9"
FT                   /protein_id="ACA38274.1"
FT                   /translation="MTKQDKDFILVYGDAFIDYIADDVTNTSFTKYMGGATVNVAAGIS
FT                   RIGAPSALITITGDDEGSQFVRDGLVEEGVKLDYAIFDPAKRVSGVYVHLTEACERIFK
FT                   DYVDETPDLQVEPLQLNEAAFKHASALTVCSGTMFHPTALATTRAAVEMAKDKGAIIAM
FT                   DANIRPLRWSSEEICRETITSFFEDVDILKVTDDELFFLTETTSLEEGIEQLSSYLVPI
FT                   ILVTVGENGTYAVLNGEVIHVPTEKVIPVDTTGAGDAFMAGVLRDVHYNGLPTTKEELV
FT                   RCTSFGNKLGAFAATKAGALTALPYYEDIKHLLK"
FT   gene            674962..675393
FT                   /locus_tag="Bsph_0655"
FT   CDS_pept        674962..675393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38275"
FT                   /db_xref="GOA:B1HXI0"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI0"
FT                   /protein_id="ACA38275.1"
FT                   /translation="MEKNYDVLVKDQIFFGGAKDAETAFEQEAVDVVIDVRVQGLTSEE
FT                   QGAISYSYKHMPIADEEIAVASSIQHVAKEIASSYEAGQKVYVHCGSGGGRAGVAATAA
FT                   LIELGLANSLEEAEAAVKKARPQVTIRPKMEEALQKLYK"
FT   gene            675606..675809
FT                   /locus_tag="Bsph_0656"
FT   CDS_pept        675606..675809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0656"
FT                   /product="YxlE"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38276"
FT                   /db_xref="GOA:B1HXI1"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI1"
FT                   /protein_id="ACA38276.1"
FT                   /translation="MMEELAKVPWAVIAPLIVVQLILMIVALIDLRKTHATNGPKILWV
FT                   FIILFTNIIGSIAYFIVGRKQA"
FT   gene            675806..676690
FT                   /gene="yxlF"
FT                   /locus_tag="Bsph_0657"
FT   CDS_pept        675806..676690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yxlF"
FT                   /locus_tag="Bsph_0657"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38277"
FT                   /db_xref="GOA:B1HXI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI2"
FT                   /protein_id="ACA38277.1"
FT                   /translation="MTTLLQVTGLTKRFAEHNVVDDVQFMLEEKTSTALIGPNGAGKTT
FT                   TLSMLTGLLTPTAGSVKMLNGDLRENIGFLPQYPQFHPWLSALEFTEMAARLNGVSAKN
FT                   AKLEAQKTLEFVGLGNAQHKKIDTFSGGMRQRLGISQAIVHKPKLLLLDEPVSALDPVG
FT                   RREVLDLLKGLQQETTILYSTHILNDAEEMTDQLLFLQNGKLVEQGTLREVRQRFDEQN
FT                   YIVEFSSEEEAKLFASSTDHVVGCYVYIEILNEEPTMRELLHRLSNCPYTIRKVERQTA
FT                   SLEEIFMKVAKKA"
FT   gene            676687..677469
FT                   /locus_tag="Bsph_0658"
FT   CDS_pept        676687..677469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0658"
FT                   /product="putative ABC-2 type transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38278"
FT                   /db_xref="GOA:B1HXI3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI3"
FT                   /protein_id="ACA38278.1"
FT                   /translation="MRGFNVLLQKEFREAWRSWKFLWIPLVFALLGMNDPLINYYIMDI
FT                   LNAVGNVPEGFEMLMPELMPVDLLQASIGQFQTIGLLVIMASFVGIISKERASGMATLL
FT                   YVRPISFGAYFMSKFIVMSAVCFVSILAGFAASVYYTSILYGTLEIGPLLASFCTYYVW
FT                   LIFVIAVTLMMSASFKTIIATTCAFTVIFGGQIVDMVVGLFWTISPWKLANYGPLLVRG
FT                   TMEMSDYWWSLIMTLALIILCICLGIIMMKKNAAMTKI"
FT   gene            complement(677675..678121)
FT                   /locus_tag="Bsph_0659"
FT   CDS_pept        complement(677675..678121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0659"
FT                   /product="spermine/spermidine acetyltransferase, putative"
FT                   /EC_number="2.3.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38279"
FT                   /db_xref="GOA:B1HXI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI4"
FT                   /protein_id="ACA38279.1"
FT                   /translation="MKEICLKPIDKSNWEEAIRLSVKEEQQAFIASNLYSIAEVQFLDN
FT                   FFAKGIYLNNKMIGFTMFGIDPDDNNYWIYRLMIDEEFQGKGIGKQAIYLVIEEIRKNN
FT                   HANIPFIMIGYDPKNLTAKFAYKRAGFIETELSSWGEQLAKYSL"
FT   gene            complement(678464..678607)
FT                   /locus_tag="Bsph_0660"
FT   CDS_pept        complement(678464..678607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38280"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI5"
FT                   /protein_id="ACA38280.1"
FT                   /translation="MNIPRTQFLLSFIFTFSLESYVITKKMDYFSQQVRQMMDIGFTVS
FT                   MN"
FT   gene            678696..679400
FT                   /locus_tag="Bsph_0661"
FT   CDS_pept        678696..679400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38281"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI6"
FT                   /protein_id="ACA38281.1"
FT                   /translation="METENSDRFLTAFNRIDHRLRDIVGIKDFTPFYRLIDQAKKKEVL
FT                   VKKYEDDLRSYADLRNAIVHHRTSINYVIAEPHTDVVERIEYIDATLAKPTLVGQMFRK
FT                   RVLVFQENDSLKHVLKVIHQRKYTQFPVYFNKQFRGLITTVGITNWLASKMGGDYLPKG
FT                   IPTLHDILMHEKNRVNYKFVSRYITIYQAEEIFKQGVERGRRFEALLITEHGKPHQKLI
FT                   GIITPLDIVKID"
FT   gene            complement(679418..680137)
FT                   /locus_tag="Bsph_0662"
FT   CDS_pept        complement(679418..680137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0662"
FT                   /product="protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38282"
FT                   /db_xref="GOA:B1HXI7"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI7"
FT                   /protein_id="ACA38282.1"
FT                   /translation="MESFIHANFWEMILRTTLSFFILLILARILGKKQLGQLTFFHYIT
FT                   GITFGSIAAEIASQEETPFLDGIISLVWWSALTYLMTIITIKSKKARVLIDDKPTIVVQ
FT                   NGLILESALRKNRLHMDELTMMLREQAIFSVQDIHYALLETNGKLSVLQKTSEQVATKQ
FT                   DVKADVTPPTYLPTEVISDGQLIKENIVELELTEDWVMKKLKKQNVHSVEDVFFAQVQT
FT                   NGSLYISLKDKARHSSP"
FT   gene            680244..681449
FT                   /locus_tag="Bsph_0663"
FT   CDS_pept        680244..681449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0663"
FT                   /product="Fosmidomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38283"
FT                   /db_xref="GOA:B1HXI8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI8"
FT                   /protein_id="ACA38283.1"
FT                   /translation="MNNQINVANPIYPIMILIGVAHLINDTMQAVIPAMFPIFKSELGL
FT                   TFTQIGLISFVLNIFASALQPIVGFVSDKKPMPYALPIGMVSSFIAITIIAFTTQYWII
FT                   LIAVLFLGFGSAIFHPEGSRVSFMAAGSKRGLAQSIYQVGGNSGQALAPLISAYIFDIF
FT                   GQRGAAIVLVAATFGIILLTKIARWYKKQLEQERAAKKKRVLVSTLPPLTKKQVGVALT
FT                   LLFTIIFARSFYTTNITSFYVFYLMDHYDVNLRLGQILIFLFMAFGVVGTFFGGSLSDR
FT                   IGRKNVIILSVVVPMPFCLALPYVPLWAAMIFLVIIGTLIMISFSVTVVYAQELVPSKI
FT                   GTMAGLTTGFAFGMGAIGAMVIGVLMDHKGIDFTMMVVSLLPLLLLIAFFLPKDKPASS
FT                   AA"
FT   gene            complement(681661..682347)
FT                   /locus_tag="Bsph_0664"
FT   CDS_pept        complement(681661..682347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0664"
FT                   /product="osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38284"
FT                   /db_xref="GOA:B1HXI9"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXI9"
FT                   /protein_id="ACA38284.1"
FT                   /translation="MRHVKGRLDESILVCVYYGLNGERLIRRGHKMATMLDCPLYILSV
FT                   DSQPLDAFDAEKSSYIEQWEKLSDELEVEKFILQDNEKRPIQKVIAEVAKNYGISQIIV
FT                   GQSAQSRWEEITKGSFLNVLLKEVPFVDFHIVAVQRPTDDDANETYEKGVRAYLIKEQE
FT                   NFKVAFTCPKYVSIEGIFFKEIGTDFDNGVFKFTYNDKMHEVHISEGYVIDQEKLPAEF
FT                   LSPLRQ"
FT   gene            682924..685308
FT                   /locus_tag="Bsph_0665"
FT   CDS_pept        682924..685308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0665"
FT                   /product="Na(+)/H(+) antiporter subunit A (Multiple
FT                   resistance and pH homeostasis protein A) (Mrp complex
FT                   subunit A)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38285"
FT                   /db_xref="GOA:B1HXJ0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR005663"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ0"
FT                   /protein_id="ACA38285.1"
FT                   /translation="MPFVCAALIPLLYRRLRHITHLGWFVFSVPFILFLLLTRYIPQIA
FT                   GGKTFIHTYEWIPSFNINITTYLDGLSMIFGLLITGVGSLVILYSIFYLSTKESLHHFY
FT                   CYLLLFMGAMLGVVFSDNLMVLYTFWELTSVSSFLLIAFWHHRKASRAGAKKAMMITVF
FT                   GGLSMLAGFLMLYVAADTFSIRDIVAHVGVIRDHALFTPALILILLGAFTKSAQFPFHI
FT                   WLPDAMEAPTPVSAYLHSATMVKAGIYLVARFSPVFGGEAIWFWLVSVIGLVTLFWGSF
FT                   NAVRQTDLKALLAFSTVSQLGLIMSLFGLGSVGHYYGYTKDSIVYTQASFAALFHLINH
FT                   STFKGALFMMVGIVDHEVGTRDIRRLGGLMSLMPITFTIAVIGSFSMAGLPPFNGFLSK
FT                   EMFFAAVLAIRDVEAFSIADLGLFFPLVAWVASIFTFVYSLILISRTFLGKLQPEKMDR
FT                   KPHEAPLGMLLSPIVLCLLVVGIFFFPNVLGHYILEPAMASIYPTFPTTYELTPHISAW
FT                   HGINAELLMTLGVIVLGFILFKTLKSWKPVYRIFSQKYTFNTYYNRMIEISESGSEKLT
FT                   RKYMTGNLTHYFVYIYVFFVALIAGYFIWSDAMTFNFDMDSTIESYELILVFVMVFAAV
FT                   WMIFAKGRVTAMLLNGVLGYSIAFFFVIFRAPDLALTQLVVESVTTALFLLCFKYLPDL
FT                   MPEAPRKRVQWSKAMISIFVGATVTMVGLAVVHYEQFEPVSSYFNDAYELAGGSNIVNT
FT                   ILGDFRAFDTMLEVVVLLIAGLGVYTLTKLKPRKEEADYEN"
FT   gene            685298..685720
FT                   /locus_tag="Bsph_0666"
FT   CDS_pept        685298..685720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0666"
FT                   /product="Na(+)/H(+) antiporter subunit B (Multiple
FT                   resistance and pH homeostasis protein B) (Mrp complex
FT                   subunit B)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38286"
FT                   /db_xref="GOA:B1HXJ1"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ1"
FT                   /protein_id="ACA38286.1"
FT                   /translation="MKINDVILRTVTKAVVFIILTLGVYLFFAGHHAPGGGFIGGLVLA
FT                   SGIVLLYLAYDIETVHKGMPFDFKKVAALGVLLATSTAIGSLFFDVPFLTQAYTYINVP
FT                   IFGKMGFSTVTIFEAGVALTVVGVVVTIILSISEDE"
FT   gene            685724..686062
FT                   /locus_tag="Bsph_0667"
FT   CDS_pept        685724..686062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0667"
FT                   /product="Na(+)/H(+) antiporter subunit C (Multiple
FT                   resistance and pH homeostasis protein C) (Mrp complex
FT                   subunit C)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38287"
FT                   /db_xref="GOA:B1HXJ2"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ2"
FT                   /protein_id="ACA38287.1"
FT                   /translation="MESLILVLVGILVAVATYLILSKQLLRVILGTAVLSHAAHLLILT
FT                   MGGLKKGDVPLLGESEGPYTDALPQALILTAIVISFAVTAFVLVLGYRAYKTNGSGNLD
FT                   ELRGTPDE"
FT   gene            686064..687560
FT                   /locus_tag="Bsph_0668"
FT   CDS_pept        686064..687560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0668"
FT                   /product="Na(+)/H(+) antiporter subunit D (Multiple
FT                   resistance and pH homeostasis protein D) (Mrp complex
FT                   subunit D)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38288"
FT                   /db_xref="GOA:B1HXJ3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ3"
FT                   /protein_id="ACA38288.1"
FT                   /translation="MIVLPLIVPVITAILLVFLKEHVFLQRIISLLTLSFIVIISVILL
FT                   VEIQEQGIMRIDFSGWAPPFGISFVADSFATLLVLVANLVAVICMLYAIFTMELRYEKM
FT                   YFYPFTLLMVAGVNGSFLTGDIFNLFVCFEVMLLASYALISLGGEKIQLREALKYVLIN
FT                   IVASWIFLVALAFLYGTVGTLNMAHISVRVMEAGANPLITTVALIFLIVFSLKAGLLLF
FT                   FWLPGSYSVPPTAIAALFAALLTKVGIYALVRTFTLLFPNNTEVTHMALGIMAGITIVA
FT                   GCIGALSGRDVRTIASYNVLIGVGFIVAGLAMGTESALQGIVYYLMHDMVAKAMLFIAV
FT                   GMMIYVTGETVIDKMSGLIRNYPFFGWLFFLAMCSLAGIPPLSGFLGKVLIGQGAIEGG
FT                   NFVLLGLGFFSSLIVLYSLLRIFLSSFFGETIISLEDEKPLPKRVILPLTLLAACTISL
FT                   GIGAEKLAPFVTDAAETLYTPSIYIDAVLDGEQWQGEVNK"
FT   gene            687560..688042
FT                   /locus_tag="Bsph_0669"
FT   CDS_pept        687560..688042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0669"
FT                   /product="Na(+)/H(+) antiporter subunit E (Multiple
FT                   resistance and pH homeostasis protein E) (Mrp complex
FT                   subunit E)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38289"
FT                   /db_xref="GOA:B1HXJ4"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ4"
FT                   /protein_id="ACA38289.1"
FT                   /translation="MAMQFILNLFIAALWLLLQDEVTPQFSTFLMGFIVGMGILYAMHR
FT                   FYGTQFYLRRVFSIIKLLWLFNWELFLSSYSVLKQITTPKLNITPGIFTYKTALKGDWE
FT                   ITALALLLTLTPGSVVMEVSEEGDVFYIHAMDIEQSKDAVIRSIGKFEQAIMEVTR"
FT   gene            688129..688326
FT                   /gene="mrpF"
FT                   /locus_tag="Bsph_0670"
FT   CDS_pept        688129..688326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrpF"
FT                   /locus_tag="Bsph_0670"
FT                   /product="multiple resistance and pH regulation related
FT                   protein MrpF"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38290"
FT                   /db_xref="GOA:B1HXJ5"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ5"
FT                   /protein_id="ACA38290.1"
FT                   /translation="MPDRAIALDTIGVNLLSAIAIVSIILKTKAYLEAILILGILAFIG
FT                   TIAFTKYIERGVIVERKSND"
FT   gene            688319..688669
FT                   /locus_tag="Bsph_0671"
FT   CDS_pept        688319..688669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0671"
FT                   /product="Na(+)/H(+) antiporter subunit G (Multiple
FT                   resistance and pH homeostasis protein G) (Mrp complex
FT                   subunit G)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38291"
FT                   /db_xref="GOA:B1HXJ6"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ6"
FT                   /protein_id="ACA38291.1"
FT                   /translation="MIEWAAVILILIGSVVSVISAFGMIRLPDVYTRSHAATKSSTLSV
FT                   LTCLLGTFIYFWVHDGYVSVRLILGILFVFVTAPVAGHLICRAAYRSHVPLAEGSGEDE
FT                   LKDKLFTEKNKH"
FT   gene            688967..689758
FT                   /gene="yqiX"
FT                   /locus_tag="Bsph_0672"
FT   CDS_pept        688967..689758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiX"
FT                   /locus_tag="Bsph_0672"
FT                   /product="Probable amino-acid ABC transporter
FT                   extracellular-binding protein yqiX precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38292"
FT                   /db_xref="GOA:B1HXJ7"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ7"
FT                   /protein_id="ACA38292.1"
FT                   /translation="MKNKLFMMILVLAIGVLAACGAKEDDANNSNADSSTDKQVLKVGT
FT                   SADYAPFEYVDAAKGEEIIGFDIDLIKLVGEKIGVDMQVQDMDFNSLVPALQAGKIDVV
FT                   ISGMTPNPEREKVVDFSDQYNETEQVIIVKKDSGIKKEADLAGKKVGVQTASIQENLGN
FT                   EIAKKVDVSVEGRTRIPEIIQDMMSKRLDAGILEGGVAKGYLKTNDQLAAFPVEEQPED
FT                   FKAIAVPKGSNLKEKINKALKELAEEGKIQELEEKWLEKVE"
FT   gene            689855..690538
FT                   /gene="yqiY"
FT                   /locus_tag="Bsph_0673"
FT   CDS_pept        689855..690538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiY"
FT                   /locus_tag="Bsph_0673"
FT                   /product="Probable amino-acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38293"
FT                   /db_xref="GOA:B1HXJ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ8"
FT                   /protein_id="ACA38293.1"
FT                   /translation="MKKKGGSAVNLDFTAIVPSIPYILKGIGVTLQIAIGASIIGFIVG
FT                   ILLALCKIGKVKVLRWFADFYTSIFRGTPLVLQLLIIYYAVPQLLDIQIEPIPTAIIAF
FT                   GLNSGAYISEIIRAGINAVDKGQMEAAQALGIPYAKMMKDIIIPQAVKNILPSLVNEFI
FT                   TLNKETAVVTVISALDIMRRAYIVGGSTYRYLEPLLFAGIIYYLMTLVLTFLGKRIEKG
FT                   MRKSD"
FT   gene            690531..691253
FT                   /locus_tag="Bsph_0674"
FT   CDS_pept        690531..691253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0674"
FT                   /product="polar amino acid transport system ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38294"
FT                   /db_xref="GOA:B1HXJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXJ9"
FT                   /protein_id="ACA38294.1"
FT                   /translation="MIKIEDLHKSYGQNEVLKGISTEVKEKEVIAIIGPSGSGKSTFLR
FT                   CLNLLEIPTSGKVTIAGDVLTDKGTNIMKIREEVGMVFQHFHLFPHKTVLENLTYAPIN
FT                   VKGMDKVVAIQNAEELLKKVGLFEKRQEYPNRLSGGQKQRVAIARALAMDPKVILFDEP
FT                   TSALDPEMVKEVLAVMKNLADSGMTMLIVTHEMGFAREVADRILFLDGGKLIEDAPPEQ
FT                   FFTAPSTQRAKDFLEKVL"
FT   gene            691666..692391
FT                   /locus_tag="Bsph_0675"
FT   CDS_pept        691666..692391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0675"
FT                   /product="Hypothetical metallophosphoesterase ykuE"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38295"
FT                   /db_xref="GOA:B1HXK0"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK0"
FT                   /protein_id="ACA38295.1"
FT                   /translation="MFESEKVPASFDGLRIVQVSDLHDALFGNNQEKLIAKVKETNPDY
FT                   IFITGDVIDSNRYDLNQSLQAVKGLVDITDVYYVLGNHEVATNKVSEIYEALSSLGVHI
FT                   LANESTVLERDGERLAIVGIEDPLMGRSTEDMLELATAYLPDDMFKMLLAHRPEVFNTY
FT                   VNDGIDLVFSGHAHGGQVRIPGLGGLVAPGQGLFPKYTAGVYDEGITKMVVSRGLGNSS
FT                   VPYRIFNLPEIVVMDLKKK"
FT   gene            complement(692413..693258)
FT                   /locus_tag="Bsph_0676"
FT   CDS_pept        complement(692413..693258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0676"
FT                   /product="Sec-independent protein translocase protein
FT                   tatCd"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38296"
FT                   /db_xref="GOA:B1HXK1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK1"
FT                   /protein_id="ACA38296.1"
FT                   /translation="MDPYEDGKRKFLSPLDKPQAEPPLPMEALVEIQAVKMEDQQVAEE
FT                   PIIPVTSLLEHLSDLRKQIIKGLTVFILFFIVVFSTINIWFPFVTRGHSLIILGPLEVV
FT                   KFYMTISTTLSFGLAMPFLVHFLWSFVKPGLKETESRFLGLYAPVMLALFLLGIAFGYF
FT                   VVNPLSYSFLVGIGATNFDVMVSASEYMHFLIMTTVPLGLLFELPIVALFLSAIGVLSA
FT                   ESMRKIRGWSYIVMGICSAVITPPDFISQLLVLIPMIILYEISIYLVKRLERKQIESTA
FT                   "
FT   gene            complement(693270..693473)
FT                   /locus_tag="Bsph_0677"
FT   CDS_pept        complement(693270..693473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG: Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38297"
FT                   /db_xref="GOA:B1HXK2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK2"
FT                   /protein_id="ACA38297.1"
FT                   /translation="MGGLGAIGVPGLVIILVIVLIVFGPRKLPEIGGAVGKTFAEFKKS
FT                   TKGLMEDDDDSVKKVEKKSDVS"
FT   gene            complement(693516..695228)
FT                   /locus_tag="Bsph_0678"
FT   CDS_pept        complement(693516..695228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0678"
FT                   /product="Gluconate 2-dehydrogenase flavoprotein precursor"
FT                   /EC_number="1.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38298"
FT                   /db_xref="GOA:B1HXK3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK3"
FT                   /protein_id="ACA38298.1"
FT                   /translation="MAKTLPSVDVVTVGVGWTGGIVAAECAKAGLKVVGLERGQKRGTE
FT                   DYLNVHDEYRYAIRYDLMQNLSKETVTFRNDRNMKALPMRQLGSFLLGEGLGGSGTHWN
FT                   GMTFRFLPYDFQIKTLTDKHYGPNKLGPEYLIQDWGLTYDQLEPYMDKFEKTAGISGDD
FT                   KNTFSGKRSNPYPTGPMKKTPMLMQFEKAAQDLKLTPYMVPSANVSEVYKNPDGETINA
FT                   CQYCGFCERFGCEYGAKSSAEITVVPTALKTGNFDLRYNSNVVEILKQGNKVTGVRYID
FT                   TVSGEEFIQPTNAVVLTSYVFNNAKLLMVSDIGERYDPTTGKGTLGRNYCYQILPGAVG
FT                   FFDEQYNTFMGAGSLGMCVDDYNGDNFDHSDLDFIHGGNIALTQTGTRPIGSNPTPPDT
FT                   PTWGPEFKKQSIHYYTRSFGIGAQGASMPHKQNYLTLDPTYKDAYGLPLMQLTYNFTDQ
FT                   DRALHKFISARAADIMKQMGAKTIVPNAEITDYNIVPYQTTHNTGGTVMSLTPEQGVVN
FT                   NYLQHWDVDNLFAVSAGNFAHNSGYNPTGTLGALAYRCAEGVIKYSQSGGSLV"
FT   gene            complement(695241..695990)
FT                   /locus_tag="Bsph_0679"
FT   CDS_pept        complement(695241..695990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0679"
FT                   /product="Gluconate 2-dehydrogenase subunit 3 precursor"
FT                   /EC_number="1.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38299"
FT                   /db_xref="GOA:B1HXK4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK4"
FT                   /protein_id="ACA38299.1"
FT                   /translation="MSSDKNNVSRRDFLKTTGIAAGTLVGGGLIGGLVGYNINGKGTST
FT                   LEHGGHGTTNEALGSPKAKMFFRNERDFSILSKATERIFPEDDLGPGAIGLDVPYFIDH
FT                   QLAGNYGSNSKEYMQGPFDVGTPTQGYQSRLTRAEIFRQGIQKMEDEAQKRYKKSFNDL
FT                   DGEQIDEILTAFQKGEVEMVGVQSAFFFTLLRAATLEGAYSDPMYGGNRNMEGWRMKNF
FT                   PGHQMAYISQIEDSKFQKIEPKSLGNH"
FT   gene            696318..698315
FT                   /locus_tag="Bsph_0680"
FT   CDS_pept        696318..698315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38300"
FT                   /db_xref="GOA:B1HXK5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK5"
FT                   /protein_id="ACA38300.1"
FT                   /translation="MWIKGIGGKLVVAIIALVFVTCGTLGLSTWINSTKAMNEQVETNL
FT                   VSRAGDVSQYIEEHFQLTLVEVEAIAEQEAVRSMDFEKQKQYLSKRLADNKNYLGFGII
FT                   KADGVAHYLDDTTADLGDRDYVKEGFTGNSVMSEITISRVTGEPVILIVSPIDTVSGEK
FT                   ALLLARIDGYYLSNIVEDIKVGNSGYAFMLDANGTIIGHNNHSYVKEQNNPIKEAEETG
FT                   VMTGRALAAKEMIANKSGYFSFETEDAGTNLMGYHTLDNGWKMGVVALENEMFSGLSKL
FT                   KTNFIVTTIIVSLLGLIISFAISRSVSRPLRHVLRISEGLSEGDFTQEIPEKYLKRIDE
FT                   MGTMSRALDRMTDNMREMIAKVSHEATTVNEASCDLMGDVMAVTKHSEQIAGAINEVDR
FT                   GAQSQTVMAEESASAMEQMALGIQNVAEVASTIASNTDFISQKISESNHAVQQSICRMN
FT                   EIQEGTTAELMIIHKLEKESEEINLISNMITAISEQTNLLALNASIEAARAGDAGKGFA
FT                   VVAEEVRKLSEQTAESATKINVLIERVQSYTLEVVKAAESGEDNVERGLASIEAVGERF
FT                   EEIVRAVGEIAGQVEEMNASAEQMSANTEEVSASMEEMAATAHAASDYVHEVTDATTEQ
FT                   LKTVTTMNNQTEKLSEMAKRLYEAIQKFKY"
FT   gene            complement(698363..699643)
FT                   /locus_tag="Bsph_0681"
FT   CDS_pept        complement(698363..699643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0681"
FT                   /product="Alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38301"
FT                   /db_xref="GOA:B1HXK6"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK6"
FT                   /protein_id="ACA38301.1"
FT                   /translation="MGQLEKPYTPVSNYAKINWNQPCINRIYIKGGFFLKNLLYYQDVM
FT                   LREFDAHIVSKEIDELGRHYVVLSNTAFYPTGGGQPHDTGTLNGIDVIDVEKNGEEIRH
FT                   YMQGDISELKGIVHGTLNWSRRFDHMQQHAGQHILTAAFVELFDAQTVSFHLGSQHVTI
FT                   DIAVDTLTEQQLAAAEARANEVILENLPIETTWITENELVHYHLRKEVAVAGDIRLVII
FT                   PNYDYNGCGGTHPTSTGQVNAIKILGTEKMKGNVRVSFVCGQRVLHELAMRKKVLGDVA
FT                   RQLSVPEVEAATALTKILSAQKHTERALVAAKEELLTYEAKALVSNSGNLMTAAFQQRT
FT                   MQELQKLARTIVSEHDDMITLLVSESEGKLQFVAARGKNVSKSMKAIAEKALPLINGKG
FT                   GGSDQMVQGGGECIISKEELLEAIQNI"
FT   gene            699695..699985
FT                   /locus_tag="Bsph_0682"
FT   CDS_pept        699695..699985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0682"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38302"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK7"
FT                   /protein_id="ACA38302.1"
FT                   /translation="MMEITQFSMEEILDPTNIMEGKRYEFILDIEIDEEDELYHEAGIE
FT                   IRVLIGEKAEEPYILNYFIMEKAEGEYLDFALEDDELEEILVFCKEEIAKA"
FT   gene            700241..701386
FT                   /locus_tag="Bsph_0683"
FT   CDS_pept        700241..701386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0683"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38303"
FT                   /db_xref="GOA:B1HXK8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK8"
FT                   /protein_id="ACA38303.1"
FT                   /translation="MSTYTQSILIAFFITIILSFILFIPWLIYTYRKYSYLSMSKTIIM
FT                   FSFIFYFLSALCLVLLPFPSTRDTCSLQSPDTVHTNLRLFQFIEDILKGSGVVLTSPST
FT                   WLVITKQQAFYQAFFNFLLLMPFGVYLRYFLQERRYWKRAFLLSFLLTLFYEITQRTGI
FT                   YGIFNCAYRIFDVDDLLLNSVGALLGFFLAPIVWALFPSHEEVEAKAAEMEKSDIVKPI
FT                   SVLLALVIDLFIVQVIWFIIGTLTGYSGTFEFLVIIALYMAIFGFIPSLMNGATLGMKI
FT                   MRFTMVNKKGKSIVRQSWKRCIAIVATVLLSEAITTVGNIQLDMDSPFYVLQILISLLA
FT                   SLGGFALTMIIAIHVIRVIVSGGKRRLYIDQYADLMATKKK"
FT   gene            701400..702734
FT                   /locus_tag="Bsph_0684"
FT   CDS_pept        701400..702734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0684"
FT                   /product="Coenzyme A disulfide reductase"
FT                   /EC_number="1.8.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38304"
FT                   /db_xref="GOA:B1HXK9"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXK9"
FT                   /protein_id="ACA38304.1"
FT                   /translation="MKYVIIGGDAAGMSAAMEIYRNVPGAEITTLERGFIYSYGQCGLP
FT                   YVVDGRISSTKRLIARDVETFRGKYGIDARVGYEVEKVDIENKVVSGIQASGEVFEISY
FT                   DKLLIATGADPVVPVRSGVNLEGIHTVKTIPQLEDLMADLTPDIEQVTIIGGGYIGLEM
FT                   AETLQTCGKKVRLVQRGSHVAKILDEELAQHVHEEAKKNNVELLLNTDVEAFEGNKRVE
FT                   RVITNNGILETDLVIVASGIRPNTKFLEGTGIAFAKNGAIIVNRHLETSVENVYAAGDC
FT                   ATHFNIVKERIDYIPLGTTANKQGRLAGLNMSGKFAPFRGIVGTSILKFFNLTIATTGI
FT                   NERHAKELGFDYEAFKLSARHIAGYYPGAQRMYIKVVVRKRDQLLLGAQIVGPAGVDKR
FT                   IDVFATALYSKMTLPDLLDLDLAYAPPFNGVWDPLQQVARMNGRL"
FT   gene            702773..703225
FT                   /locus_tag="Bsph_0685"
FT   CDS_pept        702773..703225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0685"
FT                   /product="Glutathione peroxidase bsaA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38305"
FT                   /db_xref="GOA:B1HXL0"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL0"
FT                   /protein_id="ACA38305.1"
FT                   /translation="MTLEDGTDYSLERYKGKPMLIVNTASKCGFTPQFEELEGLFEKYQ
FT                   DEGLVVLGFPSNQFKQELATAEEAASQCRLEYGVTFPMHKIVKVNGKEAHPIFDYLTSH
FT                   SKGFLGNSIKWNFTKFLVNRDGEVVGRYASADKPSSFEDDIKKVLA"
FT   gene            703399..704166
FT                   /locus_tag="Bsph_0686"
FT   CDS_pept        703399..704166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0686"
FT                   /product="ABC transporter (ATP-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38306"
FT                   /db_xref="GOA:B1HXL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL1"
FT                   /protein_id="ACA38306.1"
FT                   /translation="MTPLLKVQNVEKTYGKGANTFTALSNISFEVKKGEFVGVMGPSGA
FT                   GKSTLLNVLATIDTPTTGEIIIGDTNLARMKDAELADFRRDNLGFIFQDYNLLDSLTVR
FT                   ENIVLPLAIAKMPTKAISARVDRIASLFGISDLLDKYPYQISGGQKQRTASSRALVTEP
FT                   KLIFADEPTGALDSKSATDLLESLSDLNQSQAATIMMVTHDAFAASFCQRILFIQDGQL
FT                   SKEIHRGTLTRKQFFQEILQVLSSIGGGVNDVI"
FT   gene            704153..706021
FT                   /locus_tag="Bsph_0687"
FT   CDS_pept        704153..706021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0687"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38307"
FT                   /db_xref="GOA:B1HXL2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL2"
FT                   /protein_id="ACA38307.1"
FT                   /translation="MTLFSLARKNIQRNLSNYFLYIASMVFSIVIYFTFVTLKYNDDLS
FT                   ALKQSSQQIKGLMSASSVVLLFFIVIFMAYSNSFFMKKRKKEVALYSLLGVRKQKIGLL
FT                   LFFENLVIGLVSLVLGIVLGFFMSQGLLMILVRLMGYEIVGNLTFSIEALVNTTVIFTV
FT                   LFLFTSLQGYRVIYQFKLIDLFHAEKQGEQIPRASLVAAVLGTALIAFGYYTAASDMFT
FT                   SEIWRFFTVLGTPLMVIGVTIVGTYLLFHSVSVFVLTALKRATSWSWKGLNLIGVSQLL
FT                   YRIRANAKSLSIIAILSATTITAGGGVFGMYYNAEATVRQMLPNTFMWKGDPVDFSQKD
FT                   VIYNESLSVKNLRVDNEFSFFEYTLLKESDYNRLAKLQGKDQNLHIADGSTVLLDAAYD
FT                   ERFSHDFTGENFKLKNGDSFHVEKMYTESVLNFIPAGTVLVVNDQEFAATNAEEIKMQA
FT                   IGLDNDLKQQVVSQDIIKQLSTEQQESFSSVPQSYEDSIATVGALLFVGSFLGLVFLAA
FT                   TGSIIYFKILTEAEEDQAKYAILNKIGVNSKQILKTVAGQVAVIFSAPLIVGIVHSAFA
FT                   LLAFSQLFGMNITKPVILWMIAYSAIYFIYYIFTVRSFYKIVRQGN"
FT   gene            706023..706382
FT                   /locus_tag="Bsph_0688"
FT   CDS_pept        706023..706382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0688"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38308"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL3"
FT                   /protein_id="ACA38308.1"
FT                   /translation="MKKVFFGIGALLILFVAGLVVLMTVDFNRLNKDTYYVHITADGEV
FT                   EEYKASNGEIFKMYWYELPAYNKNGKEKTLKFSAHKNLRHDAYLKLYVKKETEVTSYDE
FT                   VKFHEVPNKAQDQMK"
FT   gene            complement(706408..707748)
FT                   /locus_tag="Bsph_0689"
FT   CDS_pept        complement(706408..707748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0689"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38309"
FT                   /db_xref="GOA:B1HXL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL4"
FT                   /protein_id="ACA38309.1"
FT                   /translation="MIIVIFVNTAILIGLLSYKLNNDSDRATESKEEDFVRNFQQYIEI
FT                   ENGETSISAEGLEQLHMRNAWIQLLDVNGQVIDSHFAPEEAPSHYAPVDLIQVYKYKEF
FT                   DADTTVYVGVKDEISYLVGVKGSEVERLVMHISGTSFLQFVGKFGLFIVIADLIVAALV
FT                   GWLFGRTLTTPLYALIERIRHLKNHEHQPVKTPGGVYKTVFENLNEVSRELAAHEQERK
FT                   RLELMREEWISNVSHDMKTPLASIRGYAELLDDETLTSQEKAEYAQIIEKQSLHMQNLL
FT                   DDLNLTMRLRHQQLPLTLKEVNMVPFIREIVIDTLNTPQFELANIDFEAISENHHQLID
FT                   EHFMRRAIINFLHNALLHNTPDVSVHVSVDKDSITIADNGKGISSEDLEHIFERYYRGT
FT                   NTDNTAGTGLGTAIARDIIEAHGGFVTITSEKGKGTIVSINLKKEQH"
FT   gene            complement(707793..708515)
FT                   /gene="mrsR2"
FT                   /locus_tag="Bsph_0690"
FT   CDS_pept        complement(707793..708515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrsR2"
FT                   /locus_tag="Bsph_0690"
FT                   /product="probable two-component response regulator;
FT                   probable MrsR2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38310"
FT                   /db_xref="GOA:B1HXL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL5"
FT                   /protein_id="ACA38310.1"
FT                   /translation="MQEPTILVVDDEADLANLLKVSLQKEGYKQIYTAGSIHDAWTSFQ
FT                   QTSPDIVLLDVMLPDGEGYDLCRRIREISHVPVLFMSAKNEEIDKILGLAIGGDDYITK
FT                   PFSPKEVAYRVKAQLRRVGYQTHETTSGMAEKTIQVGPFQLNADETEVHKDGILLELTA
FT                   KEIGLMACFMHNPHRILSKETLFERVWGEDFFGSDNTVMVHIRRLREKIEQDASKPIFI
FT                   TTVKGLGYKFVIPKEAQE"
FT   gene            708725..709345
FT                   /locus_tag="Bsph_0691"
FT   CDS_pept        708725..709345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38311"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR021722"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL6"
FT                   /protein_id="ACA38311.1"
FT                   /translation="MAMFKKIAADALGLSDIGVVVQREDYDKTDADDFILHEIDEKIYF
FT                   LIKTKADEYCFTNRAILHVDGESAMSKKRLLRRYDYSMFAITDVFLETAGTIDLDVEIK
FT                   FTIGNSPLSIDIHKRFIDDIKDLYKALHAISYEQKNNAYKLEVAEKSLHIASSSLGRIG
FT                   NDNISPSASFEAITRFANTWMIDHKDQYKKEDFSHIFDLYMNN"
FT   gene            709467..710822
FT                   /locus_tag="Bsph_0692"
FT   CDS_pept        709467..710822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0692"
FT                   /product="acetamidase/formamidase"
FT                   /EC_number="3.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38312"
FT                   /db_xref="GOA:B1HXL7"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:B1HXL7"
FT                   /protein_id="ACA38312.1"
FT                   /translation="MTNELHVLDKEGLESDFIQQPQAAETLFVNEFIDGILDPSQEMLG
FT                   PVKDGGTIIANTTPGCWGPMLTPTIRGGHEVTKPVFVEGAEVGDAIVIKIKSIQVTSMA
FT                   TSSGHDEPITDRFIGDPFVSVKCPGCGKLHPSTVVKGIGPQAIRCSTCDTDTAPFNMTN
FT                   GYTMAFDHKGHIGVTVGREGARRIALDAKNYMRTPENSIQNPVVALAPSDIVGVMARMR
FT                   PFLGQLGTTPSKAMPDSHNAGDFGSFLIGAPHEYAFTQDELDLHRTDGHMDISRVREGA
FT                   TIICPVKVPGGGIYIGDMHAMQGDGEIAGHTTDVAGIVQLQVHVLKKVALEGPVLLPNE
FT                   EDLPYTAKPFTKEEKRRARELAEEFGVKQIEEALPVSIVGTGKTLNEATDNAIRRASKL
FT                   FELPESEVLNRATITGSIEIGRHPGVVTATFQVPKTILKKVRIFKTVKKQYD"
FT   gene            711015..711569
FT                   /locus_tag="Bsph_0693"
FT   CDS_pept        711015..711569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38313"
FT                   /db_xref="GOA:B1HY52"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY52"
FT                   /protein_id="ACA38313.1"
FT                   /translation="MSELVRIGNKIEKKNIVKPFLLKMKGGGHAPSRTNFADAFTGAVG
FT                   GLICIFVLLLLTNYTDAPWLMASLGGSCVLVFVVWNAPLSQPRNIIGGHLVSACIGLTL
FT                   YSTLGSNILSISLGVGLTIFFMALLGIIHPPAGANPIIIILGGYSWSYLILPVLIGAVI
FT                   IVFFGLLINNLRETRKYPQFW"
FT   gene            711737..713230
FT                   /locus_tag="Bsph_0694"
FT   CDS_pept        711737..713230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38314"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY53"
FT                   /protein_id="ACA38314.1"
FT                   /translation="MGGSNCMLLDCDEQLFMTYKQSNVEGAENLLATWLEAEVDLQEDP
FT                   KILGTSLSPKLFLVNEEMAMNIAFSTARKYWGRASTDMQMYFDKYGLDAKFVNDRLNAF
FT                   FYTQKGKETFFEQLFAQHTIDLERLIWLVFGKRMQMEMPVNELQTIMLYKFQDEYLVHM
FT                   MYKEHTPFWHWLFTKKVYSLFIHRPLEQFTFLYEIMGHFEHSMKMSCEHVDNFVNNYKL
FT                   ILDKCITHVDKNKSSCLAKKQLRLYQIVTHYCLSEGDYKRVKDFITSFEAEWRYSMYAL
FT                   TEKEKVLIAYILFHIANREQQSEKVIYYGEYLLEDERLNNYAIEILLEYKDLLPNRKPT
FT                   PPAIIKNYQLNYLENLYAILLDHYVKATRYEDGLLLLKEHVLASNKKINTSLVQKNYSS
FT                   EQLIAIEAYVQQDIALQVNNSLQHIGLSVEEWRQNYRQPEVPYYIVAQSASWHMLNILR
FT                   VLFVTEQFELFEKLMEIYKKYLLIDDHFENLRVFISAYV"
FT   gene            complement(713277..714470)
FT                   /locus_tag="Bsph_0695"
FT   CDS_pept        complement(713277..714470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0695"
FT                   /product="Alpha-methylacyl-CoA racemase"
FT                   /EC_number="5.1.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38315"
FT                   /db_xref="GOA:B1HY54"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY54"
FT                   /protein_id="ACA38315.1"
FT                   /translation="MEDLGILKGLKILDFSALLPGPMATMIFADLGADVIHVESSKRVD
FT                   LTRIMPPYDDDHEAYIHQHLNRSKKSLTLNLKSSEAIEIVKSLVQEYDVIIEGFRPGVM
FT                   QRLGIGYEALKEINPRVIYCAITGYGQTGPYSNRPGHDNNYLSLAGVLDYSRHKDKKPV
FT                   SMGIQLADIAGGTMHAAIGVLAAALHREKTGVGQFIDISMTDAVFSLNAMYGSAFIGGG
FT                   RVPQPEQEILNGGSYYDFYKTKDGRFFSVGSLEPQFRKLLCEALDIPELIDNTFNDSYY
FT                   TQIRFKEAVHDAFLSKTYEEWLEVFNEDFEGCVEPVLTFPEACEHPQLKAREMIVSIPK
FT                   GDGTLQQQIASPLKFDGSEPEYKHVGAKLGEHNEEILSSLGYGTEQIKALKDKGVLE"
FT   gene            714948..716510
FT                   /locus_tag="Bsph_0696"
FT   CDS_pept        714948..716510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0696"
FT                   /product="probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38316"
FT                   /db_xref="GOA:B1HY55"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY55"
FT                   /protein_id="ACA38316.1"
FT                   /translation="MKSHQLKLKNLIMGVAMAAFFFTIIGSVWGGYRMNVDSIKENTLE
FT                   TNHVYAQKLASTADAYLHEAFQILSYSANQVSENLGDEQILNRETDRLRLQNEMFNSVV
FT                   ITNAEGLVLSVSPPSIEIKGEVLTSLGAQEALAKKIPLVSKPYEAMTGRLIIFISHPIF
FT                   SASNEYLGMVAGTIYLKEPNAFKTLLGEHYSKDGSYVYVVDSDGRVIYHQDPSRINDVV
FT                   TKNKVVQAVMSGKSGVQIVDNTKGVKMLAGFSSVSSTGWGVVAQKPLEVALAPSFDRVQ
FT                   EVIIKSVPLMIVSVVIVLWAAARIANPLQQLAMLTEESLDKKNVEGLKSVSGWYFEAHS
FT                   LKYVLIRSLSFLHGQVTFFKDQSTVDPLTGVTNRRTMDAMLAEWFENRVPHAIILLDLD
FT                   HFKSVNDTYGHAVGDKVLQFLAKHMQSVAREGDVCCRYGGEEFVMLLPNTTVIEAEQVA
FT                   EQLRGNLAETDSPCGRPVTLSAGIALYPEMAATPETLIEAADGALYEAKQAGRNQVKVA
FT                   VKK"
FT   gene            716818..716943
FT                   /locus_tag="Bsph_0697"
FT   CDS_pept        716818..716943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38317"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY56"
FT                   /protein_id="ACA38317.1"
FT                   /translation="MELLCVSINLLDYFRFIYEDSTVLGRYKGYDENDICTYQNT"
FT   gene            716961..721214
FT                   /locus_tag="Bsph_0698"
FT   CDS_pept        716961..721214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0698"
FT                   /product="probable S-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38318"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY57"
FT                   /protein_id="ACA38318.1"
FT                   /translation="MDKSKIQKVNKALIATVFASSGIAVVVPSPQKAAAATSPFTDIDQ
FT                   YSVHYNDILKLYSQGVINGFADNTFRPDVNVTRGQAAKMLATALKLDTRNVQDPYYKDV
FT                   PKGSEFYKSVAALQNAGIMSGYSNGTFMPNEVMTRGELAKILVLAFHLEVSPSYNNIFK
FT                   DVDSKSSNAIYIQTLIDLNITEGTTPVTFSPFDPVNRGQFASFVVRSQEKKNNETSYKI
FT                   TSVDDDAVYINGKAYTVSENLSHIFNDYNAPVLKGAYIEGNLSSKKILSISKLTINASG
FT                   TSKDFLDFDGDHGSLGATIEVNGNYIEFNNLKMTGTMFVNETVRPPLHLGAINNQPLSI
FT                   GRVASNNISFINWSDPDNSKGDDSSINNSTNDLQNWTNQNPDKDKPFVNWSNEKQEMKN
FT                   VEKHLEFYNSTVSRLVVSQTGTKIESNMKLPRVDIIGSVREFEIQGYIGTLNLNTETPL
FT                   TIYGSGNIDWINYNSRTDLELYIYGRIGTLFVDNVYGKIDIGDYTYIDKVILPKDGSPN
FT                   NIFDDFLDDKDNIGNITDPDGKPIDKDENENQNPDDKTKPIVSITNVKVLNGSEIQADF
FT                   TSDEVGTYYYIVREKGAEAPNKREMVNHLSNENIAYGSGAAVKGTNSVKVSNLGEKKEY
FT                   VIYIMVVDGSKNASDIVSQSFQMKDATPPVVKSLQVTPLHGGTRAEFKFAASEPGDYYY
FT                   YVRKKTTAADPTTADIVANPTGKGKAKAGELGITEILTGLDAETDYQLYVVMKDDSGNY
FT                   SVDPAVVKDFKTSELDNVPPYVVGGQLVLLDEIKNEFYITVSEELDPISAEKVENYDLS
FT                   GTGIVNQGAQLPIHPTKVVYNKAQKRLIFTIPSLTGFVNGDNLVVTISPNVKDLADIEF
FT                   ENINNIPINTVPRNTAEYIHNDIELPVLTIIGEPAINNAKDQTLLEFNASKAGTYHYLI
FT                   MESDLTLTRDDRLRLIEAVQLNETTFKVGTQDVAIVGSGGNKPAQLGKQKVTIPLPNTF
FT                   PPLDPFKSYSIYMVLRDRSGNVSDIQTKHVIDDRTAPKIENTSIKIAEGDKKATFKFMS
FT                   DEAGTYYYILRKAGDTTVPVPASAEEVIERGRASAMRKDTNEINLSPLEPHENYELYVA
FT                   VKDRYNNSTMVQVGTESTIYTHDEKQNKPISLTPSLNNTGIMAYKFFSDGTPPKVEDPI
FT                   VKQLDGKTLEVTFSEAVELKASDFQLVNPETGTAITPTYASWKWQDKVDEIDEWKPRKM
FT                   ILTFANEVTQSFDMTINATAKDKGEWTFSKLKAEYKYPAKVNTITSATLVPDIQYPGDL
FT                   NISKQVRVIANLDADITWNQHYYYAVLSKNQGDLTIANIKDIIERADSNNYTDIPGGGI
FT                   ISYGKGQITKPSDASSEKTFTAIQTSTDPNSTNIFQKDQKIYLFTKDKYGNIVYAKEST
FT                   SPTAPNYVLIQPRTQ"
FT   gene            complement(721594..722391)
FT                   /locus_tag="Bsph_0699"
FT   CDS_pept        complement(721594..722391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0699"
FT                   /product="Hypothetical yuiI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38319"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY58"
FT                   /protein_id="ACA38319.1"
FT                   /translation="MTAKIKKPYITETNFEYAMTSYKQDYRILIANPTDAPPVDGYAVI
FT                   YALDGDALFPTLAEAVKLQTRKPKGYEPILVIGIGYPSKEPFDMERRCNDFTLPVSEGK
FT                   LPPRPDGTPWPPNGKANDFLDFIEYELMPAVEKEWSINKKKQAVVGHSLGGLFTLYALC
FT                   ERPHLFSHIVASSPSIWWADNAILKEMDRFFGDWNGQHAINLLLTIGANELPDMLEGAD
FT                   LAAERMKPLRVKNIYTNYVKFDDEDHVSVLPCMLSRLPRFLDG"
FT   gene            complement(722388..723380)
FT                   /locus_tag="Bsph_0700"
FT   CDS_pept        complement(722388..723380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsph_0700"
FT                   /product="ferrichrome ABC transporter ferrichrome-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38320"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1HY59"
FT                   /protein_id="ACA38320.1"
FT                   /translation="MTHNGRNQTIIKSVYILATFMLAIGLLSACNAQSSSNEKKVDTQA
FT                   NPDNIKEQSAYPLTIKDEVGNDVTLPAKPSKIFAPVLEDSLLALGIKPTMQWSNGVKPQ
FT                   LYLQKQLQGVPEISFASGPPSPEAIMADKPDLIVLHNSFYVENGTYEKYAKVAPTYVFK
FT                   NAATDIEGSIKMLGQLLDEPHKAQHAIQNYQEKVDAAKSKLASTTKGKKVALIRFNAKG
FT                   MFFMTDEYFSGYVLTHELGFEQSSYVKNGAFEVSLEILPELDADYIFLINDGNLGDSFI
FT                   NELKNSPIWQSTNAFKNNQVFETSEDYWLNGGIHAQEKVIDDVLEFLAP"
FT   gene            complement(723426..724613)
FT                   /gene="ybbB"
FT                   /locus_tag="Bsph_0701"
FT   CDS_pept        complement(723426..724613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="Bsph_0701"
FT                   /product="YbbB, ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsph_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ACA38321"
FT                   /db_xref="GOA:B1HY60"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPr