(data stored in ACNUC1104 zone)

EMBL: CP000820

ID   CP000820; SV 1; circular; genomic DNA; STD; PRO; 8982042 BP.
XX
AC   CP000820; AAII01000000-AAII01000259;
XX
PR   Project:PRJNA13915;
XX
DT   11-OCT-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Frankia sp. EAN1pec, complete genome.
XX
KW   .
XX
OS   Frankia sp. EAN1pec
OC   Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
XX
RN   [1]
RP   1-8982042
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Israni S., Dalin E., Tice H., Pitluck S., Saunders E., Brettin T.,
RA   Bruce D., Detter J.C., Han C., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Rawnsley T., Niemann J., Benson D.R., Huang Y.,
RA   Mastronunzio J., Bassi C.A., Tisa L.S., Richardson P.;
RT   "Complete sequence of Frankia sp. EAN1pec";
RL   Unpublished.
XX
RN   [2]
RP   1-8982042
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Hammon N.,
RA   Israni S., Dalin E., Tice H., Pitluck S., Saunders E., Brettin T.,
RA   Bruce D., Detter J.C., Han C., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Richardson P.;
RT   ;
RL   Submitted (29-AUG-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 105aaf3f5bc812bf89f84f0e84d4be63.
DR   BioSample; SAMN02598325.
DR   EnsemblGenomes-Gn; EBG00001116812.
DR   EnsemblGenomes-Gn; EBG00001116813.
DR   EnsemblGenomes-Gn; EBG00001116814.
DR   EnsemblGenomes-Gn; EBG00001116815.
DR   EnsemblGenomes-Gn; EBG00001116816.
DR   EnsemblGenomes-Gn; EBG00001116817.
DR   EnsemblGenomes-Gn; EBG00001116818.
DR   EnsemblGenomes-Gn; EBG00001116819.
DR   EnsemblGenomes-Gn; EBG00001116820.
DR   EnsemblGenomes-Gn; EBG00001116821.
DR   EnsemblGenomes-Gn; EBG00001116822.
DR   EnsemblGenomes-Gn; EBG00001116823.
DR   EnsemblGenomes-Gn; EBG00001116824.
DR   EnsemblGenomes-Gn; EBG00001116825.
DR   EnsemblGenomes-Gn; EBG00001116826.
DR   EnsemblGenomes-Gn; EBG00001116827.
DR   EnsemblGenomes-Gn; EBG00001116828.
DR   EnsemblGenomes-Gn; EBG00001116829.
DR   EnsemblGenomes-Gn; EBG00001116830.
DR   EnsemblGenomes-Gn; EBG00001116831.
DR   EnsemblGenomes-Gn; EBG00001116832.
DR   EnsemblGenomes-Gn; EBG00001116833.
DR   EnsemblGenomes-Gn; EBG00001116834.
DR   EnsemblGenomes-Gn; EBG00001116835.
DR   EnsemblGenomes-Gn; EBG00001116836.
DR   EnsemblGenomes-Gn; EBG00001116837.
DR   EnsemblGenomes-Gn; EBG00001116838.
DR   EnsemblGenomes-Gn; EBG00001116839.
DR   EnsemblGenomes-Gn; EBG00001116840.
DR   EnsemblGenomes-Gn; EBG00001116841.
DR   EnsemblGenomes-Gn; EBG00001116842.
DR   EnsemblGenomes-Gn; EBG00001116843.
DR   EnsemblGenomes-Gn; EBG00001116844.
DR   EnsemblGenomes-Gn; EBG00001116845.
DR   EnsemblGenomes-Gn; EBG00001116846.
DR   EnsemblGenomes-Gn; EBG00001116847.
DR   EnsemblGenomes-Gn; EBG00001116848.
DR   EnsemblGenomes-Gn; EBG00001116849.
DR   EnsemblGenomes-Gn; EBG00001116850.
DR   EnsemblGenomes-Gn; EBG00001116851.
DR   EnsemblGenomes-Gn; EBG00001116852.
DR   EnsemblGenomes-Gn; EBG00001116853.
DR   EnsemblGenomes-Gn; EBG00001116854.
DR   EnsemblGenomes-Gn; EBG00001116855.
DR   EnsemblGenomes-Gn; EBG00001116856.
DR   EnsemblGenomes-Gn; EBG00001116857.
DR   EnsemblGenomes-Gn; EBG00001116858.
DR   EnsemblGenomes-Gn; EBG00001116859.
DR   EnsemblGenomes-Gn; EBG00001116860.
DR   EnsemblGenomes-Gn; EBG00001116861.
DR   EnsemblGenomes-Gn; EBG00001116862.
DR   EnsemblGenomes-Gn; EBG00001116863.
DR   EnsemblGenomes-Gn; EBG00001116864.
DR   EnsemblGenomes-Gn; EBG00001116865.
DR   EnsemblGenomes-Gn; EBG00001116866.
DR   EnsemblGenomes-Gn; EBG00001116867.
DR   EnsemblGenomes-Gn; EBG00001116868.
DR   EnsemblGenomes-Gn; EBG00001116869.
DR   EnsemblGenomes-Gn; EBG00001116870.
DR   EnsemblGenomes-Gn; EBG00001116871.
DR   EnsemblGenomes-Gn; EBG00001116872.
DR   EnsemblGenomes-Gn; EBG00001116873.
DR   EnsemblGenomes-Gn; EBG00001116874.
DR   EnsemblGenomes-Gn; EBG00001116875.
DR   EnsemblGenomes-Gn; EBG00001116876.
DR   EnsemblGenomes-Gn; EBG00001116877.
DR   EnsemblGenomes-Gn; EBG00001116878.
DR   EnsemblGenomes-Gn; EBG00001116879.
DR   EnsemblGenomes-Gn; EBG00001116880.
DR   EnsemblGenomes-Gn; EBG00001116881.
DR   EnsemblGenomes-Gn; EBG00001116882.
DR   EnsemblGenomes-Gn; EBG00001116883.
DR   EnsemblGenomes-Gn; EBG00001116884.
DR   EnsemblGenomes-Gn; EBG00001116885.
DR   EnsemblGenomes-Gn; EBG00001116886.
DR   EnsemblGenomes-Gn; EBG00001116887.
DR   EnsemblGenomes-Gn; EBG00001116888.
DR   EnsemblGenomes-Gn; EBG00001116889.
DR   EnsemblGenomes-Gn; EBG00001116890.
DR   EnsemblGenomes-Gn; EBG00001116891.
DR   EnsemblGenomes-Gn; EBG00001116892.
DR   EnsemblGenomes-Gn; EBG00001116893.
DR   EnsemblGenomes-Gn; EBG00001116894.
DR   EnsemblGenomes-Gn; EBG00001116895.
DR   EnsemblGenomes-Gn; EBG00001116896.
DR   EnsemblGenomes-Gn; EBG00001116897.
DR   EnsemblGenomes-Gn; EBG00001116898.
DR   EnsemblGenomes-Gn; EBG00001116899.
DR   EnsemblGenomes-Gn; EBG00001116900.
DR   EnsemblGenomes-Gn; EBG00001116901.
DR   EnsemblGenomes-Gn; EBG00001116902.
DR   EnsemblGenomes-Gn; EBG00001116903.
DR   EnsemblGenomes-Gn; EBG00001116904.
DR   EnsemblGenomes-Gn; EBG00001116905.
DR   EnsemblGenomes-Gn; EBG00001116906.
DR   EnsemblGenomes-Gn; EBG00001116907.
DR   EnsemblGenomes-Gn; EBG00001116908.
DR   EnsemblGenomes-Gn; EBG00001116909.
DR   EnsemblGenomes-Gn; EBG00001116910.
DR   EnsemblGenomes-Gn; EBG00001116911.
DR   EnsemblGenomes-Gn; EBG00001116912.
DR   EnsemblGenomes-Gn; EBG00001116913.
DR   EnsemblGenomes-Gn; EBG00001116914.
DR   EnsemblGenomes-Gn; EBG00001116915.
DR   EnsemblGenomes-Gn; EBG00001116916.
DR   EnsemblGenomes-Gn; EBG00001116917.
DR   EnsemblGenomes-Gn; EBG00001116918.
DR   EnsemblGenomes-Gn; EBG00001116919.
DR   EnsemblGenomes-Gn; EBG00001116920.
DR   EnsemblGenomes-Gn; EBG00001116921.
DR   EnsemblGenomes-Gn; EBG00001116922.
DR   EnsemblGenomes-Gn; EBG00001116923.
DR   EnsemblGenomes-Gn; EBG00001116924.
DR   EnsemblGenomes-Gn; EBG00001116925.
DR   EnsemblGenomes-Gn; EBG00001116926.
DR   EnsemblGenomes-Gn; EBG00001116927.
DR   EnsemblGenomes-Gn; EBG00001116928.
DR   EnsemblGenomes-Gn; EBG00001116929.
DR   EnsemblGenomes-Gn; EBG00001116930.
DR   EnsemblGenomes-Gn; EBG00001116931.
DR   EnsemblGenomes-Gn; EBG00001116932.
DR   EnsemblGenomes-Gn; EBG00001116933.
DR   EnsemblGenomes-Gn; EBG00001116934.
DR   EnsemblGenomes-Gn; EBG00001116935.
DR   EnsemblGenomes-Gn; EBG00001116936.
DR   EnsemblGenomes-Gn; EBG00001116937.
DR   EnsemblGenomes-Gn; EBG00001116938.
DR   EnsemblGenomes-Gn; EBG00001116939.
DR   EnsemblGenomes-Gn; EBG00001116940.
DR   EnsemblGenomes-Gn; EBG00001116941.
DR   EnsemblGenomes-Gn; EBG00001116942.
DR   EnsemblGenomes-Gn; EBG00001116943.
DR   EnsemblGenomes-Gn; EBG00001116944.
DR   EnsemblGenomes-Gn; EBG00001116945.
DR   EnsemblGenomes-Gn; EBG00001116946.
DR   EnsemblGenomes-Gn; EBG00001116947.
DR   EnsemblGenomes-Gn; EBG00001116948.
DR   EnsemblGenomes-Gn; EBG00001116949.
DR   EnsemblGenomes-Gn; EBG00001116950.
DR   EnsemblGenomes-Gn; EBG00001116951.
DR   EnsemblGenomes-Gn; EBG00001116952.
DR   EnsemblGenomes-Gn; EBG00001116953.
DR   EnsemblGenomes-Gn; EBG00001116954.
DR   EnsemblGenomes-Gn; EBG00001116955.
DR   EnsemblGenomes-Gn; EBG00001116956.
DR   EnsemblGenomes-Gn; EBG00001116957.
DR   EnsemblGenomes-Gn; EBG00001116958.
DR   EnsemblGenomes-Gn; EBG00001116959.
DR   EnsemblGenomes-Gn; EBG00001116960.
DR   EnsemblGenomes-Gn; EBG00001116961.
DR   EnsemblGenomes-Gn; EBG00001116962.
DR   EnsemblGenomes-Gn; EBG00001116963.
DR   EnsemblGenomes-Gn; EBG00001116964.
DR   EnsemblGenomes-Gn; EBG00001116965.
DR   EnsemblGenomes-Gn; EBG00001116966.
DR   EnsemblGenomes-Gn; EBG00001116967.
DR   EnsemblGenomes-Gn; EBG00001116968.
DR   EnsemblGenomes-Gn; EBG00001116969.
DR   EnsemblGenomes-Gn; EBG00001116970.
DR   EnsemblGenomes-Gn; EBG00001116971.
DR   EnsemblGenomes-Gn; EBG00001116972.
DR   EnsemblGenomes-Gn; EBG00001116973.
DR   EnsemblGenomes-Gn; EBG00001116974.
DR   EnsemblGenomes-Gn; EBG00001116975.
DR   EnsemblGenomes-Gn; EBG00001116976.
DR   EnsemblGenomes-Gn; EBG00001116977.
DR   EnsemblGenomes-Gn; EBG00001116978.
DR   EnsemblGenomes-Gn; EBG00001116979.
DR   EnsemblGenomes-Gn; EBG00001116980.
DR   EnsemblGenomes-Gn; EBG00001116981.
DR   EnsemblGenomes-Gn; EBG00001116982.
DR   EnsemblGenomes-Gn; EBG00001116983.
DR   EnsemblGenomes-Gn; EBG00001116984.
DR   EnsemblGenomes-Gn; EBG00001116985.
DR   EnsemblGenomes-Gn; EBG00001116986.
DR   EnsemblGenomes-Gn; EBG00001116987.
DR   EnsemblGenomes-Gn; EBG00001116988.
DR   EnsemblGenomes-Gn; EBG00001116989.
DR   EnsemblGenomes-Gn; EBG00001116990.
DR   EnsemblGenomes-Gn; EBG00001116991.
DR   EnsemblGenomes-Gn; EBG00001116992.
DR   EnsemblGenomes-Gn; EBG00001116993.
DR   EnsemblGenomes-Gn; EBG00001116994.
DR   EnsemblGenomes-Gn; EBG00001116995.
DR   EnsemblGenomes-Gn; EBG00001116996.
DR   EnsemblGenomes-Gn; EBG00001116997.
DR   EnsemblGenomes-Gn; EBG00001116998.
DR   EnsemblGenomes-Gn; EBG00001116999.
DR   EnsemblGenomes-Gn; EBG00001117000.
DR   EnsemblGenomes-Gn; EBG00001117001.
DR   EnsemblGenomes-Gn; EBG00001117002.
DR   EnsemblGenomes-Gn; EBG00001117003.
DR   EnsemblGenomes-Gn; Franean1_R0001.
DR   EnsemblGenomes-Gn; Franean1_R0002.
DR   EnsemblGenomes-Gn; Franean1_R0003.
DR   EnsemblGenomes-Gn; Franean1_R0004.
DR   EnsemblGenomes-Gn; Franean1_R0005.
DR   EnsemblGenomes-Gn; Franean1_R0006.
DR   EnsemblGenomes-Gn; Franean1_R0007.
DR   EnsemblGenomes-Gn; Franean1_R0008.
DR   EnsemblGenomes-Gn; Franean1_R0009.
DR   EnsemblGenomes-Gn; Franean1_R0010.
DR   EnsemblGenomes-Gn; Franean1_R0011.
DR   EnsemblGenomes-Gn; Franean1_R0012.
DR   EnsemblGenomes-Gn; Franean1_R0013.
DR   EnsemblGenomes-Gn; Franean1_R0014.
DR   EnsemblGenomes-Gn; Franean1_R0015.
DR   EnsemblGenomes-Gn; Franean1_R0016.
DR   EnsemblGenomes-Gn; Franean1_R0017.
DR   EnsemblGenomes-Gn; Franean1_R0018.
DR   EnsemblGenomes-Gn; Franean1_R0019.
DR   EnsemblGenomes-Gn; Franean1_R0020.
DR   EnsemblGenomes-Gn; Franean1_R0021.
DR   EnsemblGenomes-Gn; Franean1_R0022.
DR   EnsemblGenomes-Gn; Franean1_R0023.
DR   EnsemblGenomes-Gn; Franean1_R0024.
DR   EnsemblGenomes-Gn; Franean1_R0025.
DR   EnsemblGenomes-Gn; Franean1_R0026.
DR   EnsemblGenomes-Gn; Franean1_R0027.
DR   EnsemblGenomes-Gn; Franean1_R0028.
DR   EnsemblGenomes-Gn; Franean1_R0029.
DR   EnsemblGenomes-Gn; Franean1_R0030.
DR   EnsemblGenomes-Gn; Franean1_R0031.
DR   EnsemblGenomes-Gn; Franean1_R0032.
DR   EnsemblGenomes-Gn; Franean1_R0034.
DR   EnsemblGenomes-Gn; Franean1_R0035.
DR   EnsemblGenomes-Gn; Franean1_R0036.
DR   EnsemblGenomes-Gn; Franean1_R0037.
DR   EnsemblGenomes-Gn; Franean1_R0038.
DR   EnsemblGenomes-Gn; Franean1_R0039.
DR   EnsemblGenomes-Gn; Franean1_R0040.
DR   EnsemblGenomes-Gn; Franean1_R0041.
DR   EnsemblGenomes-Gn; Franean1_R0042.
DR   EnsemblGenomes-Gn; Franean1_R0043.
DR   EnsemblGenomes-Gn; Franean1_R0044.
DR   EnsemblGenomes-Gn; Franean1_R0045.
DR   EnsemblGenomes-Gn; Franean1_R0046.
DR   EnsemblGenomes-Gn; Franean1_R0047.
DR   EnsemblGenomes-Gn; Franean1_R0048.
DR   EnsemblGenomes-Gn; Franean1_R0049.
DR   EnsemblGenomes-Gn; Franean1_R0050.
DR   EnsemblGenomes-Gn; Franean1_R0051.
DR   EnsemblGenomes-Gn; Franean1_R0052.
DR   EnsemblGenomes-Gn; Franean1_R0053.
DR   EnsemblGenomes-Gn; Franean1_R0054.
DR   EnsemblGenomes-Gn; Franean1_R0056.
DR   EnsemblGenomes-Gn; Franean1_R0057.
DR   EnsemblGenomes-Gn; Franean1_R0058.
DR   EnsemblGenomes-Gn; Franean1_R0059.
DR   EnsemblGenomes-Tr; EBT00001707601.
DR   EnsemblGenomes-Tr; EBT00001707602.
DR   EnsemblGenomes-Tr; EBT00001707603.
DR   EnsemblGenomes-Tr; EBT00001707604.
DR   EnsemblGenomes-Tr; EBT00001707605.
DR   EnsemblGenomes-Tr; EBT00001707606.
DR   EnsemblGenomes-Tr; EBT00001707607.
DR   EnsemblGenomes-Tr; EBT00001707608.
DR   EnsemblGenomes-Tr; EBT00001707609.
DR   EnsemblGenomes-Tr; EBT00001707610.
DR   EnsemblGenomes-Tr; EBT00001707611.
DR   EnsemblGenomes-Tr; EBT00001707612.
DR   EnsemblGenomes-Tr; EBT00001707613.
DR   EnsemblGenomes-Tr; EBT00001707614.
DR   EnsemblGenomes-Tr; EBT00001707615.
DR   EnsemblGenomes-Tr; EBT00001707616.
DR   EnsemblGenomes-Tr; EBT00001707617.
DR   EnsemblGenomes-Tr; EBT00001707618.
DR   EnsemblGenomes-Tr; EBT00001707619.
DR   EnsemblGenomes-Tr; EBT00001707620.
DR   EnsemblGenomes-Tr; EBT00001707621.
DR   EnsemblGenomes-Tr; EBT00001707622.
DR   EnsemblGenomes-Tr; EBT00001707623.
DR   EnsemblGenomes-Tr; EBT00001707624.
DR   EnsemblGenomes-Tr; EBT00001707625.
DR   EnsemblGenomes-Tr; EBT00001707626.
DR   EnsemblGenomes-Tr; EBT00001707627.
DR   EnsemblGenomes-Tr; EBT00001707628.
DR   EnsemblGenomes-Tr; EBT00001707629.
DR   EnsemblGenomes-Tr; EBT00001707630.
DR   EnsemblGenomes-Tr; EBT00001707631.
DR   EnsemblGenomes-Tr; EBT00001707632.
DR   EnsemblGenomes-Tr; EBT00001707633.
DR   EnsemblGenomes-Tr; EBT00001707634.
DR   EnsemblGenomes-Tr; EBT00001707635.
DR   EnsemblGenomes-Tr; EBT00001707636.
DR   EnsemblGenomes-Tr; EBT00001707637.
DR   EnsemblGenomes-Tr; EBT00001707638.
DR   EnsemblGenomes-Tr; EBT00001707639.
DR   EnsemblGenomes-Tr; EBT00001707640.
DR   EnsemblGenomes-Tr; EBT00001707641.
DR   EnsemblGenomes-Tr; EBT00001707642.
DR   EnsemblGenomes-Tr; EBT00001707643.
DR   EnsemblGenomes-Tr; EBT00001707644.
DR   EnsemblGenomes-Tr; EBT00001707645.
DR   EnsemblGenomes-Tr; EBT00001707646.
DR   EnsemblGenomes-Tr; EBT00001707647.
DR   EnsemblGenomes-Tr; EBT00001707648.
DR   EnsemblGenomes-Tr; EBT00001707649.
DR   EnsemblGenomes-Tr; EBT00001707650.
DR   EnsemblGenomes-Tr; EBT00001707651.
DR   EnsemblGenomes-Tr; EBT00001707652.
DR   EnsemblGenomes-Tr; EBT00001707653.
DR   EnsemblGenomes-Tr; EBT00001707654.
DR   EnsemblGenomes-Tr; EBT00001707655.
DR   EnsemblGenomes-Tr; EBT00001707656.
DR   EnsemblGenomes-Tr; EBT00001707657.
DR   EnsemblGenomes-Tr; EBT00001707658.
DR   EnsemblGenomes-Tr; EBT00001707659.
DR   EnsemblGenomes-Tr; EBT00001707660.
DR   EnsemblGenomes-Tr; EBT00001707661.
DR   EnsemblGenomes-Tr; EBT00001707662.
DR   EnsemblGenomes-Tr; EBT00001707663.
DR   EnsemblGenomes-Tr; EBT00001707664.
DR   EnsemblGenomes-Tr; EBT00001707665.
DR   EnsemblGenomes-Tr; EBT00001707666.
DR   EnsemblGenomes-Tr; EBT00001707667.
DR   EnsemblGenomes-Tr; EBT00001707668.
DR   EnsemblGenomes-Tr; EBT00001707669.
DR   EnsemblGenomes-Tr; EBT00001707670.
DR   EnsemblGenomes-Tr; EBT00001707671.
DR   EnsemblGenomes-Tr; EBT00001707672.
DR   EnsemblGenomes-Tr; EBT00001707673.
DR   EnsemblGenomes-Tr; EBT00001707674.
DR   EnsemblGenomes-Tr; EBT00001707675.
DR   EnsemblGenomes-Tr; EBT00001707676.
DR   EnsemblGenomes-Tr; EBT00001707677.
DR   EnsemblGenomes-Tr; EBT00001707678.
DR   EnsemblGenomes-Tr; EBT00001707679.
DR   EnsemblGenomes-Tr; EBT00001707680.
DR   EnsemblGenomes-Tr; EBT00001707681.
DR   EnsemblGenomes-Tr; EBT00001707682.
DR   EnsemblGenomes-Tr; EBT00001707683.
DR   EnsemblGenomes-Tr; EBT00001707684.
DR   EnsemblGenomes-Tr; EBT00001707685.
DR   EnsemblGenomes-Tr; EBT00001707686.
DR   EnsemblGenomes-Tr; EBT00001707687.
DR   EnsemblGenomes-Tr; EBT00001707688.
DR   EnsemblGenomes-Tr; EBT00001707689.
DR   EnsemblGenomes-Tr; EBT00001707690.
DR   EnsemblGenomes-Tr; EBT00001707691.
DR   EnsemblGenomes-Tr; EBT00001707692.
DR   EnsemblGenomes-Tr; EBT00001707693.
DR   EnsemblGenomes-Tr; EBT00001707694.
DR   EnsemblGenomes-Tr; EBT00001707695.
DR   EnsemblGenomes-Tr; EBT00001707696.
DR   EnsemblGenomes-Tr; EBT00001707697.
DR   EnsemblGenomes-Tr; EBT00001707698.
DR   EnsemblGenomes-Tr; EBT00001707699.
DR   EnsemblGenomes-Tr; EBT00001707700.
DR   EnsemblGenomes-Tr; EBT00001707701.
DR   EnsemblGenomes-Tr; EBT00001707702.
DR   EnsemblGenomes-Tr; EBT00001707703.
DR   EnsemblGenomes-Tr; EBT00001707704.
DR   EnsemblGenomes-Tr; EBT00001707705.
DR   EnsemblGenomes-Tr; EBT00001707706.
DR   EnsemblGenomes-Tr; EBT00001707707.
DR   EnsemblGenomes-Tr; EBT00001707708.
DR   EnsemblGenomes-Tr; EBT00001707709.
DR   EnsemblGenomes-Tr; EBT00001707710.
DR   EnsemblGenomes-Tr; EBT00001707711.
DR   EnsemblGenomes-Tr; EBT00001707712.
DR   EnsemblGenomes-Tr; EBT00001707713.
DR   EnsemblGenomes-Tr; EBT00001707714.
DR   EnsemblGenomes-Tr; EBT00001707715.
DR   EnsemblGenomes-Tr; EBT00001707716.
DR   EnsemblGenomes-Tr; EBT00001707717.
DR   EnsemblGenomes-Tr; EBT00001707718.
DR   EnsemblGenomes-Tr; EBT00001707719.
DR   EnsemblGenomes-Tr; EBT00001707720.
DR   EnsemblGenomes-Tr; EBT00001707721.
DR   EnsemblGenomes-Tr; EBT00001707722.
DR   EnsemblGenomes-Tr; EBT00001707723.
DR   EnsemblGenomes-Tr; EBT00001707724.
DR   EnsemblGenomes-Tr; EBT00001707725.
DR   EnsemblGenomes-Tr; EBT00001707726.
DR   EnsemblGenomes-Tr; EBT00001707727.
DR   EnsemblGenomes-Tr; EBT00001707728.
DR   EnsemblGenomes-Tr; EBT00001707729.
DR   EnsemblGenomes-Tr; EBT00001707730.
DR   EnsemblGenomes-Tr; EBT00001707731.
DR   EnsemblGenomes-Tr; EBT00001707732.
DR   EnsemblGenomes-Tr; EBT00001707733.
DR   EnsemblGenomes-Tr; EBT00001707734.
DR   EnsemblGenomes-Tr; EBT00001707735.
DR   EnsemblGenomes-Tr; EBT00001707736.
DR   EnsemblGenomes-Tr; EBT00001707737.
DR   EnsemblGenomes-Tr; EBT00001707738.
DR   EnsemblGenomes-Tr; EBT00001707739.
DR   EnsemblGenomes-Tr; EBT00001707740.
DR   EnsemblGenomes-Tr; EBT00001707741.
DR   EnsemblGenomes-Tr; EBT00001707742.
DR   EnsemblGenomes-Tr; EBT00001707743.
DR   EnsemblGenomes-Tr; EBT00001707744.
DR   EnsemblGenomes-Tr; EBT00001707745.
DR   EnsemblGenomes-Tr; EBT00001707746.
DR   EnsemblGenomes-Tr; EBT00001707747.
DR   EnsemblGenomes-Tr; EBT00001707748.
DR   EnsemblGenomes-Tr; EBT00001707749.
DR   EnsemblGenomes-Tr; EBT00001707750.
DR   EnsemblGenomes-Tr; EBT00001707751.
DR   EnsemblGenomes-Tr; EBT00001707752.
DR   EnsemblGenomes-Tr; EBT00001707753.
DR   EnsemblGenomes-Tr; EBT00001707754.
DR   EnsemblGenomes-Tr; EBT00001707755.
DR   EnsemblGenomes-Tr; EBT00001707756.
DR   EnsemblGenomes-Tr; EBT00001707757.
DR   EnsemblGenomes-Tr; EBT00001707758.
DR   EnsemblGenomes-Tr; EBT00001707759.
DR   EnsemblGenomes-Tr; EBT00001707760.
DR   EnsemblGenomes-Tr; EBT00001707761.
DR   EnsemblGenomes-Tr; EBT00001707762.
DR   EnsemblGenomes-Tr; EBT00001707763.
DR   EnsemblGenomes-Tr; EBT00001707764.
DR   EnsemblGenomes-Tr; EBT00001707765.
DR   EnsemblGenomes-Tr; EBT00001707766.
DR   EnsemblGenomes-Tr; EBT00001707767.
DR   EnsemblGenomes-Tr; EBT00001707768.
DR   EnsemblGenomes-Tr; EBT00001707769.
DR   EnsemblGenomes-Tr; EBT00001707770.
DR   EnsemblGenomes-Tr; EBT00001707771.
DR   EnsemblGenomes-Tr; EBT00001707772.
DR   EnsemblGenomes-Tr; EBT00001707773.
DR   EnsemblGenomes-Tr; EBT00001707774.
DR   EnsemblGenomes-Tr; EBT00001707775.
DR   EnsemblGenomes-Tr; EBT00001707776.
DR   EnsemblGenomes-Tr; EBT00001707777.
DR   EnsemblGenomes-Tr; EBT00001707778.
DR   EnsemblGenomes-Tr; EBT00001707779.
DR   EnsemblGenomes-Tr; EBT00001707780.
DR   EnsemblGenomes-Tr; EBT00001707781.
DR   EnsemblGenomes-Tr; EBT00001707782.
DR   EnsemblGenomes-Tr; EBT00001707783.
DR   EnsemblGenomes-Tr; EBT00001707784.
DR   EnsemblGenomes-Tr; EBT00001707785.
DR   EnsemblGenomes-Tr; EBT00001707786.
DR   EnsemblGenomes-Tr; EBT00001707787.
DR   EnsemblGenomes-Tr; EBT00001707788.
DR   EnsemblGenomes-Tr; EBT00001707789.
DR   EnsemblGenomes-Tr; EBT00001707790.
DR   EnsemblGenomes-Tr; EBT00001707791.
DR   EnsemblGenomes-Tr; EBT00001707792.
DR   EnsemblGenomes-Tr; Franean1_R0001-1.
DR   EnsemblGenomes-Tr; Franean1_R0002-1.
DR   EnsemblGenomes-Tr; Franean1_R0003-1.
DR   EnsemblGenomes-Tr; Franean1_R0004-1.
DR   EnsemblGenomes-Tr; Franean1_R0005-1.
DR   EnsemblGenomes-Tr; Franean1_R0006-1.
DR   EnsemblGenomes-Tr; Franean1_R0007-1.
DR   EnsemblGenomes-Tr; Franean1_R0008-1.
DR   EnsemblGenomes-Tr; Franean1_R0009-1.
DR   EnsemblGenomes-Tr; Franean1_R0010-1.
DR   EnsemblGenomes-Tr; Franean1_R0011-1.
DR   EnsemblGenomes-Tr; Franean1_R0012-1.
DR   EnsemblGenomes-Tr; Franean1_R0013-1.
DR   EnsemblGenomes-Tr; Franean1_R0014-1.
DR   EnsemblGenomes-Tr; Franean1_R0015-1.
DR   EnsemblGenomes-Tr; Franean1_R0016-1.
DR   EnsemblGenomes-Tr; Franean1_R0017-1.
DR   EnsemblGenomes-Tr; Franean1_R0018-1.
DR   EnsemblGenomes-Tr; Franean1_R0019-1.
DR   EnsemblGenomes-Tr; Franean1_R0020-1.
DR   EnsemblGenomes-Tr; Franean1_R0021-1.
DR   EnsemblGenomes-Tr; Franean1_R0022-1.
DR   EnsemblGenomes-Tr; Franean1_R0023-1.
DR   EnsemblGenomes-Tr; Franean1_R0024-1.
DR   EnsemblGenomes-Tr; Franean1_R0025-1.
DR   EnsemblGenomes-Tr; Franean1_R0026-1.
DR   EnsemblGenomes-Tr; Franean1_R0027-1.
DR   EnsemblGenomes-Tr; Franean1_R0028-1.
DR   EnsemblGenomes-Tr; Franean1_R0029-1.
DR   EnsemblGenomes-Tr; Franean1_R0030-1.
DR   EnsemblGenomes-Tr; Franean1_R0031-1.
DR   EnsemblGenomes-Tr; Franean1_R0032-1.
DR   EnsemblGenomes-Tr; Franean1_R0034-1.
DR   EnsemblGenomes-Tr; Franean1_R0035-1.
DR   EnsemblGenomes-Tr; Franean1_R0036-1.
DR   EnsemblGenomes-Tr; Franean1_R0037-1.
DR   EnsemblGenomes-Tr; Franean1_R0038-1.
DR   EnsemblGenomes-Tr; Franean1_R0039-1.
DR   EnsemblGenomes-Tr; Franean1_R0040-1.
DR   EnsemblGenomes-Tr; Franean1_R0041-1.
DR   EnsemblGenomes-Tr; Franean1_R0042-1.
DR   EnsemblGenomes-Tr; Franean1_R0043-1.
DR   EnsemblGenomes-Tr; Franean1_R0044-1.
DR   EnsemblGenomes-Tr; Franean1_R0045-1.
DR   EnsemblGenomes-Tr; Franean1_R0046-1.
DR   EnsemblGenomes-Tr; Franean1_R0047-1.
DR   EnsemblGenomes-Tr; Franean1_R0048-1.
DR   EnsemblGenomes-Tr; Franean1_R0049-1.
DR   EnsemblGenomes-Tr; Franean1_R0050-1.
DR   EnsemblGenomes-Tr; Franean1_R0051-1.
DR   EnsemblGenomes-Tr; Franean1_R0052-1.
DR   EnsemblGenomes-Tr; Franean1_R0053-1.
DR   EnsemblGenomes-Tr; Franean1_R0054-1.
DR   EnsemblGenomes-Tr; Franean1_R0056-1.
DR   EnsemblGenomes-Tr; Franean1_R0057-1.
DR   EnsemblGenomes-Tr; Franean1_R0058-1.
DR   EnsemblGenomes-Tr; Franean1_R0059-1.
DR   EuropePMC; PMC2770080; 19821988.
DR   EuropePMC; PMC2813009; 20008172.
DR   EuropePMC; PMC3127629; 21498757.
DR   EuropePMC; PMC4661313; 26607894.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01325; CRISPR-DR12.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP000820.
DR   SILVA-SSU; CP000820.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634642
CC   Source DNA and bacteria available from Louis S. Tisa
CC   (lst@hypatia.unh.edu)
CC   Contacts: Louis S. Tisa (lst@hypatia.unh.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8982042
FT                   /organism="Frankia sp. EAN1pec"
FT                   /strain="EAN1.pec"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:298653"
FT   gene            71..1654
FT                   /locus_tag="Franean1_0001"
FT   CDS_pept        71..1654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fal:FRAAL0002 chromosomal replication
FT                   initiator protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09470"
FT                   /db_xref="GOA:A8LB16"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB16"
FT                   /protein_id="ABW09470.1"
FT                   /translation="MTDLSADSVAGQPSRGAAPTSEPDLSAVWEQAVAGVADGTLSGQQ
FT                   RAWLRLTRPLGLVQDTALLAAPNEFTKDLLDSRLRPFLSTALSTAYGREIRVAVTVEHT
FT                   PDPEPMTGPLTLPGTDPGGGPRSLLGTGHEPRPGEEHRGEDRRNEDRLDGRLEGRVDGA
FT                   PPGRMAPGLGRDPSPRPSEPARLNPRYLFETFVIGDSNRFPHAAAVAVAEAPAKAYNPL
FT                   FIYGDSGLGKTHLLHAIGHYTVKLYPESKIKYVSMEEFTNDFIASIRDDRQLAFQRRYR
FT                   DIDVLLVDDIQFLENKERTQEEFFHTFNVLHDTEKQIVISSDRSPKQLSALEDRLRSRF
FT                   EWGLITDVTPPDLETRIAILSKKAATERLPVPPDVLEYIATHIERNIRELEGALIRVAA
FT                   FASLNKSHVDRTLAEIVLRDLIPDAANPEITAAAIMNATAAYFGVSMEDLCGTSRSRVL
FT                   VTARQIAMYLCRELTDLSLPKIGQHFGGRDHTTVMHADRKIRGLMAERRAIYNQVTELT
FT                   NRIRAQARHA"
FT   gene            2937..3959
FT                   /locus_tag="Franean1_0002"
FT   CDS_pept        2937..3959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:23524 serine/arginine repetitive matrix 2"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09471"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB17"
FT                   /protein_id="ABW09471.1"
FT                   /translation="MDERVYSLCASEGHLWNRSSPGDKPLDHPHRHPQDAHRASVGLTW
FT                   ENGRFPQFPQPLLLLRTRSSSERSKPRSSRSWGQPRISIMVWPGCPKRAHGAMRSLPSV
FT                   SRLPVGASRETSTAVRESSLRCAARGRITDAGPHDQRHRCDRWHQRDRCGPWLRRCDRR
FT                   TPDPPRGWRSSSHRCGRRLQRGTRQPVIRRGRRSRRMRSEVLMRSCGTVVSGSCGGAVV
FT                   PGEMRKITPDTPDAGDLQAPPRQSAVRSARHGSSIGRCRGCARSSSPVCHPRNTDHPPP
FT                   ARGALGCWIGSGWCSTARSLPTRRVARVRCSARRSYAGDVKFRERPWERPPRDDGRTCP
FT                   "
FT   gene            3956..5116
FT                   /locus_tag="Franean1_0003"
FT   CDS_pept        3956..5116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fal:FRAAL0004 DNA polymerase III, beta chain;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09472"
FT                   /db_xref="GOA:A8LB18"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB18"
FT                   /protein_id="ABW09472.1"
FT                   /translation="MRFRVERDEFTDAVAWTARTLPSRATTQLQVLAGLLLDATGPALK
FT                   VAAFDYEVAAQGELDATVTEEGRGLVNGKMLADITRSLPAAPVDVHVDGTRLVVACGNA
FT                   RFALPMLPVDDYPTLPPMPEITGHIEGAAFGSAVAQVAVAAGRDDTLPVLTGVRLEIDG
FT                   DTLTLAATDRYRLAVRTLKWRPATPDASGVALVPARTLLDTAKSLSGSGVEVAVALGTG
FT                   PSGETLAGFAGNTRQTTTRLLEGTFPPYRKLLPDSSPLIAQLEIAPLTEAVKRVALVAA
FT                   RTAPVQLTFTPDHLVLEAGTGGEAQASETLPVTYDGPELTVAFNPAYLLDALGALESDI
FT                   VRIGFASAEDAALAASKPAILTGKGGDDQTEIPDYRYLLMPIRLNG"
FT   gene            5118..6491
FT                   /locus_tag="Franean1_0004"
FT   CDS_pept        5118..6491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sen:SACE_0005 DNA
FT                   replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09473"
FT                   /db_xref="GOA:A8LB19"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB19"
FT                   /protein_id="ABW09473.1"
FT                   /translation="MHLTHLSLTDFRSYARLDLVLEPGVTTFVGSNGQGKTNLIEAIGF
FT                   VATLGSHRVANDAPLVREGCGQAVVRARIVRGDRAALVEMQIVPGKANRVRLNRAPVAR
FT                   ARDVAGLLATVLFAPEDLALVKGDPAERRRFLDDLLVARAPRMAAVQSDYDRVLKQRSA
FT                   LLRSAGAARRAGGRGDLRTLDVWDRHLADHGAELLAARLALVEELRPRVESAYAAVAGQ
FT                   DAPTGIEYRSTVTLDSSPDRALSPGRAGLGEPDGDAGRNGNGASPNHPSGSGDPASGNG
FT                   GSGDTEVGDTEAGRTGDGAGDGRTEADRTEVGHVGGAVGGTATRAALEEAILAGLAAVR
FT                   TQEIERGVTLVGPHRDDLLLSVNGRPARGYASHGESWSLALALRLASFELLRADDREPV
FT                   LLLDDVFAELDTRRRARLAALVADAEQVLVTAAVDADVPAELAGVRFEVVSGEVCRAG"
FT   gene            6712..7245
FT                   /locus_tag="Franean1_0005"
FT   CDS_pept        6712..7245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   fal:FRAAL0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09474"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB20"
FT                   /protein_id="ABW09474.1"
FT                   /translation="MLARAKQDARARGTTRPGGGAGDGSGGRGGAAGRRGRDDSGDPPA
FT                   RQRLPGIAAPGREWRTPMNFGSAVARLVAERGWQTRATDASVLARWDVLVGPNIAAHCS
FT                   PVSLRDGELELVAESTAWATQLRMLSRQILGILRKELGPHVVRRITVRGPAAPSWNHGG
FT                   MYAPGGRGPRDTYG"
FT   gene            7555..9513
FT                   /locus_tag="Franean1_0006"
FT   CDS_pept        7555..9513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: fal:FRAAL0008 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09475"
FT                   /db_xref="GOA:A8LB21"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB21"
FT                   /protein_id="ABW09475.1"
FT                   /translation="MAYDASSIKVLEGLEAVRKRPGMYIGSTGERGLHHLVYEVVDNAV
FT                   DEALAGYCDTISVTLLADGGVRVTDNGRGIPVGEHPVKKIPTVELVLTTLHAGGKFDGE
FT                   SYAVSGGLHGVGVSVVNALSTRLDVEIQTDGHSWFQPYENSRPARPLAQTGTSKKTGTT
FT                   ITFWADPTIFETTTYKYETLFRRLQEMAFLNKGLSITLRDERGKATETEEAAEPTEVTF
FT                   KYDNGLVDFVGHLNATKDAVHRSVISLESKGTGIEAELAMQWNSGYNESVYTFANTINT
FT                   HEGGTHEEGFRAALTSAVNAYAKDQNLLKPVKAGSKNSDERLSGDDIREGLTAIISVKL
FT                   AQPQFEGQTKTKLGNTEAKKFVQEMCYSALKDWFEVNRTEARSIVSKALDAQRARIAAR
FT                   QARDLTRRKGLLGGTGLPGKLADCQFTDPERCELYIVEGDSAGGSAKGGRDSKFQAILP
FT                   LRGKILNVEKARIDRVLKNTEVQALIQALGCGIHDDFDIAKLRYHKIVLMADADVDGQH
FT                   IRTLLLTLLFRFMRPLVEAGHVFLAQPPLYKIKWGREDWEYAYSDRERDGLLEQGVEAG
FT                   RKLPKDAIQRFKGLGEMNATELWDTTMDPDKRILLQVTLDDAAVADELFSVLMGEDVDA
FT                   RRSFIQRNAKDVRFLDI"
FT   gene            9711..12224
FT                   /locus_tag="Franean1_0007"
FT   CDS_pept        9711..12224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: fal:FRAAL0009 DNA gyrase, subunit A, type II
FT                   topoisomerase; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09476"
FT                   /db_xref="GOA:A8LB22"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB22"
FT                   /protein_id="ABW09476.1"
FT                   /translation="MVDVLPPPPGDRIEPIGIEVEMQRSYLDYAMSVIVGRALPEVRDG
FT                   LKPVHRRVLYAMYDGGYRPDRGYFKCSRVVGDVMGNYHPHGDSAIYDTLVRLAQPWSLR
FT                   YPLVDGNGNFGSPGNDPPAAMRYTEARMAPLAMEMLRDIDQETVDFAPNYDGRSQEPLV
FT                   LPSRFPNLLVNGAGGIAVGMATNIPPHNLVEVAKGVQWSLDHPEATAEELLEALLGIIK
FT                   GPDFPTHGLIVGRNGIEDAYRTGRGSIRMRAVVNVEENKGRTQLVVTELPYQVNPDNLA
FT                   EKIAELVRDNKVTGISDVRDETSARIGQRLVIDLKRDAVAKVVLNNLYKHTQLQDTFGV
FT                   NMLAIVDGVPRTLRLDQMISYYVEHQVDVIVRRTRYQLRKARERLHVLDGLLIALDHLD
FT                   EVIALIRNAESAEVARGQLMARFSLSEIQATAILDMQLRRLAFLERQRIIDEAAELRAK
FT                   IDELEAILASPVRQREIIGQELAEVVEKFGDERRTRLVPFEGDMSVEDLIAREDVVVTV
FT                   TRGGYAKRTKTDLYRSQKRGGKGVQGAALREDDIVEHFFVTTTHHWLLFFTNKGRVYRA
FT                   KAHELPEQARSAKGQHVANILAFSQDERIAEVMAIQDYQAAPYLVLATKRGLCKKTALT
FT                   DFDSNRAGGLVAINLRDDDELISARLVAPGDDLLLVSRNAQSIRFHADDEQLRPMGRAT
FT                   SGVIGMRFDEADELLSMDVVVPESPADLLVATSGGYAKRTPLAEYPIQGRGGKGVLTAK
FT                   IVSTRGGLVGALVVEPNDQLYAITSNGGVLRTVAKDVRRAQRQTMGVRLIDLEAGVQVV
FT                   GVARNADANDSDGDGETAGSDGTAG"
FT   gene            12333..14270
FT                   /locus_tag="Franean1_0008"
FT   CDS_pept        12333..14270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09477"
FT                   /db_xref="GOA:A8LB23"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB23"
FT                   /protein_id="ABW09477.1"
FT                   /translation="MSDSQNDRPARSAVHRASPARPEQRTAAVAGGAPVGGTAAGRAAA
FT                   GGTAAGGASVAGSSRSGTAKAGPVGAAPGVGSGAGSGTGIGKGVPGTTGSGTGVSSAAG
FT                   GGVGGPRSTPGKDDGESKRAFLPGTGRPADGRPGTDGRPADGRSGEGRPAAGGGAGSGS
FT                   RGPSRPSSGSASPGKGAPGSASPGTSGSASPARGAGASGAGAGGAASPFFQRPGRDEND
FT                   PSDRDGAGGQTSQTTRLGVGGTAEPKLLSASATVPGSSSAGTGGGTDRAAPAPRGGDSD
FT                   PDETSRQPAGRQPARDADAARPAGDGRKPTEATRGAGAGTSKDAAPAAGKGASRTGTRA
FT                   DAARPDAARPDTSRAETTRKPDAQTTVRSPAARPGTPVDPPRDSDTISLVRPNLPKRGS
FT                   KPPADRVGADVKTSPDRGAVTDRMPAERRPTPEPVRAATPSTRQAPLAGRTAPYDRPGT
FT                   PPGPLPTSGGVGPNGLSTEPFDRVDDADHGRPGGAPGPQGGPPRGQQQPGGREPGRDTA
FT                   GQGPRRGPAGGRRARLRVSRVEPLSVTRLSFAFSLCVFLIMIVAVAVLWFVLNSIGVFD
FT                   SVTKAADTLTDGTNANVSGWLSFGRAMQVTLLVGAINVVLMTALATLGALLYNLCADMI
FT                   GGLEVTLSDQ"
FT   gene            14343..14419
FT                   /locus_tag="Franean1_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            14343..14419
FT                   /locus_tag="Franean1_R0001"
FT                   /product="tRNA-Ile"
FT   gene            15245..15862
FT                   /locus_tag="Franean1_0009"
FT   CDS_pept        15245..15862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09478"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB24"
FT                   /protein_id="ABW09478.1"
FT                   /translation="MDVALRQAAEAAKGFMPPEEGLALHAAAAELPGGGLICEIGTYCG
FT                   KSTLYLAAAARLVGAAVVTVDHHRGSEENQSGWEYHDTTLVDPRTGRLDTLPTLRTTLE
FT                   AAGVEDVVTAVVGRSEIVGRWWSTPIDLLFLDGGHTEKQAQADYEAWARHVRPGGRLVI
FT                   HDVFPDPADGGQAPYHVLLRAVRDGFSEMSRTGSLRVLRRLF"
FT   gene            complement(15821..17065)
FT                   /locus_tag="Franean1_0010"
FT   CDS_pept        complement(15821..17065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09479"
FT                   /db_xref="GOA:A8LB25"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB25"
FT                   /protein_id="ABW09479.1"
FT                   /translation="MRPGESATGASLLSPEALRATADAIAAAQEPDGAIPWFAGGHTDP
FT                   WDHLECAMALLVTGRVDAADAAWDWLHRRQRPDGSWATSHVGGAVKEDFADSNQCAYVA
FT                   TALWHRWLVTGDRAFVTRMWPVARAALDFVVDMQAPGGQIWWARTPTGEDYPEALVTGC
FT                   SSTLHSLRCGLGLAALVGEARPEWEVAAGALWHALRRHPEYFMPRDRWSMDWYYPVIGG
FT                   ALRGAEGRARLRSRWDEFVVPGLGIRCVDDEPWVTGAETCELAIALHLVGETEAAAGLV
FT                   REMQHLRAPNGAYWTGWQFADGCHWPEEQSTWTAAAVVLAVDALAGGPTERTFRGDDLP
FT                   EGLHVVHRDDLPEPRDPSTPRTGRGTAGERAPCGERRAGGLATPGRGGEALTGPWRACG
FT                   CDSEEPAEDPQRSRA"
FT   gene            complement(17052..17921)
FT                   /locus_tag="Franean1_0011"
FT   CDS_pept        complement(17052..17921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0011"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: fal:FRAAL0024 putative
FT                   3-demethylubiquinone-9 3-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09480"
FT                   /db_xref="GOA:A8LB26"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB26"
FT                   /protein_id="ABW09480.1"
FT                   /translation="MLTVDFTRFPVPRDARVLDLGCGAGRHSFEAFRRGAHVIALDYST
FT                   DEVTGVGAMLAAMSAEGQVPAGARAAPVRGDALALPFADDTFDRVIAAEVLEHLPEDTG
FT                   AMAELARVLRPGGFAAVTVPARLPERVCWALSDDYHNVEGGHIRIYRRDQLIEKLRANG
FT                   LELVGHHRAHSLHAPYWWLRCLVGVHDDDHPATKLYHRLLVWDMMRRPALTRMAERLLD
FT                   PVLGKSIVLYLRKPRPRPEPPARSPAQAGVTTDAQAVAAVDAAAQAGTDALAARAGGRT
FT                   PEVERAAR"
FT   gene            complement(17915..19291)
FT                   /locus_tag="Franean1_0012"
FT   CDS_pept        complement(17915..19291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0012"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fal:FRAAL0025 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09481"
FT                   /db_xref="GOA:A8LB27"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB27"
FT                   /protein_id="ABW09481.1"
FT                   /translation="MEGAPLRIALLSYRSLPTCGGQGVYVRQLSRELVTLGHQVQVVSG
FT                   PPYPNLDPGVGLTKLPSLDLYRDGDPFRWPGFREFRSLADVVEFGMMRTGQFSEPLAFS
FT                   IRAFEALRPRRGQGRPDFDIVHDNQGLGYGLLPLRRALRPYGIPVVSTIHHPITVDRRL
FT                   HLAATTSRRAALGVRRWYSFLPMQARVARGLDGVVVPSESSRHEIVADMNVPIETLHTV
FT                   PLGVEADVFTPRPAPPSDAGNGTVAPVPGRIIVVTSADVPLKGLMVLLEALAKLRAERS
FT                   AHLVCIGKVREGGAAQRQVGELGLTEAVTFRSNVPQAEMVDLLRSAEVAVVPSLYEGFS
FT                   LPLVEEMACGLPLVATTAGALPEVAGPNGEAALLVPPGDAGALAGAIATLLDDPELRAR
FT                   MGAAGRRRVEERFSWQAAAAGTAAWYERQIAAVRAAVPGSGPPPVAVSTGAAAPVEPAC
FT                   "
FT   gene            complement(19531..19959)
FT                   /locus_tag="Franean1_0013"
FT   CDS_pept        complement(19531..19959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0013"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: fal:FRAAL0026
FT                   putative organic hydroperoxide resistance protein
FT                   (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09482"
FT                   /db_xref="GOA:A8LB28"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB28"
FT                   /protein_id="ABW09482.1"
FT                   /translation="MAAPLYTATSTAWGGRDGRVVSNDNRIDLQLSMPKGLGGDDGPGT
FT                   NPEQLFATGYAACFHGALKAVARERKIDVTDSAVTVSVSISRTDEGLDLSTRIEAQIPG
FT                   VDPATGRELLDLAHAKCPYSRATRGNIAAEVTLVDGDS"
FT   gene            20169..20873
FT                   /locus_tag="Franean1_0014"
FT   CDS_pept        20169..20873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0014"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL0027
FT                   putative transcriptional regulator (HTH-type)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09483"
FT                   /db_xref="GOA:A8LB29"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB29"
FT                   /protein_id="ABW09483.1"
FT                   /translation="MPPDDPAAECVRPRRGRPRDATIDDRVLRAAVDELAGRGVGGFSV
FT                   NSVAARAGVAKRGIYTRWATRDDLVLAALGTLAAGLVPPRTGSLREDLLRLAPLVDAVF
FT                   TEPRMSILARCLAELPRYPGLYEAFRRESVDRCAAAVQDAFHDARRRGEIRSDLDTDLA
FT                   AAAFLGALLTRQAFGRQAFGRPRAGPGGPGGPGGEPGEPPEPPGAVTAYHRRLVEFSLA
FT                   AARGAGQAFGPA"
FT   gene            complement(20881..21498)
FT                   /locus_tag="Franean1_0015"
FT   CDS_pept        complement(20881..21498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0015"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14 ClpP; KEGG: fal:FRAAL4270
FT                   proteolytic subunit of ClpA-ClpP ATP-dependent serine
FT                   protease (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09484"
FT                   /db_xref="GOA:A8LB30"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB30"
FT                   /protein_id="ABW09484.1"
FT                   /translation="MPGYLLPVDVAAVRRPTGRGLAGGGLVEGLKAGFVGAAVDDALAN
FT                   RVCAQLLLLAQASRRQDISLYINSPGGSVDAGMAIYDTMQFIENDVATYALGLAASMGQ
FT                   FLLTAGTAGKRFALPNSRIMMHQPHGGVGGTASDIAIQAEQALHTRRRMQELIAEHSGH
FT                   SVAEIAADSDRDRWFTAAAAKEYGLVDAVVEHVRRVPAGFTR"
FT   gene            complement(21745..22848)
FT                   /locus_tag="Franean1_0016"
FT   CDS_pept        complement(21745..22848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0016"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: fal:FRAAL0030 putative
FT                   exported lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09485"
FT                   /db_xref="GOA:A8KX42"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX42"
FT                   /protein_id="ABW09485.1"
FT                   /translation="MTGGRRGSTELTDLPPGAPGELVSSAEVPAPDGMRAWRMIYHSRG
FT                   PLNEDRLVTGLVVAPAGTSAIPAGGRRLISFGHGTTGINDSCAPSRAEPPLSAVGGVLP
FT                   LVQAGNVLAITDYIGLGGPGEHPIYVADTEGRALLDAARAAHSLSDARAGRDVVLWGYS
FT                   QGGQAALAAGGLAASYAPDLRVHGAAATAPLADLPTSLRLLDRTVPDGVAYVLLAALGL
FT                   AAADPTIDLNAILTQTGRRLTAVARNQCAVGLLKASQGESTSSVFTADPFTTEPFAAGF
FT                   ARQWQQTRLPGPPELVLQGDLDTVIHRSTTDGVVSGLCASGGPVEYHRYGLADHGTILG
FT                   VSMADLTSWINARFAGTKPPGDICARP"
FT   gene            23241..24332
FT                   /locus_tag="Franean1_0017"
FT   CDS_pept        23241..24332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0017"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   fal:FRAAL0031 conserved hypothetical protein; putative
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09486"
FT                   /db_xref="GOA:A8KX43"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX43"
FT                   /protein_id="ABW09486.1"
FT                   /translation="MTTFASNTLALGPDFISADSLAKAGLVVVLLIVFAESGLLVGFFL
FT                   PGDSLLFTLGLLISQDEVSTPLWLACALIGVAAVAGDQVGYLFGRKAGPALFRRPDSRL
FT                   FRQEYVDQAHEFFEKHGGRSIVLARFVPIVRTFTPVIAGVSRMNYRTFVVYNVIGGLLW
FT                   GCGVTVLGSLLGKIDFIRQNLEAMLILIVLISVVPILIEYLRARRTKATTGDAAGSPDA
FT                   TNAAGTGPAGPAAGHGPAWVDGPVREHDRAPGAGFAGGYESTGGYQPAGGYQGGYQPVD
FT                   VYQSADGYRNADGWQPESRYDDGRYDQPRAGTAGAAGHGGHGYDTEGFQDARPREGEAP
FT                   IQEERGPAGRRGGGGRHSAPRHR"
FT   gene            complement(24683..25021)
FT                   /locus_tag="Franean1_0018"
FT   CDS_pept        complement(24683..25021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0018"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   fal:FRAAL0032 regulatory protein (P-II) for nitrogen
FT                   assimilation by glutamine synthetase (ATase)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09487"
FT                   /db_xref="GOA:A8KX44"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX44"
FT                   /protein_id="ABW09487.1"
FT                   /translation="MKLVTAIVRPHRVDDVRAALTTYGVHGITVSQVTGFGLEMWRTQT
FT                   YRGNAFHDESTSNIRLELVVADSDAPDVVNVIRRTAASTSSGAGKIWVLPVEGLARIRT
FT                   GERGADAL"
FT   gene            25136..25678
FT                   /locus_tag="Franean1_0019"
FT   CDS_pept        25136..25678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0019"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: fal:FRAAL0033 Raf
FT                   kinase inhibitor homologous protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09488"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX45"
FT                   /protein_id="ABW09488.1"
FT                   /translation="MSLLDRNTAPDPLDLLPPLPSFSLSSDDLTDGSPLGLDQVFSGAG
FT                   GADLSPHLSWTGFPAQTESFAVTCFDPDAPTGSGFWHWVLVDVPASVTELARGAGSGDL
FT                   SGLPAGAYHVRNDWGTANYGGAAPPEGDRPHRYVFVVHAVDVPKLEIDATVAPAVVGFN
FT                   LTFHTLARAVLRATYQR"
FT   gene            25853..26017
FT                   /locus_tag="Franean1_0020"
FT   CDS_pept        25853..26017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6838 putative transmembrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09489"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX46"
FT                   /protein_id="ABW09489.1"
FT                   /translation="MAGEGSRRRGVGMRKFTVVALVASAGALLTAARRRRNKDEIDLWR
FT                   EATSAAGNR"
FT   gene            complement(26159..26716)
FT                   /locus_tag="Franean1_0021"
FT   CDS_pept        complement(26159..26716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0021"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6835 polyamine
FT                   ABC-transporter integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09490"
FT                   /db_xref="GOA:A8KX47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX47"
FT                   /protein_id="ABW09490.1"
FT                   /translation="MSSTVLGMMIGISLGKHRFRGRAGVEFLLFSSISAPEVVLGASLL
FT                   SLFITLGVPRGYLTILIAHAMFNISYVAVVVRARLAGFDTSVEEAARDLGAGPWTTFRL
FT                   VTLPMIAPGVLSAALLAFALSIDEYVITTFNAGSTLTFPLWVFGATRAGVPPQVNVLAT
FT                   IIFISGVTLALLNAVVLRRRRT"
FT   gene            complement(26953..28206)
FT                   /locus_tag="Franean1_0022"
FT   CDS_pept        complement(26953..28206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0022"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: fal:FRAAL6833 ABC-transporter polyamine-binding
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09491"
FT                   /db_xref="GOA:A8KX48"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX48"
FT                   /protein_id="ABW09491.1"
FT                   /translation="MTSNDRQGIPAAPGASHGAVPDPALLRGLTRRRFDRRDLLRLTRA
FT                   AGSAALLAACGVKGEAGDSAQAADVAGYWAGKAKAGTLDFANWPLYMDVGSTDAERPSL
FT                   DLFTQETGIKVTYREVIQENESFFAQIRPSLAENQPIGYDLMVLTNGITLSRVIQLGYL
FT                   APLDHKRLPTFAANADPSVKDPAYDPGNQFTVAWQSGITGIAYDPEKTGREITSFADLM
FT                   DPAFAGKVGMFGENQELPNLALLGIGVAPADSAPEDWRRAADKLIEQRDAGIVRKYYDQ
FT                   SYIDSLAGGDLWISMAWSGDVYQQLAAGTKLKFVVPEEGGLIWTDSMCIPRTAAHPVDA
FT                   LTYMDFVYRPDIAGMLAEYINYITPVPAARDHVSPELAESTLLFPTRAEFDRVHRFRVL
FT                   TTEEETEWNKIFQPVYQS"
FT   gene            complement(28203..29546)
FT                   /locus_tag="Franean1_0023"
FT   CDS_pept        complement(28203..29546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0023"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: fal:FRAAL6832 polyamine ABC-transporter
FT                   ATP-binding protein; TIGRFAM: spermidine/putrescine ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09492"
FT                   /db_xref="GOA:A8LB31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB31"
FT                   /protein_id="ABW09492.1"
FT                   /translation="MPSSLSTPMSSRRSREQWRGQRGGDPGRRRPRCARVPAGRIRRTL
FT                   APAIEFVGVAKEYSSRAGLVGAVSRVDLSIEQGEFFSLLGPSGCGKTTTLRMIAGFEEP
FT                   TRGRILLHGRDVTAVPPNRRDVNLVFQSYALFPHLDVASNVAFGLRRRGVRGQELRRRV
FT                   GEILELVELSGLADRRPRALSGGQQQRVALARALVNRPRALLLDEPLGALDLKLRQTMQ
FT                   IELKRIQREVGITFVYVTHDQSEALTMSDRIAVMNRGRVEQLAAPREIYERPGTRFVAG
FT                   FIGTSNLLRRSVRSVDPAGVDGTPVAVLDSAAEERLVVPLRPELGRPATGSELEMTVRP
FT                   EKITLGVTRPNGTCCALHGRVTEVVYLGTYTTYTVLTHGGSEITVFWQNSADATNIADR
FT                   GDEVWLSWLPTHSFALAPSAHAKSTPPSALAPSGSLREDQNHTEGLAS"
FT   gene            29898..30662
FT                   /locus_tag="Franean1_0024"
FT   CDS_pept        29898..30662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09493"
FT                   /db_xref="GOA:A8LB32"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB32"
FT                   /protein_id="ABW09493.1"
FT                   /translation="MRRLAAPSPLPGPEYTPSAVPLDILLGCARSHARLLEAVARVDDT
FT                   TARRPSLLPGWTVGHLVTHLARNADSHTGMFGAAAEGRVVAQYPGGLTQRDGGIEAGAH
FT                   QPADLLLADLAGAVARLERAWDGTHVDVWRGGLGLTAARGATSVADLVFLRWREAEIHL
FT                   VDLALTDRGGPEWDDLSPAYVEAEWAWSTRLLPERLPAEVTVLLTPGDRPSRAVGRGPQ
FT                   VVRVDVPTLPALRWLTGRDAGDPAWPPLGPWT"
FT   gene            30889..31950
FT                   /locus_tag="Franean1_0025"
FT   CDS_pept        30889..31950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0025"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   fal:FRAAL6830 hypothetical protein; putative ParA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09494"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB33"
FT                   /protein_id="ABW09494.1"
FT                   /translation="MISMALFNNKGGVGKTTLAYHLAHMFQRMGHRVLAVDLDPQANLT
FT                   AQFLDEDELASLWKEDEDLGSSAPRSAVLDPRRSRIRPGNGTLATAIEPIMEGVGDVRL
FT                   SEPVTVEDGLWLLPGDVNLASFEDRLSAAWPNSFLGRDVAALRTTTALHRAIDHGARET
FT                   GADIVIIDVGPNLGAINRAALLSADTILMPLAADLFSLRGLRNIGPTLRDWRVTWQGTI
FT                   LPRIPERIPAPRGLMMPIGYILVEPPARADRPSKGHGRWLDRIPGVFTTSVLGSAAPAD
FT                   GDRSFEIATMKNYAALMPLAQDARKPMFELRAGDGAVGGTQSAVRRCFSDFRELATKVR
FT                   DRLVFIDPTLRRG"
FT   gene            33852..33924
FT                   /locus_tag="Franean1_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            33852..33924
FT                   /locus_tag="Franean1_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(33926..35488)
FT                   /pseudo
FT                   /locus_tag="Franean1_0026"
FT   gene            complement(35609..36013)
FT                   /locus_tag="Franean1_0027"
FT   CDS_pept        complement(35609..36013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09495"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB34"
FT                   /protein_id="ABW09495.1"
FT                   /translation="MCQITVRSVSDQRRRQPAPQPAARAGSARGHDTASTPRPAPGEDF
FT                   HDGKHRDSAASLGLANVRPRQATTGRKPEGLPPLRPPVLTPMTAQQFTDAVHGLADLIS
FT                   LHLAPSLPRKIRHSPQQNRDRLESIDITEQ"
FT   gene            complement(36044..36967)
FT                   /locus_tag="Franean1_0028"
FT   CDS_pept        complement(36044..36967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09496"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB35"
FT                   /protein_id="ABW09496.1"
FT                   /translation="MIRCQISVRSPSDARVFTRTRKAAPPTSHMLCAMWADILLRRNRV
FT                   PQPPRHPPGPEPHPGHSTRLLVHGPVPSGRPCNAPAARSIATSNNTDALALGATGTGIV
FT                   TASPTGPTTDRSHSCARGVRPSHGRHTLRGRRRGTHRRSTTATASERNLTDPSTVSRPI
FT                   PAHPKAAHDLSPDIFQAGFRSSSPPCVASVASLCAGFPLTPAEGPPAAPSTSTGQPECM
FT                   DATAPAVPARPKVSPRSASDSPRFSPQPRSSGDRRSSPTDCTASPSIRPALPPPHVTVD
FT                   EDVRVLCGTSGRPSQSESPLAWANTI"
FT   gene            37290..37865
FT                   /locus_tag="Franean1_0029"
FT   CDS_pept        37290..37865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09497"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB36"
FT                   /protein_id="ABW09497.1"
FT                   /translation="MNQTQRPHVNRRMVRAFLHTASICGRLGRRERPEVIVVATPPAGP
FT                   HPVPPSVPPLSPEPAEWLTSPWSRIVSGLRPWSRSRRVARDPADVVLASTRGTIAFGSR
FT                   PQDAGDLAGPGNLVPAECDLSRLPVCTATVRVPDAEAGAAAHTARIRSLPPAVNGRTSK
FT                   PGIPAWRHVACHGVGARRGICRGTGTGL"
FT   gene            37862..38839
FT                   /locus_tag="Franean1_0030"
FT   CDS_pept        37862..38839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09498"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB37"
FT                   /protein_id="ABW09498.1"
FT                   /translation="MSGPAVPRRRPGSGGRVSDEHVWYLASRLTARDRWLLAMLAEHQI
FT                   LTTRQIALLCFSGDRTARARLALLAELRAVDRVRPLRGDLATPYHYTLGPAGAQVLAAQ
FT                   AALPVSEFYRRDRGLSLIYSRLLDHTVGANGLFVAFAHASRPRPANDGLVLWWSEKRAV
FT                   TMWRQWVRPDGFGAWYHQGRRLDFFVEFDTGTEPLTRVAGKIPGYAKLAVSSGMVSPVL
FT                   IWLPTPTREANLRRQLLITGGVVVITASPPPGTAPPELDNSREAVDLAAARPVWLPLGS
FT                   TTRADLDGLTLRFGRPAGPPGPSDEDEEQSAPPPRPPQPRRPRP"
FT   gene            complement(39584..40471)
FT                   /locus_tag="Franean1_0031"
FT   CDS_pept        complement(39584..40471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09499"
FT                   /db_xref="GOA:A8LB38"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB38"
FT                   /protein_id="ABW09499.1"
FT                   /translation="MASSRPTSKSVRSGRPTGRATTGSAEEDLLIVHRHQDHPEGRRRL
FT                   SRAETTVLAEARVRPGQDLVDLSQASTLTPAALWAVVPGGSVTTLTPTAVALQRIRPTP
FT                   ENGHTWGSVWDLLEHPVPLADASVDAVIGRSVLGPLRHPRRMLTDIARVLKPGGWLSLC
FT                   EPLLGQSRPVSLDGLSAHEIAQAEQVLAGVRPAAHAFTAAHAVGNARLAGLRPVEHTEE
FT                   TVTAPIIGVAAADAALRAVGPAGESAYQAISRVLGAAFARQYAEAWRSTARRRPLILET
FT                   PIAYLTMIKRETSR"
FT   gene            complement(40475..41677)
FT                   /locus_tag="Franean1_0032"
FT   CDS_pept        complement(40475..41677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0032"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL2702 putative
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09500"
FT                   /db_xref="GOA:A8LB39"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR027573"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB39"
FT                   /protein_id="ABW09500.1"
FT                   /translation="MTSCTADVSLAPLRNAMVERILAAKPVSAPVEAAMRTVPRELFLP
FT                   NLPPEVAYQDRAVVLKRDVYGNPVGSVSQPSVIAAMLEALRVEPGQRILELGSGGYGAA
FT                   LLARLAGRTCSVVSIDLDETVIHRTHEYLRAAGYTGITALVGDGRYGFRLRAPYDRIIV
FT                   TFDTLDVPQDWFDQLVEGGRVIIPLHLRGLTRTIAFTKTGGILTSDSIRPFAFGPMQGF
FT                   GVPRRTTVSLAGGARLDVGPDQDVDVDALCAALAEPRHTVGTGVILPPGNTLLPSLDLW
FT                   LATAQQTYGRLHTDTRTDQQGPDASAIPPGVPAVWSDDTIAFLALAQTTGTGLELGVIA
FT                   YGPQAGRLGDQLAHDVRAWNTEHYGKLPTIKVYPRGIVEKSPPPGRLLDLPSAQVLISW
FT                   G"
FT   gene            complement(42120..42485)
FT                   /locus_tag="Franean1_0033"
FT   CDS_pept        complement(42120..42485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09501"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB40"
FT                   /protein_id="ABW09501.1"
FT                   /translation="MVGCAVRMTPRSPLVPVALRPVVLIARMAALPELTPPEDIARILA
FT                   TFTPPIDPASPEWAALRTALDRYDAAHDQAAFDAARRQIVLAAVTLLLGPPGYSAPDTP
FT                   ARCRVPAQRTPPPSRRT"
FT   gene            complement(42461..43171)
FT                   /locus_tag="Franean1_0034"
FT   CDS_pept        complement(42461..43171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6353 putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09502"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB41"
FT                   /protein_id="ABW09502.1"
FT                   /translation="MTGSISAVIRVAVARFPPTTAAVPDLRASTVRTLTRWSVDPDAVD
FT                   VAEVVVCELASNAVKASGPDDVVALRLTICDAVLTIEMWDASTAPPVLTVAHPDQESGR
FT                   GLVLVDAVSLRWAWYRSRTGGKVTWAQLPAATTPAVPTDSTAALPTRAATPVPAPAAPV
FT                   TFHDDPATLRRVIDRLRALDDWHRPPPGRGVRDRTPGGQTPKVPDQFVSPLDVEIIGYF
FT                   SPGISRTWSAAQSA"
FT   gene            complement(43221..43496)
FT                   /locus_tag="Franean1_0035"
FT   CDS_pept        complement(43221..43496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09503"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB42"
FT                   /protein_id="ABW09503.1"
FT                   /translation="MEEHRFVVWDADERPLGAFGDFDAAHEWAHRRLRQALTRLPLTKV
FT                   SRRLSQARCELVAWVEFAVLPVCDLPGLAPAMGDLSCSQSAWPARG"
FT   gene            43699..44568
FT                   /locus_tag="Franean1_0036"
FT   CDS_pept        43699..44568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0036"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL0518 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09504"
FT                   /db_xref="GOA:A8LB43"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB43"
FT                   /protein_id="ABW09504.1"
FT                   /translation="MPSTPGPTVRRRCLGAELRRLREAKELTVDQAGEHIHRSGPTISR
FT                   METGQFRFVLRNVSDLLDLYGVTDDEQRQALLALVKENRRPAWWHSYGDLVPRWFQVYI
FT                   GLEAEASTITTFESLLVPGLLQTEDYARAVIRAASPELPAHEVDRAVEVRMNRQKILTG
FT                   DQPVQLWAILDEAVIRRHVGNPTVMARQLDRLIEAAEQPAVTIQVVPFTAGAHAGMIAS
FT                   FTILGFPDTGGASETVYIEAPTGSLYLEKQAEVRRYEAWMNQLRSSALAPTPNTLSIIK
FT                   AAREDLQR"
FT   gene            44565..44774
FT                   /locus_tag="Franean1_0037"
FT   CDS_pept        44565..44774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0037"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397; KEGG:
FT                   fal:FRAAL0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09505"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB44"
FT                   /protein_id="ABW09505.1"
FT                   /translation="MTTHGADAPLNWRKSSYSGGTGGNCVEVATLPDGGRAVRDSKHPD
FT                   GPALHFTATEWAAFLAGTQDGEFD"
FT   gene            45693..46814
FT                   /locus_tag="Franean1_0038"
FT   CDS_pept        45693..46814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0038"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sen:SACE_2322
FT                   phage-related integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09506"
FT                   /db_xref="GOA:A8LB45"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB45"
FT                   /protein_id="ABW09506.1"
FT                   /translation="MVDRESVAGAAGLYLVAGVPLLRADEQVFAAMLEGWGSQQTARNL
FT                   AVGTVEGRVRAVRAFTRHAEAFPWAWTAAMVDEWCTDLRAVRNLRRSTLRNYQEAVRLF
FT                   CVYVTDPAYGWPVRCEQEFGAHPVQICHEWNTTVHAQQSESDPGKRAFTVDELQAFFDY
FT                   ADEQVSRIRAAGRKGWLPAFRDAVLFKVAYAYGLRRREVRMLDLADFGRNPHGPEFGDY
FT                   GVCQVRFGKASKGSPPKRRGVLTVWTWTPEILAEWVEEFRPLLAPQDCPALWPSERAPR
FT                   VALTQINARFSTYRDALGLDPALDVHSLRRSYVTHLIEDGYDALFVQQQVGHEHASTTA
FT                   IYICVSSDFRTRTLRRALDQTLAAALTPTEKAR"
FT   gene            46811..47149
FT                   /locus_tag="Franean1_0039"
FT   CDS_pept        46811..47149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0039"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: stp:Strop_2907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09507"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB46"
FT                   /protein_id="ABW09507.1"
FT                   /translation="MTIRRQVSYQWRLREVMATRGLFTITDLVPLLAERGITLSASQVH
FT                   RIVTGTPERLSLPVLAALCDILEVTPAELIVTRAVNATLRRAAAGDVPAPVDLAGEIRP
FT                   KRARLRPE"
FT   gene            47146..48660
FT                   /locus_tag="Franean1_0040"
FT   CDS_pept        47146..48660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_2905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09508"
FT                   /db_xref="GOA:A8LB47"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB47"
FT                   /protein_id="ABW09508.1"
FT                   /translation="MTARTGRYTAEQYERWHIRVCARCGRRASLSANWSDGPICRSCYD
FT                   RAARTYGRCPGCQAERLLPGRDDDGAALCRDCAGITRDFFCSRCGFEGLLLGGRLCERC
FT                   TLTDQLAAALDDGTGNVSPPLVPLLDALRVMPKPKSGLAWLRNPRVRELLADLATGRVA
FT                   LTHEALHALPNWRTVAYLRDLLMACGVLPAVDKQLLHHETWLHRQLAELDGHPHARLLR
FT                   QFGTWAQLPRLRHRAAARPLTPHARKEAAAQFTQARLFLAWLDERDRTPETLTRTDVDV
FT                   WHATHLDHAKRSLRTFLTWAMDSGHLPCLDLPRLQIVRAEPLTQRRRLDLVKSVLTSET
FT                   GSPPTRAAACLMLLYAQPASRIVRLTVDDLTRDGDQVLLRLGDPPVPVPDPFATLLLTA
FT                   ATRRDNMTTATNPDSRWLFPGRRAGQPLHPCSLLDQIRALGIPIQAARTAALRQLVLQA
FT                   PAPVVAQALGYHPITTQWHRADAGGTWTHYAPGDHAGPSPTPPVIT"
FT   gene            complement(48701..49600)
FT                   /locus_tag="Franean1_0041"
FT   CDS_pept        complement(48701..49600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0041"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   fal:FRAAL3884 putative aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09509"
FT                   /db_xref="GOA:A8LB48"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB48"
FT                   /protein_id="ABW09509.1"
FT                   /translation="MIESEMEINEDLVRDLLREQHPDLAELPIREVVGGWGNQMWRLGD
FT                   DLAVRMQRMDKSPDLQLKERRWLPQLASRLPLPIPTPVRSGTPSEHFPKIWTVMTWVEG
FT                   TPLDHGSITRGDHAADMLAAFLAALHVEAPAEAPDAVDVGAHPKQCTGGFEHFLRSVDL
FT                   GGFTEDDIRAVWDDAVAASEWQGPRVWVHGDLHPANVVIAEGTLAGIVDFGAVFAGDPA
FT                   WDLAAAWLLLPAGGASRFFNSYAQADEATVRRARGLAAMKSLFLMLMGQNGDRGLPGGK
FT                   PHWGPAGRSALDRVLKGL"
FT   gene            49995..50705
FT                   /locus_tag="Franean1_0042"
FT   CDS_pept        49995..50705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0042"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: psa:PST_0242 probable
FT                   DNA invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09510"
FT                   /db_xref="GOA:A8LB49"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB49"
FT                   /protein_id="ABW09510.1"
FT                   /translation="MAVPDDRGPGRPWTPRPPTAPVPAPASPATAIRIGYARCSAAQQD
FT                   LASQLEALRAAHCKRIFSEKISTRIKVRPELEAALRLARDIKQAAPDQPMILTVPELKR
FT                   LARNAAELMTPSTTLQADGVQLELLTGPLTGIYDPHGMSSMLFAILAVAAQLDRNYIRE
FT                   KTLEGQQTAAARGNHGGRPRVIDDDMLVFARALKDRGIPMPEIARKLTHCCRKTNTDDR
FT                   ASGFPKTHQVPGPA"
FT   gene            51034..56460
FT                   /locus_tag="Franean1_0043"
FT   CDS_pept        51034..56460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_2635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09511"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB50"
FT                   /protein_id="ABW09511.1"
FT                   /translation="MESVIGKVHGPDGSSFVGHSVRLRYTVDLGDRDATPPTALPVRLE
FT                   SAAPLAADGDFALAIADAPLVGTATVTIVSPAGVTINEGTLSVDALANPVIVSATPAAP
FT                   LPVLPNHEPGTGPRVRLTGRVIDDRGHRVSSGLPVVISGRRVDQNGDPEIADRVLLVTD
FT                   TQPGGTFGADWPTDELATAHGVVKGLPPVPIPLVGGRLPLKVLLVVSLPDDEREDCACD
FT                   NTAPRAPDPSDLTSNPAAFSQDMGGTCVDLTTPNRVVEEFAYFFVVRTSEPEIRGTTLG
FT                   TRRVLPPAVTRELLGAVREALPAAEGASTRAIRGLSLDTAALKSLVATDAIPSVDQLQV
FT                   AAYHSEVAAVSRLVDALRRRQPGRVALDASSAVDWDDTPTIYQAASVAHGHILQYREVW
FT                   RADGYSLGDLLYSLPLAPGQKRKLAVLDWERQTTSARTERLDFEEQLDAFAERDRDISE
FT                   IVGSHLNEESSGGSRSNTWGVAGGIGAGFIGSGFGIFGGVAGGAGGSSARAWQDNARDL
FT                   SANSLQQLRDRMVQRSAAVRDVRSTTVQTVGQGETVRAETETVANYNHCHAMTVEYFNV
FT                   LRHFLVTHELADVRECLFVPLPISEFDRAKAMRWRSALQRFVSDPTLRRGFDAIERISR
FT                   NWVGYDFPVDRYSEEAPESLEGELYVSFLLPRPRDAADGTFQVDMWKSCQWLLPIDALE
FT                   LFTAKLAARAQRERDLVFRNEIAPGIAEQLVQHLRFAYVTASGAQLGVRLDPTLVSRYA
FT                   ESTPLYVTLRPSGAVPAIPREDIARFRIWYDGPALPSAARVIVHRGKVRYRTEHLQYLL
FT                   FDEPRLLNDISSTDDIYVATPLSRAELRSPRREDIEAADRLVKHLNTNIERAHQAIWAS
FT                   MDENRRYLLLDGVIAPNSGGRSVASVVENRLIGIVGNCLVMPCGPGIQLDPSRAVPQAR
FT                   TDGEPVEPQPLIDLYATAPLPSTRISLPTRGVYAEAVSGECNACERIDDTRFWRWEESA
FT                   ITDTPPDIAALSTASRASDEPDLTPTPLPAAIVNIQQPASLPDPLGLSAAMKVLARNDL
FT                   FKDITGLEGSQKNALAGFKAALGMAQTLGGEAANLARQNESARNADRLMDSIQQAQRDK
FT                   LISPDQAQQLTQSVLRSASGEASAKDRPAAPAEDPGVQKAIDSAADSPRATVSVTTPTE
FT                   SLDATFDGGPKPPVIGGAPAIGGTTLTFDLAIPFIDDWTQPAPGTPPGPLTRQRWTETR
FT                   KIAKLSTASSVTQRTGPTSFSRFDLAAAALSNGLIKREAPGSDTFVVPTKMRLAHPAPS
FT                   AGSKVVAGSGALPLVVFLHGNHQAWDFTFGPPTSTMTALDGAGNPVTVDIVDTTTAFTV
FT                   TPNHEGYAYLQDSLAASGYASISIDTNFANTFNSAIDTRALTVLAALDRLRTAAETKGN
FT                   AYFGRFDFHKVVLVGHSRGGDAVVQVARLNAKRVTKKYGVLAVCSLAPTDFSGTAAAGD
FT                   GPFVLTPNETGFFLAIQAALDGDVSGVGGATAGTGTVFRHYARATCQKALVQLTKCCHN
FT                   RFNTVWSKEPIDRAHDDSALVDAEFNALHTHATHRQLFTEYLTALLEKQVRKNSKDVAL
FT                   FTGQRSNSAGVDAAHQWAFGRTVTLMDSFEAAASDLGGARTLTAAAVGPFLDVKVPEST
FT                   LKRGGNAGTLVAITEHATHVTKLANLDTAVVASGTAFTIDVPSAKRDWSGFEVVNLDVV
FT                   GTFDLTKASSQPVPVLTVTLTDGSGTTKQLTARNVLNQPSTHIVNYDRAVPKDPTKEQD
FT                   ATLFRLETLSFELPRTSTVGGIDSGDIVSLTVDVDLSVGNTVLIDSITLVAL"
FT   gene            56470..56763
FT                   /locus_tag="Franean1_0044"
FT   CDS_pept        56470..56763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09512"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB51"
FT                   /protein_id="ABW09512.1"
FT                   /translation="MAIIDLTDVLYESVEPTADLPYVLRVHLVGHGFVQRAAPVIGAVG
FT                   DQALAAVIVDQARDAASGFLRSAPPAGAVVRVGYLDTGLADTAFTFPQIPNA"
FT   gene            56774..60883
FT                   /locus_tag="Franean1_0045"
FT   CDS_pept        56774..60883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpf:lpl0694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09513"
FT                   /db_xref="InterPro:IPR022118"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB52"
FT                   /protein_id="ABW09513.1"
FT                   /translation="MMRGKLNPDPVRPLDGYRVTANVDVPMLGDDGQTTTTVAVGADVT
FT                   SGGDVAIELPERRTGDVRLVATAPDGSRVGATTIAAANVDQPFTLDVTTVDPVTVVPSD
FT                   VPGLGRRERLVGRVLDPQGAGAPAKLLVVVWGVPHGAQPTDAVPLLVAETAAGGYFGDD
FT                   LPPDELDDAWAKVAGGAPVPILLDGGRLPRTVVIVTPVKASHDNDDDGCGCHAAPPRSP
FT                   DQADLAANPEAFAADPGRCVDLTVPNRALEEVTFHAVVRTTQPEIRGLQMPNADDVPSP
FT                   VVDRLVQLVASRPIEAIARLESPSTYTTSVDAAIKPASSPQLAALAVRAAVPEVDEPTV
FT                   RRSLNLRADVVGELMRDGAHLRVDDLLHAERVSTIRTVRDIVQAVGGAPAGRVELGGET
FT                   QVDWDDTPTLYQATTIAHGHLLTFKQVWRADGYSLGDLLYSLPLAPGQKKLIAVVDWDR
FT                   REVEVRQAQRSETEVLDASLAHDRDISEVISSSLRQSMRGSSSADTESIAGGIAGFIGP
FT                   VVFGFGGGSSSAGSTASQRSSRDVAGTMLNQARDRTLQAASAVRSQRATVVQTARQGES
FT                   LRVQTDVVANHNHCHAMTVEYFEVLRHLQVTQEIAHVQECLFVPFEITPFNGAKALRHR
FT                   DVLVRHVPGALRRGFDALERMRTNWSDADFPLARYADEPLTYLDGELQMSFSIPRPADG
FT                   GTDKDQFDSSKWSVYEASGLLAQPAQTLWNAYLGTAVVANRDAIFAASIAPNIAQRIVD
FT                   RLALRLVLDNGSPVGVGIDATLVSRYRPDAPLLVSLRPTSTTPAVVRAQIERAVISLGA
FT                   LLPPEAKLVVQQAGLRYRTAHLEHDLVPTQRTYNDLGPGDEVELVVGLDRQEKRNPRAE
FT                   DPRLADALVDHLNEHIEHYHQAIWREMDPNRRYLLLDGFVAPNAGGRSVASVVENRLIG
FT                   IVGNCLVMPVVPGVKLDRSYEHSKRTQTDLLDLYATDPAPPMRISLPTKGVFAEAVLGA
FT                   CNSCELKDDTRFWRWEESPIPDEPTPIEQVSTATRRSTVPNLTPDAFPQALVRFQDVPT
FT                   APAPSALAAALELIGTPNLFSDITGLALNQANSAAALEEASKTATFFAQQGAALAQQRF
FT                   LASDTQRQLKRIKDARDQKLITPEQANERAMSLLQGATGERRPEGQVTTANPAVQKVLD
FT                   RVSQSSNASMTLRRPDGTVSVKKGDDAGGRIDVTADPPVGLIKQPTNLVCWAVAGAMMA
FT                   NWRDRRSATIQTVLDELGGTWRAKFDANQALAVAETVGFTKALGLVAEGPASYLPIGIA
FT                   RLVETYGPLWVISDDTVENNQLVHVRIVTGISGGGTAETTMVNIVDPDLDQPTTETFAE
FT                   FARRLEANDAIDVGLGIMRFPTVQTT"
FT   gene            complement(61226..61570)
FT                   /locus_tag="Franean1_0046"
FT   CDS_pept        complement(61226..61570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:pnf2850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09514"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB53"
FT                   /protein_id="ABW09514.1"
FT                   /translation="MIAEYMSVEHATLPVSDPEMTHQLLLTWLEHRRTSWPHTPNRHVL
FT                   VNERTALGTGPISPNYLHQHLLRHGVRLDRIRADRVLHEGGRRDTEERGNGLSGGGLLD
FT                   RGLPAGQRLW"
FT   gene            complement(61583..61909)
FT                   /locus_tag="Franean1_0047"
FT   CDS_pept        complement(61583..61909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbb:BCG_3348c putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09515"
FT                   /db_xref="GOA:A8LB54"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB54"
FT                   /protein_id="ABW09515.1"
FT                   /translation="MPELEPGAVNISYGVFPHWRGRGITRRAISLVYHWLRTQPACTTV
FT                   VIRVAPDNIHSLRIPEALGFQHVEPSTSPQGEELIRFDKAIQRHTSGQPAQDARPDDAA
FT                   SHRL"
FT   gene            61929..62132
FT                   /locus_tag="Franean1_0048"
FT   CDS_pept        61929..62132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB55"
FT                   /protein_id="ABW09516.1"
FT                   /translation="MPTRAVEATSKTPKFRRGPPVAHCSRLSRIQGRSRSSEPGPPDSQ
FT                   RIRSSSSPADVLRRHRRRGTAA"
FT   gene            complement(62283..63137)
FT                   /locus_tag="Franean1_0049"
FT   CDS_pept        complement(62283..63137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09517"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB56"
FT                   /protein_id="ABW09517.1"
FT                   /translation="MSGSELLRETTPPQYRPYWSERRAGTSPGRAGLRATARQFIDIVS
FT                   HLNNHGYFEQAFGKDCVDDPSEIDPSAVIERAIGATDLWPLTPDRLAQNIDVFCDVVEV
FT                   LHDLVARPRSRGLHDYDGCGWHYRDFSPATGRVVYRWRVNGLLERSDLGLHLADEGEDV
FT                   GRLVTSTDPARSDLLRRMAQRESPAADRLRHAISLYRARHADEHTKRSAVVVLGGVLEE
FT                   RRQLIKDELLSKDEGDLFTIANKFAIRHQNEQQKTDYSVEFLDWIFWWYLATIELTDHL
FT                   RAR"
FT   gene            complement(63167..63649)
FT                   /locus_tag="Franean1_0050"
FT   CDS_pept        complement(63167..63649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09518"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB57"
FT                   /protein_id="ABW09518.1"
FT                   /translation="MWPPPAASDHQKRSYVTDLSRQDTPVRECGHRGVLGCTGMSRRPV
FT                   LSDAQAPLFRQSGRRRVTGGQDGSSAAARIRLVLHSHRPLTRIGTRLMYDGGDYELVWP
FT                   RHLFVHEASNLLNHRRIHRDWDDRCVLLLDHAFAGPTPQDDFRQAAAQSPPPRGLS"
FT   gene            63682..65379
FT                   /locus_tag="Franean1_0051"
FT   CDS_pept        63682..65379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa54280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09519"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB58"
FT                   /protein_id="ABW09519.1"
FT                   /translation="MARVSQRAEQRQLRGRMREFGMSHDEIAGEFGRRFRFRPRAAFRH
FT                   AFGWTLEEAADAINAQAASLGLDPVGRASMTGPRLSELESWPVSGARRPTPQILALLAH
FT                   VYGTDIHRLLDLEDREHLAPADLLLLDSCVREVGAARGQSAVTPTSATRGRNSLPRSGA
FT                   AGGLPQPALLQAFVDNEPISRPPAVRSQAPVPVGGEGEGSPTKRREVLAAVGASAVAAL
FT                   LAQSAAESAMFGQRWEESDLGSTTLEHLDLEVQRFGLSYLHTPPEQLFVQVRECRQRVS
FT                   VMVAGRQTLGQRQHLCVVGGWLSGLMGSLALDLGDSTVAHAHCLTAWQLAVESGDARLG
FT                   GWVRGTQAMIAFYTGDAADALRYALAGLDVAPRNSFVRTRLLAQLGRAHARLGDADGVS
FT                   VAFARADDSFESVTETASHSIFSFDYPYLPFYAGTAYTALARPEKARAFAQQAVTLCDA
FT                   AAVNWPVARALARVDLALAAVRQKEPDRACAVTVEALEICATERPLDLIVRRTGEVVRE
FT                   LRPYKELSSVRDLHERQTSLARTVRGTQRTPSDPGASSAVHDRQADIL"
FT   gene            65379..66158
FT                   /locus_tag="Franean1_0052"
FT   CDS_pept        65379..66158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0052"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   syg:sync_0860 3-oxoacyl-(acyl-carrier protein) reductase
FT                   BH0932"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09520"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB59"
FT                   /protein_id="ABW09520.1"
FT                   /translation="MDLHLSGKVALVTGGSRGIGRAIVSRLAAEGCRVGICGRDSDALV
FT                   QAAASLDLAESDVFSLTADVTRPGDVERFVEGAAEYFGGVDLLVANVGGTVGGDLLDST
FT                   PEDWAQTFELNAGHAVRAIRSAVPHMKKNGGGSVVIVSSISASKPSPRAQYGAAKVAEI
FT                   YLASAFARELGPFNVRVNAVSPGSILFPGGGWENYARQHPEDFETFVQRDFPAHRLGTA
FT                   EEVADVVTFLLSDRASWVNGADIAVDGAQGRPSARGY"
FT   gene            complement(66165..67283)
FT                   /locus_tag="Franean1_0053"
FT   CDS_pept        complement(66165..67283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09521"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB60"
FT                   /protein_id="ABW09521.1"
FT                   /translation="MNPVALALACFFPLIGRPRLACQPLPDRVAEIAEIAQAAARDGAD
FT                   GLAEGAHALNKAALLASDCGLAPLARDLCWQHINIYCAVPRPLTVHEARYMLEPALNLA
FT                   RLQIRASDGEQALGLLTAMFQAVSSNTDLVVDGRVLPLTDLIGTRDERHKLREWVWLHL
FT                   VGDGVRALALAGRWDDAVIHADTYRGIGLHLLEGRQAKILAHCLTGTSAEARAALAEST
FT                   PMYPWELQVASCLEVMCTEDTSTAHGVTTMIGQFLGQRPMPGYAVFRAHLGMTVAALAA
FT                   TTDPDAATRVLTQTVEEVIEAEDGYAARDVLRLRPTQAVDLPARHEKALADLLNASGLR
FT                   AETPPEPVLESVLGSARTAEAAIVAATHPQRR"
FT   sig_peptide     complement(67218..67283)
FT                   /locus_tag="Franean1_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.965 at
FT                   residue 22"
FT   gene            complement(67290..68258)
FT                   /locus_tag="Franean1_0054"
FT   CDS_pept        complement(67290..68258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0054"
FT                   /product="putative O-methyltransferase"
FT                   /note="KEGG: fal:FRAAL6342 putative protein; putative
FT                   signal peptide; putative O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09522"
FT                   /db_xref="GOA:A8LB61"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB61"
FT                   /protein_id="ABW09522.1"
FT                   /translation="MPAHSLSVTAPRDLAAGVLAVLAGADLRATATSNALDPADLDDAV
FT                   RVYQAAGLAALEQRADQDCYQVRVQFPDWSTAEATAVTQLGPRLDQLQDSGVVGGWWFL
FT                   RKHPCWRLRLHHTDTAAVDQVLDELTAAGALARWWSTVYEPETFAFGGPAGMDTVHELF
FT                   CADSRGVLDYLRHDTPGLGRRELSILLINGLLQTAGLDTFERGDVFARVAGLRPASAAA
FT                   DHPKIAQLAANVRLLLSIPDLPTSDLFAPGGPVAHAAPWLSAFHTAGRQLGDTAAQAQL
FT                   GRGLRAIVTHVLIFHWNRLGLSATSQAVLARAAATALLPRD"
FT   gene            complement(68240..69427)
FT                   /locus_tag="Franean1_0055"
FT   CDS_pept        complement(68240..69427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0055"
FT                   /product="Lanthionine synthetase C family protein"
FT                   /note="PFAM: Lanthionine synthetase C family protein; KEGG:
FT                   fal:FRAAL6343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09523"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB62"
FT                   /protein_id="ABW09523.1"
FT                   /translation="MTPGTAAAVETFSADDAVRQSLARGPVGTALLQIERARTGSGGWD
FT                   TAHAHIRRAVAGPVDAAEHAGLYYGAPALAFLLQAAADGNPRYRRARDTLDTHVLRLTR
FT                   RRLTLAASRATRGEPTAFAEYDLFYGLTGIGTLLLRSHPDSEILADVLRYTVSLTRPRR
FT                   ENGVNLPGWWVTHDPDDTLPTPGGHANLGMAHGAAGLLALLALATAEGHLVDGQGEAIA
FT                   TLTSWFDQWRQDGADAPWWPQWITREDLRTGRPTQTSPGRVSWCYGTIGIARAQQLAAL
FT                   ATHDQQRAQDAESTLAAALTDTQLDRISDLGLCHGLAGIYQTAYRAARDARSSAIGRRL
FT                   PAIAARLAQHATASSVTGEQDSGLLTGTAGIALALESTRHVGPPRTGWDTCLLIA"
FT   gene            complement(69424..72531)
FT                   /locus_tag="Franean1_0056"
FT   CDS_pept        complement(69424..72531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0056"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   fal:FRAAL6344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09524"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB63"
FT                   /protein_id="ABW09524.1"
FT                   /translation="MPMPPRYQHTGFIQVRASTDPGGLDLPTDLDLSDSAAVEQEGRAW
FT                   LAKTWARPEVREALRLASADLCARIEQILDDGAGRRSGAEIQRALTAVASYLLRWQRRA
FT                   TPFGMFAGISTATAGPATAEVGRAHQAVARADAEWVTALADQLERHPELRGRLTVVTDS
FT                   ARIVRDGRVIVHRRAEVGAPSPGPLRESSVRLTRPVFFALAEAGNPIRLDALVARTATR
FT                   FPTASPDKIRALVHGLVDGGLLITSLRPPTTGVDALTHLADALRAAGLEGLADVSDLLR
FT                   EIDCLRAMLAAHNRITDPQPAAQTRRTVAARMASLAPGAGQMLAVDTRLDANIAVPGRV
FT                   LTEAALAASVLLRLSRQPFGSTAWLDYHARFRARYGPGALVPVRELVAESGLGYPGGYL
FT                   GAPRARPAWRMLTDRDTALLALIQRAAVDGAEEIALTDADVEELAVGERGDVVPPQRVE
FT                   LGVEVWAVSTRAIDRGDFRLRVTAAPRTGTSMAGRFAYLLGPADRDRLAATYAASAEAG
FT                   ERDQPLAAQLSFPPRRPHNENVVRVEPLLPAVISLSEHPDPAHAKVRLIDLDDLVVTAD
FT                   AAQMYLVQRSTGRRVIPRIPHALDTSVQSPPLARFLAEVADARTAVFGGLDLGAARVLS
FT                   YIPRIRYGRTVLAVARWTLTSTDLPRGQSGDGRQEALCAWRQRWRVPARVVLCHSELRL
FT                   PLDLDRHLDRVLFLTRLERAGRIEVQEDGPPDAQGWIGRPAELLIPLTAISPPARPLPV
FT                   TAAPGAVLRPGDAAVLHAQLVGNPARFDDILTGHLPRLADSLEGLVCLWWVRRHRDMIL
FT                   PESDQHLAVFLRLRSTDHYGPVAAAVASFAADLETRGLPGQLTLASSPQHPARYGDGDA
FT                   LAAAESVFAADTLCATAQITAAQTSGISAQALAAASMVDLAAAFAPDPLAGYQALVGCL
FT                   RQEHGALDRTLRDQALDLADPGGNHQAVRALTGGEAVVSVWNARAIVLASYYQALARQR
FT                   DPRTVLRTLLHEHHVRAVGVDPTLEKETGRLARASALRHLALAGAR"
FT   gene            complement(72610..72801)
FT                   /locus_tag="Franean1_0057"
FT   CDS_pept        complement(72610..72801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09525"
FT                   /db_xref="InterPro:IPR027575"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB64"
FT                   /protein_id="ABW09525.1"
FT                   /translation="MSPVLMADQTESVDFALDDAELELDMRVVESTTRIAIMMCDTSDG
FT                   CGNSCSTSACNTSSNDPS"
FT   gene            complement(72866..74167)
FT                   /locus_tag="Franean1_0058"
FT   CDS_pept        complement(72866..74167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0058"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; KEGG: fal:FRAAL6346 putative protein;
FT                   putative O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09526"
FT                   /db_xref="GOA:A8LB65"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR027573"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB65"
FT                   /protein_id="ABW09526.1"
FT                   /translation="MFRLWRRETGARPPEGSSLIQMIGTSSAPDRATEVRNALVDKLCV
FT                   TGMITSLEVERAFRAVPRHLFVPEGTSLEVAYNADDSVAVKRAADGVIISSISAPFIQA
FT                   RMIEQAGLGPGMSVVEIGSSGYNAALLAEIVGPSGRVVSVDIDPEVTDRARALLEATGY
FT                   ADRVTVVRADAQDGVADHGDRVDAILVTAGAWDLSPAWLAQLAEDGRIVVPLRMNGITR
FT                   SIGFRRDGDHLVSTSAEVCGFVPMQGAGAHDERVFLLPDGHGRHVRLRFDANPPQDLDL
FT                   LDGVLATPRSEVWSGVTIRNGVSFADLHLWFACFLSGFCRLAADEGTDLAAERKSWFPF
FT                   GAVQGDSFAYLAVRPALDGAGVEFGGRAYGPHGEAAATALVEQIQAWDRQARGGPAPTF
FT                   AYWPTGADRPPAGEGTAVLAKTHGLVSISWPVAG"
FT   gene            74912..76456
FT                   /locus_tag="Franean1_0059"
FT   CDS_pept        74912..76456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0059"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mxa:MXAN_3955 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09527"
FT                   /db_xref="GOA:A8LB66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB66"
FT                   /protein_id="ABW09527.1"
FT                   /translation="MGGVTEVAEILGVSRQRVAKLRDRADFPDPIAEIAQGPIWDLDKI
FT                   EEWGGSDLRLSPGRPRADTVARTLGGRFVLEEPRIGHGGFGDVYRAMDRKQPGRNAAPV
FT                   AVKLMRDASMVDPEAVRRFERELRLLEPIRHPNIVPILGHGKTPAGAIWYAMPLAQGSL
FT                   VDFAEELHGRNALILDLMRQVGAGLTHIHDRKIYHRDLKPGNILRLADGVWAIADFGLA
FT                   VDAERATTALTSTLRGIGTAWYTAPEQWRDARNVNHLADVFGLGKVLQELVIGDAPVTN
FT                   EVPPGPLRPIVQRAIAERPEHRYASVRDFLAALATAIETPRDGWESAEGTAERLLERVR
FT                   LPKAAEVDLDELATWALALDESDTDDMTALARVLPWISTRSIHYLWAADPAGFQRIFRH
FT                   YSKHVETTGFGFEYCDVLADFSRRAVKETDDSDVLREAIRSLVELGHRHSRWRVRGVVT
FT                   TILQGIRKPEPALAAVEALRAADVEAVEWTLSEFSIRSLPPILRNEINMLLSAASR"
FT   gene            complement(76584..76895)
FT                   /locus_tag="Franean1_0060"
FT   CDS_pept        complement(76584..76895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09528"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB67"
FT                   /protein_id="ABW09528.1"
FT                   /translation="MPPWPGAVACPREQAARRSGRSPVLVLGAIRRGGRLGDVHGATLR
FT                   APRSQGQAEYCRGGGECRSDEKRELVAAVDGRERGVCGSVGRGERGQDGEPDGAAELL"
FT   gene            76974..77804
FT                   /locus_tag="Franean1_0061"
FT   CDS_pept        76974..77804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09529"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB68"
FT                   /protein_id="ABW09529.1"
FT                   /translation="MGDAQPSAWARERFGAAAVDFSRAVPEAIHRAHELALDGHVGSRL
FT                   KSNDAYGAALHVQQYEQLAAFTREIESVALRKPVGFRGRFELVVLDSTAVVLYPWRYAT
FT                   DRKTPRGEAKMRRVSDLRKNLLTLTARTADMQLTFDHAELDPAALEAQFTEEQAVLDQL
FT                   SRLGRVVTIGYASSPALGVFDLGWGDAELVDESSGAVVWHTWELLRRGGSGGAGVSTPK
FT                   LPAGPRDPSGRRSRFDDAPLDDTFPSLAPRAPLAEPPTSEPGQPERYTGSDDTE"
FT   gene            77817..79001
FT                   /locus_tag="Franean1_0062"
FT   CDS_pept        77817..79001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0062"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; KEGG: sco:SCO3537 DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09530"
FT                   /db_xref="GOA:A8LB69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB69"
FT                   /protein_id="ABW09530.1"
FT                   /translation="MDDPRQLRLLSLPAPASGSVASLAVIAAEFDPARLAQARRLAGLT
FT                   KRAVAGQLGVSPVAVGQWEAGTHAPRPDHVGRLAEVLDVPPAFLAAGRPYARLESSAAH
FT                   FRSLRRTPVSQRNKAIAFTEQVWELTYALEKRVQLPPVDLPGFSAGEVVTDVAGTDPAG
FT                   AARALRQAWNLGTGPIPHLVRTMENHGLIVTLVPFAGTATATVDAFSTSHLPRPVVVLT
FT                   PDRANDVYRHRFTAAHELGHLLLHPDTAPGDAIQEKEADAFAAELLTPSAEITPQLPAR
FT                   VDLHALDQLSKQWGVSVDSLVYRCREVGAVSDAAYRRAYQRLNQLRQLGLFAREPVDGY
FT                   RGEVPILLNRAYALAEEHGLTLATLARELACTLPRLRLLLGHADTDTRPQLRLV"
FT   sig_peptide     77817..77900
FT                   /locus_tag="Franean1_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.931 at
FT                   residue 28"
FT   gene            complement(79376..80018)
FT                   /pseudo
FT                   /locus_tag="Franean1_0063"
FT   gene            complement(80009..80491)
FT                   /locus_tag="Franean1_0064"
FT   CDS_pept        complement(80009..80491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_6589 ISMsm5, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09531"
FT                   /db_xref="GOA:A8LB70"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB70"
FT                   /protein_id="ABW09531.1"
FT                   /translation="MSRRATAITLTREVRAVLAGRVRSSTVPRRDWLRAAIVLAAADGV
FT                   PNTTIATDLGVCEDTVGKWRGRFAREGLAGLADRPRSGRPARCRSPRSRRRRVPGPRTS
FT                   VRRWNAGRTVNSPATRPDRASWRACRRRRSGAGWPVTRSAPGSTDRGSSPEIRRSS"
FT   gene            80561..80929
FT                   /locus_tag="Franean1_0065"
FT   CDS_pept        80561..80929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09532"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB71"
FT                   /protein_id="ABW09532.1"
FT                   /translation="MAGIPESTKISLRQRLVAHATTNWHGIMVSIRYRGPFAYITATHP
FT                   DGDDQPLCRLRYVGYASQWGFAIWHARHDDYADSVLADGSPTGTAEAALDLAAGLYLPA
FT                   TTVHAATIETGGGMGDAA"
FT   gene            complement(81495..82970)
FT                   /locus_tag="Franean1_0066"
FT   CDS_pept        complement(81495..82970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0066"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: sru:SRU_1401 subtilisin-like serine
FT                   proteases"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09533"
FT                   /db_xref="GOA:A8LB72"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB72"
FT                   /protein_id="ABW09533.1"
FT                   /translation="MPLGGSMGGLGVVDVMVKMQPSDGGSVADSLDQADEVMRSADITL
FT                   DSHFEPIRMQGKSRVGRDEILPYGGDRFRPSSSAGEDAELRTEKGGPACVIVRASVDTC
FT                   DPREIEGSLIELNRRSEVISIYSDPEIAPYWKCWRENQPENLSDMLSVLNLQELSAVGM
FT                   DGDGVDVAVVDGGIDADYLVQRSRDLKPLEGWHPDNLQNTPGQYAVNNDRDAAHGTMCA
FT                   HEVLLASPRARILDYALLRRAATVNNKATMSGLDIRFSHAIAAYHALASRLRKDRRSNG
FT                   GSLSRPLVVTNSWGLGSVASDEVTNRLGRYRDQFEHPFNLAVEELSLAGADIVFAAGNN
FT                   GQPHPDDSTWPQDELPITGANSHPLALCVGAVTVGGERICYSSQGPGRLFWGKPDVMGY
FT                   SEYVGSEVLGSDTPDVGTSAACPLVAGVIAAVRSKIGTDVLSPVKLREAVRCSAWMPSV
FT                   AGHCKPNSEYGWGIIDPSALLAGVREHLTQSRE"
FT   gene            complement(82991..83287)
FT                   /locus_tag="Franean1_0067"
FT   CDS_pept        complement(82991..83287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09534"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB73"
FT                   /protein_id="ABW09534.1"
FT                   /translation="MGRYGIVDLAGIQKEDVDALLAPYWTRDNVVDVSDISSQLRDIRD
FT                   SLAPLIDEDGTPASTSFGLRSVEISLALSLEGKVMFVAKGSVDASIKLSFGRR"
FT   gene            complement(83438..83728)
FT                   /locus_tag="Franean1_0068"
FT   CDS_pept        complement(83438..83728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4325 putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09535"
FT                   /db_xref="GOA:A8LB74"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB74"
FT                   /protein_id="ABW09535.1"
FT                   /translation="MIVRRERVARALPAYLVGRQLGAGAYGLVLAGRHRRLRRPVAIKV
FT                   LEAGNCGHLPDPGRHSHGAAPPSTSGAGMGERVAHGVAGAPGPARGSVCLE"
FT   gene            83908..84387
FT                   /locus_tag="Franean1_0069"
FT   CDS_pept        83908..84387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09536"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB75"
FT                   /protein_id="ABW09536.1"
FT                   /translation="MSRRSTARCLTHSATVSFSAPAVSPDPRLTGGVQREIAGRIATLV
FT                   ADDAAPQLGIGYVNGHAASWSVRQQARDLVEKVAHPRSPRAHRSGWFSAAPAPDIRHAG
FT                   DRGRLAGEVADVGCSAKMRGRGRSAGVAVALTWIRARMEAVGGRTGRGRKPSSVR"
FT   gene            complement(84437..85057)
FT                   /locus_tag="Franean1_0070"
FT   CDS_pept        complement(84437..85057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0070"
FT                   /product="IS630 family transposase"
FT                   /note="KEGG: sma:SAV479 IS630 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09537"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A8L684"
FT                   /protein_id="ABW09537.1"
FT                   /translation="MAGGKTTAAARGAWVCFLDETGQGLRPPRGRTWARRGVTPVVRVP
FT                   GRGGAGRVSVVGMVCYKPGQRARLVYRVRVSHGRSGERKGLCWADCRDLLLAAHVQLPG
FT                   GRLVVVWDRLNIHLQAQMAAFLAAHTGWISVVWLPAYAPDLNPTEGAWSYLKRTTLVHL
FT                   AARGIDEVFQAFKHGLKRMQYRPELLVGFLAETGLAWENLRSK"
FT   gene            complement(84982..85521)
FT                   /locus_tag="Franean1_0071"
FT   CDS_pept        complement(84982..85521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0071"
FT                   /product="putative IS630 family transposase"
FT                   /note="KEGG: sma:SAV7570 putative IS630 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09538"
FT                   /db_xref="GOA:A8L685"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:A8L685"
FT                   /protein_id="ABW09538.1"
FT                   /translation="MRYATGGGLTPAGQVERERVRLAAADRFAAGATRTEVAREFKVTP
FT                   KTAGCWYRAWESGGAAALRSTGPVSSCRLDDRDLARLEAILRRGPGVYGWTDQRWTLAR
FT                   VAQVIRREFGITYTVPGVWMLLDRNGWSCQLPVRRAVERDDTVVEEWKDRGWPAVKPPR
FT                   RPGVPGSVSSTRQGRA"
FT   gene            86789..89791
FT                   /locus_tag="Franean1_0072"
FT   CDS_pept        86789..89791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0072"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Tetratricopeptide
FT                   TPR_4; SMART: AAA ATPase; KEGG: rha:RHA1_ro02391 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09539"
FT                   /db_xref="GOA:A8LB78"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB78"
FT                   /protein_id="ABW09539.1"
FT                   /translation="MAGLRSVNRSATEAARRLRRIEAQDADPGPAPVSGLRPGPRSGPA
FT                   AGALRDALLVDGGRASFVGRPEALLQLRRAVADVLGGRPRVALLEGPAGIGKTALARHL
FT                   LGEADAGCVLWASGEEDETGLSFGVLDQLTAEAARVLGADQPSPSGPGELTGTAGSVRG
FT                   PSPDPLVAGAALVELLGELQRSGPVVLVVDDAHWADRPSLQALTFALRRLRADRVLALV
FT                   MVRDLVDAQLPDGLRRLLMDERTVRLLLEGLDDTELRALSSAHATGPLSWRACARLRAH
FT                   TGGNPLHARALLEEVPTEAFDNLDVPLPVPRSFAMLVVARLAAAPVQGRELATAASVLG
FT                   AHPTLVQAAAVGGVDEPLSALEQAIAAGLLVEQPVAWGLRFPHPLVHAAIYEQAGPARR
FT                   AELHTRAAALAEEEALRLHHLARAATGPDGGLAMELARQGREQATAGAWAAAANHLSTA
FT                   ARLAPSRTDYEQLTLEAADCQLLAGDVPDPLGKVGEVRGFRPTAWRDYLLGRFAFQRGD
FT                   ADEAETRLRSAWKRCDPDGGADADPLLGARVAGWLAALYQTKLLGAESAEWAGRALALS
FT                   PGHAAFDLIGQIRMGGLAMSGHLDAVLDSVADLPDPAVASMTDLDMLAGRGSLHALVDD
FT                   FAGARRDLGGVLAAGRDRSLLFRVSVTTALAQAEYRAGLWDDAAIHCDHALSLMADSDD
FT                   GALVPYCHQVGVLVPAARGHWVEAEEHVRTTQAFAESGFPYLVASAAIATAHLARARGL
FT                   PAEIVAALEPPVRSGLLDLDAEPGVSGWQDTLVDALVEVGDLGRAEEVLIRFEAAARLR
FT                   GRRAAMAAAARSRGNLEARRDNVSAADRAFRAGLAEWEHVDLPFERALLHHLYGAFLRR
FT                   AGRPADAIRQLRAAHDTLSLLDARPYLDRCESELVAGGWAPRDGCRREPDASRLTTPEL
FT                   AVAKLVAAGLTNRQVARELVLSEKTVEHHLRAVFGKLDVTARTQLSGRIFAAAGGLAQW
FT                   NGADRVLLRSE"
FT   gene            90092..91351
FT                   /locus_tag="Franean1_0073"
FT   CDS_pept        90092..91351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0073"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   fal:FRAAL5400 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09540"
FT                   /db_xref="GOA:A8LB79"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB79"
FT                   /protein_id="ABW09540.1"
FT                   /translation="MRVAIFAMGTRGDAQPAAIIGAELVRRGHEVVLGVPGDLAGFGIR
FT                   MGLDTASIGVDAHEFMGSEEVRAWLASGDLRKIMNGFGRYKRQRAERIADAMADISTDA
FT                   DLIVSGVTIEDEAACIAEWRGVPMACLHHAPMRANGEFPFFIASTRRLPRVVNRLMYPA
FT                   VEFAGWRALAADVNRLRARLGLRPAREPTPRRLARAGSTEIQAYSRFLVPELADWGQRR
FT                   PLVGFLTLSPEQRRLLGEHQLDPAVDQWLDEGEPPAYFGFGSMPVLDPPRILELLSTVA
FT                   DRLGLRALVSGAWATTGVSADRRVCVVGDLDHDTVLPRCRIAVHHGGAGTTAASVAAGL
FT                   PTVVCSVIGDQPFWGARLERLGIGASLRFSEMSERALVAAAVPLLAHEPRERAARLASR
FT                   LKTENAACRTADVLEEIHKS"
FT   gene            91442..92632
FT                   /locus_tag="Franean1_0074"
FT   CDS_pept        91442..92632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0074"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   fal:FRAAL5337 putative ring hydroxylating dioxygenase
FT                   alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09541"
FT                   /db_xref="GOA:A8LB80"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB80"
FT                   /protein_id="ABW09541.1"
FT                   /translation="MDRSELMDLTRRALKVATDRTTDMEPAERRQPADAYTSQESFERE
FT                   RELVLRSPQLVGYRSELPTAGSFCTKTVMDVPVLLTRSQDGTVRAFHNICAHRQAPVAV
FT                   RCGTAERFVCPYHAWTYDTQGRFVGGPGREGFPSLTAGGSGLTELPAAEHAGFLWVGLQ
FT                   PENGPLDIEAHLGPLGPELASWGIGDWSLVGERVLDSPINWKLALDTFAESYHFSTLHR
FT                   GTFAQLALGNCALFDSFGPHHRLVVPLRHITRLTDLPAEEWKPLDNLSIAYALFPNIVV
FT                   SVSAANSEVFRIYPGSGPGHSVTCHQNASGLDLEDETTRAGAERLFDFAHSTVRDEDYQ
FT                   LAVEIQKNLSSGARSELVFGRNEPGLQHRHFVLDARMGRQPRPAGQPGRVDIVHRS"
FT   gene            92648..93160
FT                   /locus_tag="Franean1_0075"
FT   CDS_pept        92648..93160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: zmo:ZMO0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09542"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB81"
FT                   /protein_id="ABW09542.1"
FT                   /translation="MREDIRQASQKMRRGIGGGRQIRCLAEYLWAGELVTDMARGSRGR
FT                   GGGILVLTDRRLLFVLAGHRCRSSEDLLLRNVSSVEWAGGMVLGRIIVHAAGDRMEIAK
FT                   VNKRDGRRVVDLIQGRLGPAPPAPPPELPADPVRDDRLRRIAALREAGVLSREEFEVKI
FT                   ARLLRPE"
FT   gene            93263..93886
FT                   /locus_tag="Franean1_0076"
FT   CDS_pept        93263..93886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dre:797993 hypothetical protein LOC797993"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09543"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB82"
FT                   /protein_id="ABW09543.1"
FT                   /translation="MEPPVMNHNRAAVRAAFPVLAALVIMGLAGCTPSTGAAAPSSAPG
FT                   QTSAVATSGNKRVKPVAPSSDTAAPQADTAAPAGTVASSAGTAGRPCGLVSRPEAEKLA
FT                   GTSLSSPVALAGTCTYTAPPDGPTAQVEIFVGETAENYLAAERGIGHDLQPLSGIGDEA
FT                   YFEDAAVFVRRAAFWVSINLVRGNDPAENSGPLKDLARTVADRI"
FT   sig_peptide     93263..93373
FT                   /locus_tag="Franean1_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.490 at
FT                   residue 37"
FT   gene            complement(94301..95116)
FT                   /locus_tag="Franean1_0077"
FT   CDS_pept        complement(94301..95116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0077"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sru:SRU_0006 retinol dehydrogenase 11"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09544"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB83"
FT                   /protein_id="ABW09544.1"
FT                   /translation="MRTIVLVGATSGLGRHAAHILKEAGHRLVLVGRDPKRAAQLAHDL
FT                   PTATVIAADISTAAGIDLVAEKVHAVVDRVDTLVNNAGVMLPTRRTTSEGIELNLAVHH
FT                   LAPYSTTARLLPLLRHGDGRIINVNSEGHRAPMRGAGPVHLDLTDLNSERRYDPFLTYS
FT                   RTKLANLLFTYELQRRHPELTVAAVHPGMVRTNLGRHFPRLRVALLLPFMMSPRQGARP
FT                   VIHLASAPTISAGRYYDRLRPVSSSPASYDTNTARRLWEITSDIRGPFG"
FT   gene            complement(95113..95979)
FT                   /locus_tag="Franean1_0078"
FT   CDS_pept        complement(95113..95979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0078"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: tth:TTC1745 corticosteroid 11-beta-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09545"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB84"
FT                   /protein_id="ABW09545.1"
FT                   /translation="MTETERRGGVLVSGAAGGIGAATVRLLADRGYLVFAAVRAENHTS
FT                   RVLADLSGVQVVTMDVADPESVATAAEEVNGAVPNGGLRAVVNNAGVIVQGPLELVPPD
FT                   ELRRQFEVNTFGPAYVTQAFLPMLRAGHGRIINVTAPTARVPMPFMAPISASKAALDAL
FT                   STALRLELAAWKVPVVLVEPGATETQIFDKADTAAREALGAATPAQVALYRDHLTAMEQ
FT                   ARKRLRTRPVEPVARAIATAVTARRPRRRYSIADARAIGVLAHLPARLRERLVMSTLGL
FT                   RGVGTER"
FT   gene            96103..96657
FT                   /locus_tag="Franean1_0079"
FT   CDS_pept        96103..96657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0079"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mjl:Mjls_5238 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09546"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB85"
FT                   /protein_id="ABW09546.1"
FT                   /translation="MSLRHGLLGLLAEGPASGYDLARRFQEVLGQIWPAQHPKIYAELR
FT                   RLTDDGLIEVDTEGPRRRKAYRITDAGLDEIRDWLTTGEIDHTMRVQSLLRSLFFWLMD
FT                   PDDLRRRLDEEARFFAESAARYRAYADAKDRGEFGDNPQVRSMRVTIEAGVRLYQALAD
FT                   WAEWAKTVSPPSTPRDISTNH"
FT   gene            complement(97102..97470)
FT                   /locus_tag="Franean1_0080"
FT   CDS_pept        complement(97102..97470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1739 putative integrase (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09547"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB86"
FT                   /protein_id="ABW09547.1"
FT                   /translation="MRGATGPASTAVHGRAQTVARRGPHRDLMQARCMSSDLCNGRTAR
FT                   FESSSRRPGDHAGRCRFPSLALGALHRQRSRQAKERIDAGEHWWENGLVFASTVGTLME
FT                   PRNVTRRVEQLRDRAGLP"
FT   gene            complement(97795..99000)
FT                   /locus_tag="Franean1_0081"
FT   CDS_pept        complement(97795..99000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0081"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: tfu:Tfu_1940 ATP-binding
FT                   region, ATPase-like:histidine kinase, HAMP region:histidine
FT                   kinase A, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09548"
FT                   /db_xref="GOA:A8LB87"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB87"
FT                   /protein_id="ABW09548.1"
FT                   /translation="MTRLSLRARLTVLYGALSILAGAVILTLLYLVVQARLDAELTGDS
FT                   DSRIAALRQRAGQANEATITTPNGSRISLDDLTEQIRGNEEKIRNAALDTLLVRGSGIV
FT                   LAIGLATAGTGWIIAGRGLRPLHAITVTAEQIARSTGPHRDLSRRIALTGHSDDIRRLA
FT                   DAFDAMLETLDHAFDGQRRFVASASHELRTPLALERAVIELEATKPAAHPDTVHFADRL
FT                   LAINTRNTDLVDRLLTLADGGNELTESVTVDLADVTADVLAQTSTDTPTSARITAGLVT
FT                   APVLGDPILLHQLVRNLVENAANHNVPGGWIKIATGTGPTYLAIANSGPLLLPQDVNGL
FT                   FEPFRRGRPDRTRGTGRRGFGLGLTIVKAIADSHHAQITALPRQDGGLDLRITFPAAPS
FT                   PR"
FT   sig_peptide     complement(98893..99000)
FT                   /locus_tag="Franean1_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.691 at
FT                   residue 36"
FT   gene            complement(98997..99656)
FT                   /locus_tag="Franean1_0082"
FT   CDS_pept        complement(98997..99656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0082"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sma:SAV2405 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09549"
FT                   /db_xref="GOA:A8LB88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB88"
FT                   /protein_id="ABW09549.1"
FT                   /translation="MVRVMVVEDEPELAGALCEALTRESFAVDVAYDGDEALEKCAAHD
FT                   YDVVVLDRDLPVVHGDDVCRAIVATQRSTRVLMLTAASAIRARVEGLAIGADDYLVKPF
FT                   ALAELSARVHALARRTAPAAAPILERAGLRVDQASRTVTRDGRSVILTNKEYAVLVELL
FT                   RAAGGVLSAEQLLEKVWDENIAPFTNTVRMTVMKLRRKLGTPQLIETLPAAGYRIP"
FT   gene            99828..100331
FT                   /locus_tag="Franean1_0083"
FT   CDS_pept        99828..100331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09550"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB89"
FT                   /protein_id="ABW09550.1"
FT                   /translation="MIRTTRPLTAVAAGLSLVVMAMAGCGSGGGTAPGGTASGGGTTGT
FT                   PTVQTYAQCMRDHDIDMADPDPSTGVPQFGEGVDPDDPAVKQALAACQDLLPAGSRGEP
FT                   SDADLAVYVAFAQCMRDNGLPGFPDPQPGSAGGLFAGADVDRGDPAFQQAARQCQGILD
FT                   EAGA"
FT   sig_peptide     99828..99893
FT                   /locus_tag="Franean1_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.266 at
FT                   residue 22"
FT   gene            100328..101554
FT                   /locus_tag="Franean1_0084"
FT   CDS_pept        100328..101554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0084"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   bad:BAD_0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09551"
FT                   /db_xref="GOA:A8LB90"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB90"
FT                   /protein_id="ABW09551.1"
FT                   /translation="MTGAGAGTDETRTGETRTGETSVTAPPTAAEYKAGGRCVPSRAWA
FT                   RAMTASWASPLRRRPRRHLLVLAGAGAAALIVAAALGFGGSPPPSPTGPVPAATATVQR
FT                   GTLTQTQQVGGLISYGEPVGLVAQQQSGVLTWVAAPGTTVKIGQPVYAVDGRPVVLLHG
FT                   TATPYRTLATGTVGSDVKELEASLQELGYTGFAVDDTFDAATASAVQAWQAKSGLPAQG
FT                   TVSPDQIFVHDGDIRVALQAIPVGSHLGLQPNQQVLTYSGTTQVASIPLDVSLQHLVHT
FT                   DDPATIALPTGQRLDGTVSSVGTVAQTIEEQNKTFVTVIVSFGDPSALAGGFDSSPVTL
FT                   TIVTGQRANVLTVPVTALVANPDGGYAVQTVQNGQSTFAPVTTGMFANGTVEISGAGIT
FT                   EGVTVRVAQ"
FT   gene            101551..102258
FT                   /locus_tag="Franean1_0085"
FT   CDS_pept        101551..102258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0085"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: lxx:Lxx22050 ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09552"
FT                   /db_xref="GOA:A8LB91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB91"
FT                   /protein_id="ABW09552.1"
FT                   /translation="MSATVPIAVLDQVSRHFGPVSALADVSLRINYGELVGIVGPSGSG
FT                   KSTMLHLLGTLDGPTTGIVTVDGHPVHALGDDQRSALRAQRIGFIFQQFHLAPGVPALD
FT                   NVADGLLYGGTRRSERLERARAALDRVGLGHRVHHRPHELSGGERQRVAIARAVVGEPT
FT                   LLLADEPTGNLDSSSGAEVMVLLRQLHSAGTTIVIITHDRDIAAALPRRIEMRDGHKVG
FT                   DSGDVRTPQGARG"
FT   gene            102255..103571
FT                   /locus_tag="Franean1_0086"
FT   CDS_pept        102255..103571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0086"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lxx:Lxx22040 putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09553"
FT                   /db_xref="GOA:A8LB92"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB92"
FT                   /protein_id="ABW09553.1"
FT                   /translation="MTTARSTTGASPTDAPTQDGTSPTSKSGPATHLGPVPDANLVLRP
FT                   ARLAARELVRVGAAGLRSRPTRVALSALGIAIGIAAMISVIGISSSSREDFHRQIAALG
FT                   TNLLTVSPGQNLFGDQAHLPTEAVTMIGAVGDVESVSATGLVPDARVYRNDHIPAAESG
FT                   SIAVLATRLDLPDTVGADIVAGTYLNEATQRYAAVVLGSTAAAHLGVDSTGPDQQIHLG
FT                   GQWFTVVGILAPVGLAPELDRAALVGWPSAADLLGFDTYPTTLYTRTDPNHVEAVQTLL
FT                   ARTANPAAPNEVDVSRPSDALAAQHAADSTLGGLLLGLGSVALLVGGIGVANTMVISVL
FT                   ERRGEVGLRRALGATRGDIRNQFLAEALLLSTLGGIAGLILGTGVTTCYATTQAWPTVV
FT                   PSWAMLLAFGATLVIGAVAGLYPATRASRLQPTAALAAP"
FT   gene            103928..104269
FT                   /locus_tag="Franean1_0087"
FT   CDS_pept        103928..104269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:pnf1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09554"
FT                   /db_xref="GOA:A8LB93"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB93"
FT                   /protein_id="ABW09554.1"
FT                   /translation="MAVTCRFGGNCVMMYWSDRDISGWGWFAMSMGMLLFWAVLITVAV
FT                   LLVRALIRSDERRRPATRSPSEPGAAHGPAVPSPEEVLADRFARGEIDEQEYRVRLATL
FT                   RDTARFVKH"
FT   gene            complement(104451..105926)
FT                   /locus_tag="Franean1_0088"
FT   CDS_pept        complement(104451..105926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0088"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: regulatory protein MerR; aldo/keto reductase;
FT                   KEGG: fal:FRAAL2328 putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09555"
FT                   /db_xref="GOA:A8LB94"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB94"
FT                   /protein_id="ABW09555.1"
FT                   /translation="MTAVDELSEDGSRAPDGPTSGRRKSGARRPSTGVARSADSGLTIA
FT                   EAATASGVSAHTLRYYERVGLMLERVARAPSSHRRYDDEDLRWIATLTALRHTGMPIRQ
FT                   IARYAALVRAGHGNETERLELLTAHKERVTERLDEVRRHLTAIDTKIDIYRERTRRPMP
FT                   HDTLRQVPLGSQGLRVSVQGLGCMGMSDFYGATDDNESIATIQRALGLGVTFLDTADMY
FT                   GPFTNERLVGRAISGRRGEVTLATKFGIVRDPDNPQARNINGRPEYVRSACDASLSRLG
FT                   VDHIDLYYQHRVDPTVPIEDTVGAMAELVTAGKVRYLGLSEASPATIRRAHAVHPISAL
FT                   QTEYSIWSRHPEEEILPTLRELGIGFVAYSPLGRGFLTGTFRTPNDFEAGDFRASMPRM
FT                   NSENLDANLSVVAQIEEIAAARNATPAQVALAWVHHQGDDIVPIPGTKRRHYLEQNVAA
FT                   VGLALTPDEVEILTKAGETVRGARYPDMSNVNL"
FT   gene            106070..106681
FT                   /locus_tag="Franean1_0089"
FT   CDS_pept        106070..106681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0089"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-E type; PFAM: sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: fal:FRAAL1328 putative RNA polymerase ECF-subfamily
FT                   sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09556"
FT                   /db_xref="GOA:A8LB95"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB95"
FT                   /protein_id="ABW09556.1"
FT                   /translation="MDDDGHDEFRAYFTARLPALLRLAYLLTGDAAEAEDLAQTALART
FT                   FVAWRKVRVCDSPDAYVRRILVNAHRRRFRGRRVVETLMPTVPDRLVGGSAGELAAVED
FT                   RAGLAAALAALPTRQRAVVVLRYCEDLSEARVAEILGCSVGTVKTHASRGLARLRADPS
FT                   LGTAMGPRSDGVRQPSRSGDGAVPPQLGASELDGTRGGAA"
FT   gene            106678..107595
FT                   /locus_tag="Franean1_0090"
FT   CDS_pept        106678..107595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09557"
FT                   /db_xref="GOA:A8LB96"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB96"
FT                   /protein_id="ABW09557.1"
FT                   /translation="MTSDEEMIERLRGAERTVDVRPSGDLWAGVRARVPGERRRRVARR
FT                   AAPAVACAVAAAGIAAGLTLAGGTGKASLAPADLPPAPRITQLQPVTFTPDEAAHLVIE
FT                   CLQSGPGPADPARFQPGGLTVWAAARDVTGATVILSNPSTFVDCDVPADAAGRLDIDGA
FT                   YVYSWGTGHDAMPRTDLELEHASGSHGIGGGFGGRLGAGFGSGPGDSRTVHDCGGRVSA
FT                   RVARVTATTPSGEIVEVPIQDGKVVVRTLQIDPPEPGPRPGEPGFEDFRRNNPTLFDDW
FT                   YQANRPVVRAYDRDGRLLAATEAG"
FT   gene            complement(107696..108688)
FT                   /locus_tag="Franean1_0091"
FT   CDS_pept        complement(107696..108688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0091"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sco:SCO5075 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09558"
FT                   /db_xref="GOA:A8LB97"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB97"
FT                   /protein_id="ABW09558.1"
FT                   /translation="MKAAAFARHGGPEVLELMDLATPVAGPGQVRVRLRFAGVQPIDCA
FT                   VRAGWAPPGVAPRLPTIPGNEFAGVVDQVGDRVDGVGGADGADGVGGIDSVGGVDGGDH
FT                   GVVVGAEVLGFGQLGAYAEYLVVPADQVTAKPAGMPWEVAGGFSGGAQTAHIALRELGV
FT                   GKGDTVLIHAAAGGVGTVAVQLAVRAGSTVIGTAGAANHDYLRSLGAIPVAYGDGLVER
FT                   VQAIAPGGVDAALDGAGGDALTASLALVADRSRILTLVEHGRAGELGIRVTPNLRSAAR
FT                   LAELADLQAHGALHINVRRVVPLADAAEAHRELETRHGRGKIVLAVSSG"
FT   gene            complement(108808..109800)
FT                   /locus_tag="Franean1_0092"
FT   CDS_pept        complement(108808..109800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0092"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; regulatory
FT                   protein TetR; Tetracyclin repressor domain protein; KEGG:
FT                   sen:SACE_3407 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09559"
FT                   /db_xref="GOA:A8LB98"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB98"
FT                   /protein_id="ABW09559.1"
FT                   /translation="MVISDSEDVPPYLRITAELRRRITSGELRPGERLPSTRQIVREFG
FT                   IAMATATKVLATLHQEGLARPLPGVGTIVDFSGPHPRSPGAARPRAGGHPTSGLTRPRI
FT                   VRVAVDIADLEGLAALSMRRVAVELGVTTVALHRQVGGRGQLVLSMADVVFAEAPPPDP
FT                   PPAGWRRCLEAAARSQWAMYCRHPWLAQAMSFTRPLMSPRIKAHAEWVMRALHGLGLDP
FT                   VAMIHVHATLAAHIRGLALNLEAEAEAVQDSGLTDEQWMDAHGTPAITPPAATSAHPLL
FT                   ASVPPRSLDLDSLFEFGLQRLLDGIAILIETSRCHVQPPPAGRVQADER"
FT   gene            110033..110944
FT                   /locus_tag="Franean1_0093"
FT   CDS_pept        110033..110944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0093"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_A1733
FT                   putative esterase/hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09560"
FT                   /db_xref="GOA:A8LB99"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LB99"
FT                   /protein_id="ABW09560.1"
FT                   /translation="MVATQVETGSVESTDGTVISYRTIGRGPGLLLVPGALAVAADLDG
FT                   FAAVLASGFTVHTIERRGRGASGPQGDAYTAAKELADLEAVRAATRARFVVGHSFGGFL
FT                   LLEALRNTGATAGSGAPVGVGAGAFDGAAAYEPGVLLDGVGPVTLEWARRCQDELDRGR
FT                   PRQAFITFVRGVNPETTGRVPRVLLGLILAFAIRPAERRRKHALLGGTIREHQEAARVA
FT                   NQPDRYRAITTPTLLMAGKGSDDTAAGRATRQLAGILPRASLVTFGDLDHFGPERAPGR
FT                   VAAAVADFFAAVGTSGSARAER"
FT   gene            111434..112696
FT                   /locus_tag="Franean1_0094"
FT   CDS_pept        111434..112696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0094"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mjl:Mjls_2729
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09561"
FT                   /db_xref="GOA:A8LBA0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA0"
FT                   /protein_id="ABW09561.1"
FT                   /translation="MNIDDMVLVSIDDHVVEPPDMFKNHVPANLVDQAPHVVRNDKGVD
FT                   QWIYQGRVTGVSGLNAVVSWPAEEWGKDPAGFAEMRPGVYDIHDRVRDMDRNGILASMC
FT                   FPTFAGFSAGHLNHYKTDTTVTMVQAYNNWHIDEWAGTYPGRFIPLALLPTWDPQLMVN
FT                   EIRRVAAKGCRAVTMPELPHLEGLPSYHNLDFWAPVFEALSDTGMVMCLHIGTGFGALK
FT                   LAPDAPIDNLIILACQISSLAVQDLLWGPAMRTYPDLKFAFSEGGIGWIPFYLDRCDRH
FT                   YTNQRWLRRDFGGKLPSEVFRDHSLACYVTDPTSLKLRREIGIDIIAWECDYPHSDSIW
FT                   PDAPEFVLNELNNAGATDEEIDKITWQNACRFFNWDPFSEIPKERATVGARRAIATDVD
FT                   TAIRSRKEWARLFAEKHPETI"
FT   gene            complement(112875..113852)
FT                   /locus_tag="Franean1_0095"
FT   CDS_pept        complement(112875..113852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0095"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mgi:Mflv_2449 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09562"
FT                   /db_xref="GOA:A8LBA1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA1"
FT                   /protein_id="ABW09562.1"
FT                   /translation="MRAAVCREYGQPEVVRVEEFPTPEPQPDQVGVRVRAAAVNYSDVL
FT                   LVAGEYQVKVPPPFVPGSEFAGVVETVGADVTGVAVGDRVFGTGMVGAFGEIAVGRAAS
FT                   LTRTPDGIADTVAAAFGVAHRTSYHMLRSVARLQPGEQLVVLGAGGGVGLAAVQLGAAL
FT                   GATVTAVASSARKLEVAATNGATHLIDHRANDLRKALKETLPDGADVVIDPVGGDLAEP
FT                   ALRSLRWRGRFVTVGYAAGSIPRIPLNLVLLKGIQIGGMQLRDLGTHAPDELQRNEREL
FT                   MELFAAGKAVPHIGASFTFDETAAALRYVADGHAIGKIVLEIAP"
FT   gene            complement(113892..114695)
FT                   /locus_tag="Franean1_0096"
FT   CDS_pept        complement(113892..114695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0096"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mjl:Mjls_4093 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09563"
FT                   /db_xref="GOA:A8LBA2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA2"
FT                   /protein_id="ABW09563.1"
FT                   /translation="MTDTDTSTADILLERVGAVLVIRLNRPEARNALTPALLSAIGSAI
FT                   LTAESDPDIRVAVLTAAGEKAFCVGMDLKAFTSGGGFSQIAPEDKEGRAAFDRLMGGDV
FT                   KVPLVGAANGTAVGGGFELLLSCDVVVASSAAKFGLPEVKRGLLAAGGGAVAIASRIPL
FT                   ALALELTLTGDTVDAARAQQLGLVNAVAEPEKVLETALALAERIAANGPLAVAATKEIV
FT                   RAAAADPARGQERMAQLSPAVFKSEDAKEGAMAFIQKRTPQWKGR"
FT   gene            complement(114692..115714)
FT                   /locus_tag="Franean1_0097"
FT   CDS_pept        complement(114692..115714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0097"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mva:Mvan_4201 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09564"
FT                   /db_xref="GOA:A8LBA3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA3"
FT                   /protein_id="ABW09564.1"
FT                   /translation="MIDIERLATWMDEAGLAGKGEPIEHRYVSGGTQNEIYEIRRGDLH
FT                   GALRIPPAGAPASRDAGILREWRIIEALDGTDVPHTAALGMCEDASVLGRSFYIMGFVD
FT                   GWSPMSQRGVWPEPFNSDLELRKGLSYQLAEGIALLSKVDWKARGLEGLGRPDDFHERQ
FT                   VDRWTAFLNRIKKRELPGYDVAAQWLRTHRPIDFIPGLMHGDYQFANVMFQNGAPAKLA
FT                   AIVDWEMGTVGDPKLDLAWMLQSWPEDTSSTDLIGKSYADLYAMPTKSQLLAHYAEVSG
FT                   RQVDDYDYYLILCKFKLAIVLEQGFQRAGDDEKLLSFGPIVLGAMQEAADLAESTDYKR
FT                   "
FT   gene            complement(115711..117012)
FT                   /locus_tag="Franean1_0098"
FT   CDS_pept        complement(115711..117012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0098"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: msm:MSMEG_4826
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09565"
FT                   /db_xref="GOA:A8LBA4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA4"
FT                   /protein_id="ABW09565.1"
FT                   /translation="MSWDFETEPEYQAQLDWADKFVREEVEPLDMAWPDLQFVPRGETL
FT                   QRVIDPLRQQVKDHGLWATHLGPELGGQGHGQLKLSLLNEILGRSSWAPIVFGCQAPDT
FT                   GNAEIIAHYGTEAQKKQYLQPLLDGECFSSYSMTEPQAGSDPTQFTCSAVKDGDGWVIN
FT                   GWKFFSSNASTARFVIVMVVTNPDVSRYRGMSMFLIPTDTPGINIVRNVGLPGEPLGEG
FT                   HHALIHYEDVRVSDDALLGGEGQAFAIAQTRLGGGRIHHAMRTIGLAKKALDMMCERAL
FT                   SRSTQGSLLADKQFVQGFIADSYAQLAQFRLFVLYTAWSIDKHKDYRKVRKDIAAVKVV
FT                   MPAVLHDIASRALQVHGALGASNEMPFHQMVMGSFVMGLADGPTEVHKVTVAKQVLRDY
FT                   KPTDDLWPTEHLPKRLAAAREKYAEYLELEVGNL"
FT   gene            complement(117226..118992)
FT                   /locus_tag="Franean1_0099"
FT   CDS_pept        complement(117226..118992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0099"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: fal:FRAAL5548 hypothetical
FT                   protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09566"
FT                   /db_xref="GOA:A8LBA5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA5"
FT                   /protein_id="ABW09566.1"
FT                   /translation="MGHSRRRDRLFRRAAVGAAVLTGACVVLAQVLPDSLALSAVRLTV
FT                   IGFLLLGGTTCVVAGLRRHGAERWWRLLMAVMVLAVAVASAAVFRDTAAGRSPVPQLTP
FT                   ASLVYLIPLAMGVAGVLLYPTDPVEHDDAEDGGPLHAYRWYAITVLDGMIVVGSVALLV
FT                   WATVLERTVGHGEPLGPGPLYSIILAAVSLVVFVVLILVAVFREPRDSRGHALLLAGMC
FT                   AASISAMWELAVLIHGLDDVPRLTDLPIGIGALLIGLAAISTDPDTGATTGADAAADVD
FT                   VDADADAVGVGLAAVPSLGRRAASARLRRWHAILPYLPLTAAGAATVLQIAGDGIGHWE
FT                   EIWALLALLLLALVRQMMTMSDNIRLLGQVEEKQRQLRHQAFHDPLTGLANRSLFIDRL
FT                   ERALHRQPGPAERFAVLFCDLDDFKRVNDVLGHAAGDDLLRITGARLAGCVRAADTVAR
FT                   LGGDEFAILLVSANIDDPEAVGCRLAAAVRAPVRLASHTFTVAASVGLVTVDPETGTGA
FT                   PHQGADPDPDPDTDTEPRADVPDTAEQLLHRADLAMYAAKARRNGEPAVYTPELVGPGR
FT                   ARARPARNVPLP"
FT   sig_peptide     complement(118903..118992)
FT                   /locus_tag="Franean1_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(119081..119740)
FT                   /locus_tag="Franean1_0100"
FT   CDS_pept        complement(119081..119740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0100"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3558
FT                   putative TetR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09567"
FT                   /db_xref="GOA:A8LBA6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA6"
FT                   /protein_id="ABW09567.1"
FT                   /translation="MSDTAGVEWEGTPASVRAAVDRALNRHQRDALVEVEQILDAALRV
FT                   AVRVAPADPKVADIVAEAGTSNQTFYRYFAGKNELMHAVLERGIVILRSYLRHQMSKKS
FT                   DPAGQMTAWVDGMIAQITRPAVAQQGATVNRLLARASDSVPGRATLDQQLGQLLVPPLT
FT                   AAGRPRPDLDARLIQDAVLGTMQRHVEPCTVPTEDEQRHLIDFCVSILQAGPAAAH"
FT   gene            complement(119884..121128)
FT                   /locus_tag="Franean1_0101"
FT   CDS_pept        complement(119884..121128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09568"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA7"
FT                   /protein_id="ABW09568.1"
FT                   /translation="MRNAPDAENSADSADSLQEPVPHQPTVPAPGPQRRPEPADRPDGG
FT                   VLRLDLRIPVPATRGHDQSSQNQSSQHDGADQDGWQIAVTVCLPAPPSPSATGPGADGL
FT                   ETGGLETGGLEPGGLAAGGSGPGVPVLVGLPGGGYARRYFDLPEPGYSQAEHHVRRGAV
FT                   VVMVDHLGVGESSVPPTEVTDLPTVAAAGHHAVTAVVDGLRSGTLTPGVGPVGVSAVIG
FT                   MGQSMGGHILAAMQAHHRTFDGVAILGSSMTATTIPWRPGTPGPVIPEGSSPDEAMAVV
FT                   LASADWIYAFFWEDVPESLVRADSTGGLPGRRTAPVWGSTTYPGLTGAEVLPAGVAEAA
FT                   ASIDVPVLFATGTRDVTGPPLTELAAFSSATDLAWFVAPRMAHMHNFAGTRHLLWNRLD
FT                   AFAAQVTGPRTTRLW"
FT   gene            121434..122270
FT                   /locus_tag="Franean1_0102"
FT   CDS_pept        121434..122270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0102"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: pac:PPA2224 undecaprenyl-diphosphatase;
FT                   TIGRFAM: putative undecaprenol kinase; PFAM: Bacitracin
FT                   resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09569"
FT                   /db_xref="GOA:A8LBA8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA8"
FT                   /protein_id="ABW09569.1"
FT                   /translation="MNIVEAVFLGAVEGLTEFLPVSSTGHLTIIEKLLGYSIDDPDITA
FT                   FTAIIQVGAVFATLLYLRHDFRRIIAALARGVTRPEYRDHPDFRFGVAVIVGSIPIGIV
FT                   GLLFKDQIETTLRSLWFVGTALIGWSAVMGYADRVATQKRHEDDVTWKDTLVIGVVQCM
FT                   ALIPGISRSGSTMSAGLLRGIDRVTVTRLSFFLSIPALFAAALLQVVTESSNIEQGVGW
FT                   TVTITATVVSFVTAYFAIAWLLKFVARHSYSVFIYYRLALGSVILFLLATGIISAT"
FT   gene            122399..123010
FT                   /locus_tag="Franean1_0103"
FT   CDS_pept        122399..123010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0103"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: fal:FRAAL6787
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09570"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBA9"
FT                   /protein_id="ABW09570.1"
FT                   /translation="MTSTVQESIDVAVPVRTAYNQWTQFESFPNFMEGVESIQQTDDTH
FT                   THWRIKAGGTEREFDATITEQLPDERVAWKSTEGSRHAGVVTFHRLADDATRVTVQMDW
FT                   QPEGLVEKAGSVLGADDRRVKDDLKRFKSFIEERGQETGAWRGDVSRPDAAGQSGQSGQ
FT                   SGQPGRLGSSEAPGTGGAGGPQRDQGTGGATYSQPGGGEF"
FT   gene            complement(123040..123750)
FT                   /locus_tag="Franean1_0104"
FT   CDS_pept        complement(123040..123750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV1688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09571"
FT                   /db_xref="GOA:A8LBB0"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBB0"
FT                   /protein_id="ABW09571.1"
FT                   /translation="MQPPPSLPAQLYLLAYDLERNRMYRSPYLGRALRAAAATELYRAG
FT                   LLTDENGRVKPVAPRAEHRPHAEGRPGQPAAPGRRRTPTADELCAQLISEVGASSRHRS
FT                   WKHWVNKNQRTAGRVVRDQLEAGRWIRVERRRILGMIPATSVTVRDRAMVRRLHREVEQ
FT                   VLHGGPAGRADPGPASLAALLAAGQIGAMKSGRARRALKGRLALLEPVAGPAVPALRAA
FT                   VREAQTAESAGAAG"
FT   gene            complement(123775..124047)
FT                   /locus_tag="Franean1_0105"
FT   CDS_pept        complement(123775..124047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09572"
FT                   /db_xref="GOA:A8LBB1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8LBB1"
FT                   /protein_id="ABW09572.1"
FT                   /translation="MAERKKILLRLDPAVHDALARWASDELRSTNAQIEFLLRAALADR
FT                   GRLPREAGAIPRRGRPRRDTTTGPEPGPEDAPSTEAVDVRRTPPP"
FT   gene            complement(124071..125018)
FT                   /locus_tag="Franean1_0106"
FT   CDS_pept        complement(124071..125018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0106"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: sco:SCO5038 integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09573"
FT                   /db_xref="GOA:A8LCD4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD4"
FT                   /protein_id="ABW09573.1"
FT                   /translation="MSTETPQVDVEHVVVDMPEPSVREHHAKDHSGLLALLASLLGMLA
FT                   CLALGIAGIVVAADHSAPVGAVLIVVGVLGLIAAFFALCGLTAVAPGEARVVALFGRYV
FT                   GTIRTTGLRWVNPFTTRKKVSTRIRNHESGVAKVNDADGNPIEIAAVVVWQVKDTAQAV
FT                   FEVDDFVEFVAIQSETAVRHIATSYPYDAAPEVMSLRDNAEEITAKLSLEIAARVASAG
FT                   VHVIESRITRLAYAPEIAQAMLRRQQAGAVVAARSRIVEGAVGMVEAALERLDRENIIE
FT                   LDEERKATMVSNLLVVLCSEQSTQPVINAGSLYT"
FT   gene            125194..126174
FT                   /locus_tag="Franean1_0107"
FT   CDS_pept        125194..126174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0107"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fal:FRAAL3623 putative ABC transporter (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09574"
FT                   /db_xref="GOA:A8LCD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD5"
FT                   /protein_id="ABW09574.1"
FT                   /translation="MPDRRLEIDDVRKRYGEVVALDGMTFDVREGELFGFVGSNGAGKT
FT                   TTMRIVLGVLAADAGQVRWAGRPVDLAVRRRIGYMPEERGLYPKMQVRDQLVHLARLHG
FT                   MPAAAAGRSADAWLERLGVAARRDDEVQKLSLGNQQRVQLAAALVHDPEVLVLDEPFSG
FT                   LDPVAVDVMSQVLREKCDEGVPVVFSSHQLELVERLCDRVGIVAAGRMVAAGTVDELRA
FT                   DGTERIVVEVPGAPPGWAEDLPGMTVRATEGARTVVDLAPGADDQDLLRRALAVGPVRE
FT                   FRRGRPSLAELFRSAVSTDEGAPGVRSRTGSGSDTASATDEVTVA"
FT   gene            126171..127487
FT                   /locus_tag="Franean1_0108"
FT   CDS_pept        126171..127487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0108"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: fal:FRAAL3624 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09575"
FT                   /db_xref="GOA:A8LCD6"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD6"
FT                   /protein_id="ABW09575.1"
FT                   /translation="MSPESDHEHGREATAGPAPGIPAQTGAGPAPAPGSGGRGDYPALG
FT                   SWATVRLVAGRELGVRLRSKVFRITTVALLVLLVGAAVVIDLVDGGDSTESVGVTAAES
FT                   AITAPLTAAARSLDVGITTREVPDEATGLRQVADGDLDALVTASPNGLRVAVKEDLNDE
FT                   WRAVLAVVARQQVLDNEISVLGGDPARVNEAVAATRVDVTQLDPAPAHQGERLVLGIAA
FT                   ALLIYMGLMLYGPAVSQGVVEEKSSRVVELLLSTVRPWTLMAGKVLGIGLVALIQMIVL
FT                   AGGGLVAALVTGALSLPSGEATGTVIWSVVWYVIGFFLYALPFAAVGAMVSRQEDVGGI
FT                   SSPIVLAIVVPWVLGISIVPGDPDNGLIAVLSLLPIFAPVLMPMRIALGVAPVWQLVLS
FT                   VVLALALIGVLIRLTGRIYRNAVLRTGARVSFRDALREA"
FT   gene            complement(127540..128625)
FT                   /locus_tag="Franean1_0109"
FT   CDS_pept        complement(127540..128625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0109"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; KEGG:
FT                   fal:FRAAL6784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09576"
FT                   /db_xref="GOA:A8LCD7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD7"
FT                   /protein_id="ABW09576.1"
FT                   /translation="MYGSSWDRTRNTESTAWGRPPGRRPRAAAGHPDTTQTRRGTRDSS
FT                   RPTATGTSSADRDPSTGGDPSAGRGPKAGRDPTADGVRARGEHERPGLTVAVTLYPPAR
FT                   NRPVRNTSGTMVEPTRGLIPHVQVGTGSLFGWFDNPASQVSAHLWLSKAGEFEQYVPFD
FT                   RRAWAQAAGNPFWISVECEGYDSEDYTAIQVQRLGELFAWGMREFGWRPEITDSPNGYG
FT                   LGTHRMGGAAWGGHSCPGNVRANRRGDILAAALGASPGGSLADPRQRYAGMPTLREGMS
FT                   GPEVVTLQNALNIIFGHEAPTGDPYRLAPDGAYGARTTARVASLQRYATPWFGRIPEDG
FT                   VCGPNTWRKIGYVLTGMNRQV"
FT   gene            128855..129745
FT                   /locus_tag="Franean1_0110"
FT   CDS_pept        128855..129745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0110"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6783 putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09577"
FT                   /db_xref="GOA:A8LCD8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD8"
FT                   /protein_id="ABW09577.1"
FT                   /translation="MTPSSTTVAGAPEGGPTFALVAGVPSAAVFDLRHEVFVGEQGVPA
FT                   DLERDALDASADHAVLVGAGGLVLATARLITPEGGQEPDVGRGRYGVIGRVAVRRPYRG
FT                   RGLGLFVTEALERLAAERGLTTIELHAQQQVEEFYRRAGYRPRSARFGPVRDIEAGIDH
FT                   IWMRRDLEPEPRLDPGRNPPRAGDPAASAARPARSAVPSAERFSDAGVGELWVGGASPD
FT                   ALRVVARLGYARTGREREPCERSGAPELEHRRGTVAAPRRGRGGPAVPCRQADRACVGH
FT                   ELGTDVHPACLSDRP"
FT   gene            129761..130477
FT                   /locus_tag="Franean1_0111"
FT   CDS_pept        129761..130477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6782 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09578"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCD9"
FT                   /protein_id="ABW09578.1"
FT                   /translation="MTVARSFSVGRAGLVAVLIAGTFAITGQTAARAGGTPGAECPGGQ
FT                   EFEVAVTGDEPDPGPPVRLEAGYYAHTASFWPPRSAVLCRTESGTDQPSAQVTDTPGLT
FT                   CPAGASELVVPDVIPTDIETPVVADSGALLPAGWYSLPSLDPESAPASTQPTDLPDQAG
FT                   PAGPVTPVNQPGPGQTALTSPGATGPESTSPATGGGVTEAGAFTGGGTAPDGDGAGTVV
FT                   WTTLCWSQTDPGAPAA"
FT   sig_peptide     129761..129862
FT                   /locus_tag="Franean1_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.751 at
FT                   residue 34"
FT   gene            complement(130611..132047)
FT                   /locus_tag="Franean1_0112"
FT   CDS_pept        complement(130611..132047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0112"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: fal:FRAAL6781 adenosylhomocysteinase
FT                   (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase); TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; TrkA-N domain protein; D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09579"
FT                   /db_xref="GOA:A8LCE0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE0"
FT                   /protein_id="ABW09579.1"
FT                   /translation="MTFDFKVADLALAEFGRKEIRLAEHEMPGLMATRAEYAASQPLKG
FT                   ARIMGSLHMTIQTAVLIETLVALGADVRWVSCNIFSTQDHAAAAVVVGPNGSKDDPKGV
FT                   PVFAWKGETLDEYWWCTDQALSWPDGGAPNMILDDGGDATLLVHKGAEFEKAGAVPATD
FT                   ASDSEEYAIVLETLRRTISEKPGRWTTTATSVKGVTEETTTGVHRLYEMAKAGTLAFPA
FT                   INVNDSVTKSKFDNKYGCRHSVIDGLNRATDVLIGGKVAVVAGYGDVGKGCADALRGQG
FT                   ARVIVTEIDPICALQAAMDGFQVATLEDVVSTADIFVTTTGNYDIITAAHMAAMKHQAI
FT                   VSNIGHFDNEIDMAGLTKTPGIEKINIKPQVDEWVFPDGHSIIVLAEGRLMNLGCATGH
FT                   PSFVMSNSFTNQVIAQIELFTKTEQYPVGVYTLPKHLDEKVARLHLDALGVKLTTLTKQ
FT                   QADYIGVPVEGPYKPDHYRY"
FT   gene            complement(132262..134859)
FT                   /locus_tag="Franean1_0113"
FT   CDS_pept        complement(132262..134859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0113"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6779
FT                   hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09580"
FT                   /db_xref="GOA:A8LCE1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE1"
FT                   /protein_id="ABW09580.1"
FT                   /translation="MPSSPAPSDPSAPSGGSARFWSGLGRTVGRRTGMVAVVALIITAV
FT                   LGLGLTKLEFTTGQDNYLNSDSQVAKDNVAYQNLFGGQAMIVLFTTKPGTDLVDLFTTD
FT                   NVKKFRDLSARLEKDPRIESVITPLTALQFTANLVTSPDGNPISSPAGQILLDAQSRDP
FT                   NPDSAKRRLADSLRTLERINAIPADRRDFDDPDWTDFLLHDNTGAVRKSLESFFPTDRT
FT                   AQMIVRLKGNASIKEEGRGASATEAAMQDLTFDNADVMTTGAAVLLRDINDYLRGGFLT
FT                   LGAISLVIMAGLLLVAFAVRWRLLPLGVVAVGLVWAFGLAGYLGVPLSVVTIAGMPVLL
FT                   GVGIDFAVQLHSRVEEEAQLDRARDPVAEALAWLMPALAVATVAGIVAFLALEFSEVPM
FT                   IRDFGVLLAIGLPVIVVATVLLSAASLGFRERRSPTAPRDYSRGPLGRAVVALGSLPRV
FT                   TAIPLVVLAAAIFAGGLVVEGDLKVQTDPEKWVSQDSQVVHDIQNLKAQTGSSSELGVY
FT                   IQSGDVFDDRTVKFVHDFTYQQLKEHPQELLTASSLVTTISFLMEVPDTTLLAPTGADI
FT                   ERAYRVTPEAIQKSTVNLDGKALNLIFRTGPGALEERAVVVDDIRATVSPPEGIRATPS
FT                   GLAVVGTGLLENFEKNRVELTYFALIGVFLILLLWHRNIVRAVVSVVPVLIAVGLTAIV
FT                   SWLAGFDLSPLTAVGGPLVIALCTEFTTLIVMRHIEERRRGRDPLAAIEEAAARTGRAF
FT                   MVSALAAVIGIVVLAFSSLPLLRDFGLVVALNVGVALLSALVVLPPLLLWADERGWVYR
FT                   GPRLAAGALPLPTPAPAGAGVGGPAGSDGTSAPPAGSATPPAAGSSAGPTPES"
FT   gene            complement(135288..135494)
FT                   /locus_tag="Franean1_0114"
FT   CDS_pept        complement(135288..135494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0114"
FT                   /product="Domain of unknown function DUF1918"
FT                   /note="PFAM: Domain of unknown function DUF1918; KEGG:
FT                   fal:FRAAL6778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09581"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE2"
FT                   /protein_id="ABW09581.1"
FT                   /translation="MYASVGDRFVVHGRTVGCPERHGVITEVRGVAGGPPYLVRWDDGH
FT                   EGLFFPGADSTIELRPAREHARA"
FT   gene            136246..137430
FT                   /locus_tag="Franean1_0115"
FT   CDS_pept        136246..137430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6775 conserved hypothetical protein;
FT                   putative membrane protein (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09582"
FT                   /db_xref="GOA:A8LCE3"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE3"
FT                   /protein_id="ABW09582.1"
FT                   /translation="MVSIPFPSHGRAGSATGSVTVGSGSAGWRATRTGRVAATTLFFVG
FT                   QVLLLAALYMIYRMGRQMAVGREPEALANARDVWSLERLLDLPNESAVQQLALHSTELL
FT                   ELANRFYIGVHFPASIAFLLWVMIRHRDHWPRVRTVILVSTGAALMIHILYPLAPPRFL
FT                   PQELPHVTLVDTGAVFGPSPYTAGDTVANQYAAMPSLHVGWSILVAWGVVSILRSRARW
FT                   LIIAHPVITTVVVVITGNHYWLDGVIGGSLVATAVQLTRLEAHARMRLWTIAAGQRLWG
FT                   RAGEATASLAGSPSGALGGVGVGAGVGNTTDADPRTGTDHGTGTDHPVSVPSSVVFAAV
FT                   LPAARGGPPRADLPAQRPFPPGPLPSGGTEPEDRPPTAARADVAAVESADGESG"
FT   gene            137538..138677
FT                   /locus_tag="Franean1_0116"
FT   CDS_pept        137538..138677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0116"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mxa:MXAN_5897 phosphotransferase enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09583"
FT                   /db_xref="GOA:A8LCE4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE4"
FT                   /protein_id="ABW09583.1"
FT                   /translation="MRDEDAFDVPAVDGWLRRRLQERAAVGAAEMGVATGAGVLTERPP
FT                   VARSIPPPGRPQVRQFSGGASNLTYLLRYEDRDLVLRRPPHGRKASGAHDMAREYRVQA
FT                   RLRPAFRYVPRMVAFCDDPTVIGSEFYIMERVPGVIPRSEFPRSLTFDPERTRRLAFQV
FT                   VDLLVALHDIDPVAYGLSDLGRGAGYVDRQLTGWARRYRDARTPNVPSFEVVMRWLTEY
FT                   APEDVATCVIHNDFRIDNVVFDVARIGDDGLPRISGVLDWEMATLGDPLMDLGGALAYW
FT                   VQADDDALFRLTRRQPTHSPGMPTRAEIVEYYAARRGLDVGRWPFYQVFGLFRLAVIAQ
FT                   QIYFRYHHGQTTNPAFREYWQVVTHLEKRCLRVMAAAGL"
FT   gene            138819..140615
FT                   /locus_tag="Franean1_0117"
FT   CDS_pept        138819..140615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0117"
FT                   /product="peptidase C2 calpain"
FT                   /note="PFAM: peptidase C2 calpain; KEGG: fal:FRAAL6773
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09584"
FT                   /db_xref="GOA:A8LCE5"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE5"
FT                   /protein_id="ABW09584.1"
FT                   /translation="MSIKGQWIEGQWIEGQWIEGAPVAAAAAVLRRVAVESSSLLAPVI
FT                   VLDNDETWRSPWQRRCHGRIDEWTSALAAGARAAREQAVRLEFLAARGAWGAVTLGPAA
FT                   VSAPRSPVSHPAVVDVAFSPERLAELARRLRRAADDAARLAAEVRRVAHALPGDMGGAL
FT                   VAEGCCRGLDRVAAEAPDMAGAIDGRLAYAASGGSVASAGFGGSGGFATSAPAVERAPG
FT                   PEMQHAARLTEPRSAGADTARTVAELTASIGADPFRLDPRELSELSTRLGRLGPAELRA
FT                   VIGGLRGRPLEVLAAAVRIAPTRVELRTLGLLPAVFSLGDLLLRGAPASMVAEIARLFP
FT                   GLEPPMGGRYRPWAYTAGHPPSTGDLTMRDHGRDPVWASGVTPSDVGQGAVGDCYLLAA
FT                   LIGIAQADPGLLRRNLRENPNGTVSVTVHLPTGAVPVTVTRSLPARAGAGQEIAADADN
FT                   AAGEPELWAALYEKACARMAGSYARLEGGDPATAMEYLTGTAAVRRSPSAVGVDELAAR
FT                   LAAGGVVTVVTRSDLPPGCGLVPNHAYAVLKADARTGQALLRNPWDQAGTDDRLEWHDW
FT                   DGLKPALAGVQWASTGRGPPAR"
FT   gene            complement(140647..141792)
FT                   /locus_tag="Franean1_0118"
FT   CDS_pept        complement(140647..141792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0118"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: fal:FRAAL6772
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09585"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE6"
FT                   /protein_id="ABW09585.1"
FT                   /translation="MTDGALTGTQADQTPERTGAPAIERHSGPTVGTAADIVVGIDGSP
FT                   GSAAALTWAVAEASRRGLRVRAVLGSCADEQPTAVRRSADAIAGPHDEATLAFAASHLL
FT                   HETIGAAPIPAGLEVLEEVVDAPGAEALLTAGRDAAMIVVGARGRGLLHRLRLGSVSTS
FT                   VAVHSPVPVVVARLPRSGDAGEPDADGLAGAGPVADERLSPTSAPRQGTPHRRPVVVGV
FT                   DGSPNSLAALRWAAVTAALRGAPLHVIHSWLAAVPLPFAETSGEIVQALEGQARAVLDE
FT                   SIEQVLGPIPGGEPGEPAEPGGTEPAVLRLAAPAPGSGEIDVYRQLIPASATRALLEAS
FT                   HDADLLVVGARGKGGFAELLLGSVSHQTMLHSAAPVAIIRA"
FT   gene            complement(141971..142558)
FT                   /locus_tag="Franean1_0119"
FT   CDS_pept        complement(141971..142558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09586"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE7"
FT                   /protein_id="ABW09586.1"
FT                   /translation="MSDRFIGHLARNSGRALPGARRSPPERAGCRMHLCHLSQAAPAAP
FT                   GTPAGRQRYAGLRPLTYVTPPPAATRRGRPPPTHVQNTAPSPRRVTAKSPGAPTIGGDL
FT                   DARTQSIQRAHTGRGENHPCQSGMIGTTRLGPPAPSQTAHSEATLRPRRMIRSNFLCCA
FT                   EVKKISRITTLRIFIRNHRHTSESGSTQKSDN"
FT   gene            142743..145028
FT                   /locus_tag="Franean1_0120"
FT   CDS_pept        142743..145028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09587"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE8"
FT                   /protein_id="ABW09587.1"
FT                   /translation="MASDTMTQLVIPGALVMVSTPDRGVPVASTADWHDALLNVKSGVT
FT                   PAMKLVAFTICTHCAPADRPAPSGAYVTSPGLSLLCEQTNFSRTHVQRQLSLLRANGWL
FT                   VTITRPAAGRPARYLLSVPVAVARAGGYRLAGEDVEPRDTERAEQRDTELVGATAAPAR
FT                   RTPGLAAVTSSDRMLTTPPAPGGPSEPGRGFGCLASGTLERPALVRRRKRATYSAGGRG
FT                   VVRVRRKPRTLPPSAVTDVIAAASSVAPVTVGDTASAAGPEQVDEARPMAVGETSYVPF
FT                   GGGQMGSDVAAGTAGGPVRAVSDISTGAVGAAQSPAAQPAASAQSASASAISASAASGR
FT                   SLGPRPIVPVSERVAGAARAPEASLRGVATSAEPPITPAPPVPAPQPTAPGPIAPVSQP
FT                   PAPTAPASQPTVPAPQPPAPAPATTAPTAEAPSPESQPQPQPQPQPQPQAAAPEPEPEP
FT                   EAEPEAEPEPVESPVVDEIRMATRQVIEILAKMLRCQVEDFAELDRRVYEVLSEGDWAP
FT                   VELATHLVNFVANGVWVNGDDVADNIRWRMDRLPLGVTECGCKSCLGWRAAPERPPRPA
FT                   PPSAPGPSAAGASARMSTPVRAAGPLPAGPVAAVTTAAATKAGSARPEHSPAANPPAPP
FT                   ARPASTSGVVANQASSAKSASQVNRAGPVEQSPAAPPPPPDLAAIAAAAAAGAEEARRN
FT                   EEAKRLQTAGISAAGDSEPGDSAAGDSEPGDLVGGDSIVEGSSAQTPPGTAGVQNGTSQ
FT                   EAEPLTED"
FT   gene            145039..146910
FT                   /locus_tag="Franean1_0121"
FT   CDS_pept        145039..146910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0121"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; KEGG: fal:FRAAL6768
FT                   cholesterol-O2 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09588"
FT                   /db_xref="GOA:A8LCE9"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCE9"
FT                   /protein_id="ABW09588.1"
FT                   /translation="MVVRHAPFPVSRRTCMPGGMMGHMGGDETERSGADIERRDDCDVL
FT                   VIGSGFGGSVTALRLAEKGYRVTVVEAGRRFTPATLPKTSWDIRRYLWLPRLGCHGIQK
FT                   ITLLGRVLVLSGAAVGGGSVVYANTLYRPLDGFYDDPQWADIADWRAELGPFYGQAERM
FT                   LGSTRNPSMTMADEVFRDVARDMGVGDTFRLADVGVFFGRDGQREPGVTVPDPYFGGAG
FT                   PARTGCVECGECMTGCRRGAKNTLDRNYLHLAEGLGARIVADTTVRSVRPDGRGGYEVE
FT                   TVRTGSRRRDARRWTARQVVFAAGALGTQRLLLGMREQGHLPGISDRVGHLTRTNSEAI
FT                   LGATRLRPDGRITRGVAITSSFYPNDHTHVEPVRYGRGSNLMAFLSSAMTDGGGSLPRW
FT                   AKHLLLLARRPYLTLLALPWRWSERTMIALVMQSRDNSLTVSRRRGPFGTSWLTSHAGH
FT                   GESNPTWIPEGNQAARLVAERLGGHPGGAITELADIPLTAHILGGAVLAADPARGVIDP
FT                   YHRVFGHPGLHVVDGSAVPANLGVNPSLTITAMAERAMAFWPNRGDTDPRPPVGAAYRR
FT                   IAPVAPRNPAVPADAPGHYEISALTSTNTDLPRDAVAGGGRETPHNM"
FT   gene            146934..147740
FT                   /locus_tag="Franean1_0122"
FT   CDS_pept        146934..147740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5810 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09589"
FT                   /db_xref="GOA:A8LCF0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF0"
FT                   /protein_id="ABW09589.1"
FT                   /translation="MAGGRLVAEFRRRPRLCSQRFVLFVNAPIGLLVALLAPRVLTEAP
FT                   RRTGTFDLPGAVGVTAGVTVGVYGLTRTTTHGWSDALTLLCLIGGVALLGLFLLREAMC
FT                   REPLVPLWLFRNRDRGGANLIILAVAVAMFGVFYFLTLFVQGVLGYSPLFWLSTLSADS
FT                   SYPTLLLPATVLFGFGVGISFVPLTAVAVAGVDAADAASAAGSARPSPAAIIEASVAGY
FT                   ADALLVGAGMCLAAMLAGLFMITPAAGRLESAGAAEGASQPVPGHV"
FT   gene            complement(147843..148565)
FT                   /locus_tag="Franean1_0123"
FT   CDS_pept        complement(147843..148565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6767 hypothetical protein; putative
FT                   coiled-coil domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09590"
FT                   /db_xref="GOA:A8LCF1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF1"
FT                   /protein_id="ABW09590.1"
FT                   /translation="MSTTLKDRLAHVTDAAPVSGLPGAAKNAADRAGAAASKAALKAGS
FT                   TAGSAAHATRDASSTLVHRVSDVSGAGGTAAGKAAGKAAGLAVGKASAVSGRTARRIEK
FT                   ARSSAELSAERARMATELRLEKSRSRKAVRSESKARQRADRAQELLEKRLEKAEVKLAR
FT                   VHRRRRRGVVTLFLIGVGAAAAVAARRYLASADTETITAEPVPPLRSDLADGVGPEVTS
FT                   GLEEMPGVDTMTEAGRRT"
FT   gene            148981..149508
FT                   /locus_tag="Franean1_0124"
FT   CDS_pept        148981..149508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0124"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: fal:FRAAL6765 peptidyl-prolyl
FT                   cis-trans isomerase B (PPIase B) (rotamase B) (cyclophilin
FT                   ScCypB) (S-cyclophilin)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09591"
FT                   /db_xref="GOA:A8LCF2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF2"
FT                   /protein_id="ABW09591.1"
FT                   /translation="MAEELYATVRTTQGDIEIRLFPDHAPKTVKNFVGLATGSREWTDP
FT                   ATGEKKTGVPLYSGTIFHRVIPNFMIQGGDPLGSGRGGPGYQFVDEFHPDLRFDRPYLL
FT                   AMANAGPGTNGSQFFITTAATDWLNRKHTIFGEVTRGTDVVDKIGKTPTGAQDRPKTDV
FT                   VVQEIVVERRPA"
FT   gene            149587..150732
FT                   /locus_tag="Franean1_0125"
FT   CDS_pept        149587..150732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0125"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: fal:FRAAL6764
FT                   hypothetical protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09592"
FT                   /db_xref="GOA:A8LCF3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF3"
FT                   /protein_id="ABW09592.1"
FT                   /translation="MTDSPAGDPARAPEGSSGAPGGSGGAGSAGEAEIPRPASPLPAAG
FT                   EPPPAGGPPNGGPPNGGPASGGPPHEQVGWRPETGPPAGHAGWTPPPAGAPSLPHCYRH
FT                   PERETYVTCQRCGRPICPDCMRPAAVGFHCPEESGAGGGGRPERRREPRTDFGGRPGAG
FT                   RRGLVTQVLISLCLVAFVLQGLPGLARDSGSLNQFSADFRLYGVSLAWDDQYYRLLTAA
FT                   FLHVNYLHVLVNLYALFVLGYQLEAILGRLRLVALFVACAVGGNTLSYLVNGVSVNSVG
FT                   ASTAIFGFFGAYYVIARRLRADTTQILILIGINFALTFTLSFIDRWGHVGGLVAGVLVG
FT                   LLYAYVPPRRTVVQAAGVLALVGLLFAAAVIKSADLTTAFA"
FT   gene            complement(150756..151208)
FT                   /locus_tag="Franean1_0126"
FT   CDS_pept        complement(150756..151208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09593"
FT                   /db_xref="GOA:A8LCF4"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF4"
FT                   /protein_id="ABW09593.1"
FT                   /translation="MSTPPVDLSWSPPIWRCAAYAAGGAVLLVVAAVEDLAWRVASLDG
FT                   AGRLLVGLVGLGLVALAVSDAVSRPTLRLGPGGIDYVEGLRRRHLPWAAVIGARSGTLT
FT                   HGRRLVHLRTLEIETIDGPVLLSRRALGTDPERVAEAVEELRLRLG"
FT   gene            151460..152671
FT                   /locus_tag="Franean1_0127"
FT   CDS_pept        151460..152671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0127"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="PFAM: putative transposase IS891/IS1136/IS1341
FT                   family; transposase IS605 OrfB; KEGG: sen:SACE_0711
FT                   putative IS element transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09594"
FT                   /db_xref="GOA:A8LCF5"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF5"
FT                   /protein_id="ABW09594.1"
FT                   /translation="MAVSRFRLYPDAAQEQALLVHCGHARFVWNLACEQQPWYRPWRGR
FT                   APGYAEQNRQLTEARSANPWLAAGSVIVQQQALRDFATAMANFFRGSHRRPTFRRRRRG
FT                   EGFRIVAVKPGDVRRVNRRWARVRVPKAGWVRFRWSRAVPGARSYRVTRDRAGRWHVAF
FT                   AVAPHPIPAPGTGGVVGVDRGVVVSAALSTGELLSCPGLRAGERARLVRLQRRLSRARR
FT                   GSQRRGRLKARIARLRAREVDRRKDWVEKTSTDLARRFDIVRVEDLKIGRMTRSARGTV
FT                   EAPGSNVRQKAGLNRGILANGWGLLVARLEEKAPGRVEKVPAAYTSQRCSACGHVASGN
FT                   RESQAVFWCVACGYTANADVNAAVNIAVGYIAAGRAVTARGGAALAVPVNREPQHCAPL
FT                   LVGV"
FT   gene            complement(152708..154795)
FT                   /locus_tag="Franean1_0128"
FT   CDS_pept        complement(152708..154795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0128"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="KEGG: mva:Mvan_2284 transcriptional regulator,
FT                   winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09595"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF6"
FT                   /protein_id="ABW09595.1"
FT                   /translation="MLDLVHHAAPRWPDGATLVELAPVRDEATVPFALAQALEVTTRGD
FT                   LLRAVIDYLATRRQILVIDNCEHLLDAVRDLVGELLRWVPNLTVLATSRAPLGTSGEWV
FT                   FRLGPLPLPAPDTDPAGAAAVQLFLDRARQARGGRDLPATALEDAAAICRRLDGLPLAI
FT                   ELAASRLTALSPADLRARMDAGLDLGRGRRPPVDDDRHHTLRGTIAWSYRLLDAQAQRL
FT                   FRHLAAVSGLFDLSIAEAVADAVTCSEDPEPAEDPIAALSTLVDASMVETVTDPAHPDD
FT                   GTAFRMLDSIRAFGLEAARAAGELETAQILIAAWAREFTRSAAGGLHGPDGPRWGRRIL
FT                   TALPVLRACRERMLKHGDLAGAARISIDLGEFAAWHNNAELWAWALETADDPGLAELPE
FT                   APLLYAAASHAAWRAGSLGKARELADRALATAVDDAGVATARYALGVTDLFAGEFASSI
FT                   DHLVAAAALDADLAANEMAVAALAAAYGGDADRADALVTRARQLVGTSGGPIIWSFVEY
FT                   VQAEIHIHDDPVTARRHAERALAAARAGGVTFAVGISLVTLASSAVRTGDLATATAHYP
FT                   EVIRLWLRTGSWPQQWTTLRNVADLFSRLGRDAEALLLSTAADADPDSSAVVGADAERV
FT                   HNLVEQLRDRLGVDAVAAIRRQAAQLTRLEVVDRALTTLAELEHQGAGTPARSPAPPVV
FT                   G"
FT   gene            154807..155253
FT                   /locus_tag="Franean1_0129"
FT   CDS_pept        154807..155253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1868 LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09596"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF7"
FT                   /protein_id="ABW09596.1"
FT                   /translation="MERIAGIIRELRPAVVVTFGSDGFTGHPDHRAVSAWTTTAFARAA
FT                   PDGARLLYAAASTDHRERTRDVDELLGIAVDGADPDGDDGPVVPPGALAVRLNLAGRLL
FT                   ERKVAALRAHASQTAGALAALGPDRFAGWVAEEAFVDHRDRVSP"
FT   gene            155425..157335
FT                   /locus_tag="Franean1_0130"
FT   CDS_pept        155425..157335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0130"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   fal:FRAAL6761 conserved hypothetical protein; putative
FT                   glycosyl hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09597"
FT                   /db_xref="GOA:A8LCF8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF8"
FT                   /protein_id="ABW09597.1"
FT                   /translation="MAHTPTRRGGGSPFPPIAEYGFLSDCETNCLVAPSGNVEWMCVPR
FT                   PDAPSVFGAVLDRSAGGFRFGPDRTFIPAGRRYLPGTNVLETTWQTPTGWLIVTDCLVV
FT                   GRWHRTHRRSKTHRRTPGDWDADHVLLRLARCEHGDVDLSLVCEPNFDYGRSPASWRYE
FT                   DEDYSTGIITHDFPAGDPAAGVALRLRTDLRLGFDGRRALARTTLREGDTAFVAMTWRA
FT                   EDPLLPGNYPQACAAVDSTTEFWRQWLSRGRFPDHPWRRHLQRSALALKGLTYAPTGAL
FT                   LAAATTSLPETPQGERNWDYRYSWIRDSTFALWGLYTLGLDYEANDFFSFIADVAEHAD
FT                   DIQVMYRVGGEPKIDEEILGHLSGYDGAVPVRVGNEAAKQRQHDVWGAVLDSVYLHTRS
FT                   RDYLSERLWPVLVRLVEAAAAHWRETDRGMWEVRGEPRHFTSSKMFCWVALDRGRRLAQ
FT                   MRGDLRTAGRWDDIADEIHADVLANGVDHRGVFTQYYGSTSLDASVLLMPLLGFLPSTD
FT                   DRVKATVLAIADELTVDGLVLRYRTDETDDGVEGEEGAFLICSFWLVSALVEIGELTRA
FT                   RQLCERLLSLASPLDLYAEEIDPADGRHLGNFPQAFTHLALINAVMYVIRAESGESFTR
FT                   S"
FT   gene            complement(157556..157822)
FT                   /locus_tag="Franean1_0131"
FT   CDS_pept        complement(157556..157822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0131"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   sco:SCO3854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09598"
FT                   /db_xref="GOA:A8LCF9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCF9"
FT                   /protein_id="ABW09598.1"
FT                   /translation="MPESRRRKPKKTTVAAPQTSTRAPKRRPPSPPWFGGMILAFFLIG
FT                   IAYLLVYYFSNGGVLGMESLGGWNILIGFGFVVVGLAVSTQWR"
FT   gene            158037..158927
FT                   /locus_tag="Franean1_0132"
FT   CDS_pept        158037..158927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0132"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   fal:FRAAL6757 conserved hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09599"
FT                   /db_xref="GOA:A8LCG0"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG0"
FT                   /protein_id="ABW09599.1"
FT                   /translation="MPGGGPARKAGSTTDETDKTEGPAPTPAARRRATGWRIALVGLVV
FT                   ACAALLTAAAVRPSAGGRVGGAGVVSVAGLVAQDRRRVDAELDRLQTEREALAANPASS
FT                   AAPAAPPTPPAPAAGDPLDRRAALAAQVGLTAMRGPAVTVELDDAPRESRGRSLPPGVP
FT                   PPGPNDLVVHQQDVQAVVNALWAGGAEAMAIMDHRVTPRTAVRCVGNTLLLEGQVYSPP
FT                   FRISAIGDPDVLRAALDTDPGVLLYREYVDAYGLGYQVTSGPDVVLPAYAGSLLTGSGA
FT                   VARPASGIPSASGGQ"
FT   gene            159068..159718
FT                   /locus_tag="Franean1_0133"
FT   CDS_pept        159068..159718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0133"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   fal:FRAAL6756 aminodeoxychorismate synthase subunit II,
FT                   component of p-aminobenzoate synthase multienzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09600"
FT                   /db_xref="GOA:A8LCG1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG1"
FT                   /protein_id="ABW09600.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLDTECVVRRNDEVDPGDLDELGA
FT                   DGVLLSPGPGTPEAAGVSIAMVHACAARRLPLFGVCLGHQALGVAHGATVDRAPELLHG
FT                   KTSVVHHEGVGVLADLPSPFTATRYHSLAVEESTLPAEIEVTARTDSGVVMAMRHRELP
FT                   LEGVQFHPESVLTQGGHLMLARWLEICGDGGAAMRLAPALAAEVETLRLAAFA"
FT   gene            complement(159777..161879)
FT                   /locus_tag="Franean1_0134"
FT   CDS_pept        complement(159777..161879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0134"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: fal:FRAAL6755 putative
FT                   serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09601"
FT                   /db_xref="GOA:A8LCG2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG2"
FT                   /protein_id="ABW09601.1"
FT                   /translation="MTDVTDRYEAQPRLVGERYELGGCIGYGGMAEVYRGRDIRLGREV
FT                   AVKTLRADLARDPTFLARFRREAQSSASLNHPAIVSVYDTGEDVINGTQLPYIVMEFIA
FT                   GQTLRDVLQAQGALDERHAMQVTAEVCAALDYSHRMGIIHRDIKPANVMLASDGSAKVM
FT                   DFGIARATTATTSNMTATSAVIGTAQYLSPEQARGARVDTRSDVYSTGVLLYELLTGEP
FT                   PFRGDNPVAVAYQHVREIPPPPSSHDSRISPEADAVVLKAMEKDPDDRYATAGEMRDDL
FT                   ERALSGHRVHAMMMGAGDETMLGGAGAGTAGTALLGRSGGGYDDRYEGGGYQGRYDDGY
FT                   DEPGGYDDGYGEQTRVRGEPYDRYDQTGPVDRYGNAGPPGHRPGDDRDREGSSTWKFVL
FT                   AGLGAVVVFVVVALLASSLLGGGGGGDDTAAAQVTIPSGLKGQPYDAVVGRLQSEGFTG
FT                   HFDKQTQESTDVAPNSVLEISPGEGQTIAADGTISITVAIAPGQVTVPQGLAGMTQQAA
FT                   TDALTALGLQASPMQYYEAANHGVGKVEKTEPEAGRPVDSGSSVTIWVVSSTVNVPNVK
FT                   GKNASAAISELQRYGLTAVQETVVDNASQPGTVSDQSPAGGAVNRGSSVKIFIAAQNQQ
FT                   PATPTATATTPPPTDTPPVIIDPTTPPATTPPATATQPAGGGTPTNGQQPGAAGPLRGA
FT                   LNRPSS"
FT   gene            complement(161876..163555)
FT                   /locus_tag="Franean1_0135"
FT   CDS_pept        complement(161876..163555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0135"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL6754 serine/threonine-protein kinase PknA (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09602"
FT                   /db_xref="GOA:A8LCG3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG3"
FT                   /protein_id="ABW09602.1"
FT                   /translation="MSTSANSPSPSQPFAGAASPNTVLDNRYRLDGRIATGGMGEVWRG
FT                   LDQTLGRPVAVKLLRPEYASDESFLVRFRGEARHAARLSHPGVASVYDYGEVSTADDYP
FT                   TAYLVMELVEGEPLSALLHREKRLSPDRMLDILGQSADALQAAHALGVVHRDVKPGNLL
FT                   LRTDGAVKVTDFGIARAVDAAPLTATGIMMGTAYYVSPEQASGRPVTPASDVYSLGVVA
FT                   YECLAGRRPFDDRNPIVVVMAHQQDTPPPLPSDIPYQVRALVESAMSKDASRRPSSAGA
FT                   FARSAASIRRSLWNSDAGRWSGTPGAADATARHPAPPAPPHLGPVPPRAPTAPRTPSWN
FT                   RSGGASWTQQPPPADPTAAAPGMPATALQPSPGQGGSGPGAGRGGGPGRLYGSGDYPPD
FT                   PRNPSDYRNPSDYRNDYPPGGEHGPGWHGGRDDGGHRDGSGHRDGGPGDPANTLYQPSP
FT                   SWSDPPGDGPGGRVAHRRPGAAAQRRRLPLPVLIALLILTVLVVAVITRTVAEAGGSKD
FT                   GAAATSNVLYLTPAEGEIVGPAGEAAGTVVAGAAEPTTGDNL"
FT   gene            complement(163552..165000)
FT                   /locus_tag="Franean1_0136"
FT   CDS_pept        complement(163552..165000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0136"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: fal:FRAAL6753 putative penicillin-binding protein
FT                   PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09603"
FT                   /db_xref="GOA:A8LCG4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG4"
FT                   /protein_id="ABW09603.1"
FT                   /translation="MNTPVRKVALACMVLFAALLVNANWIQVGQVDRLKTEPTNARQIT
FT                   ERLERQRGGIIAGETVLATSVPVDDEYKFQRQYPNGQLYANLTGYYTLFTASGLERSED
FT                   VFLSGDDDRLLASRVTDLFTGEERRGGTVVTTIDPHVQQAAMDALDGRRGAVVALDPST
FT                   GAILAMVTTPSFDPNTLATHDESAATDAYQQLSTNSDQPLLNRAAQQTYPPGSTFKLIT
FT                   AAAALAHGTEPETRVAAPDELTLPQSTTVLPNFGGERCGDGRTDTLTHALTISCNTAFA
FT                   QLGIDLGDDVLRAQAEAFGFNSTIEDFPLQQARSVFPSDLDGAQTAQSAIGQFDVRVTP
FT                   LQMAEVVAAIGNGGVRMKPYLVSELRGPDLKRLDHTEPTELNKPVSPEVAAKLTTMMES
FT                   VVTSGSGRKAQIDGVDVAGKTGTAEHGTGEPPHTWFVGFAPASAPKVAVAVIVEDGGGE
FT                   FATGGAVAAPVAKEVMQAALDTQR"
FT   sig_peptide     complement(164929..165000)
FT                   /locus_tag="Franean1_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(164997..166478)
FT                   /locus_tag="Franean1_0137"
FT   CDS_pept        complement(164997..166478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0137"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: fal:FRAAL6752
FT                   putative cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09604"
FT                   /db_xref="GOA:A8LCG5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG5"
FT                   /protein_id="ABW09604.1"
FT                   /translation="MTLPPLRRPRSADLTATFAGFPLPSGLELPPYRRRELFLLGYAGV
FT                   LATGALAALMLAHDGTIGFQVFTYGLGFFSLWALGHLAVRRFAPAADPVLLPVVAALNG
FT                   IGLVMIYRLDLAKADSARRAGNPIPTGAAQTQLVWTLLAIVVFVLVLAVVRDHRALSRY
FT                   AYTLGLAGLVFLVLPIAPGIGATINGARLWLQVGPFSFQPSEVSKIALMIFFAAYLENK
FT                   RDVLSLASRSFLGMKIPRARDLGPVLVAWLASLGVLVVQKDLGSSLLFFGMFLVILYVA
FT                   TQRASWVAIGLCLFMLGAVVAHSLFGHVQVRVDGWLHAFDGNNPSNTSYQLVQGLYGFA
FT                   AGGLTGTGIGQGSPQRVPFANTDFVMASLGEEFGLTGVMAILLLYALVAARGIRAALGA
FT                   KDPFGKLLATGLSATVALQVFVQVGGVMRLIPLTGLTLPFVSYGGSSIVANAAIIALLL
FT                   RISDAARRLEEPVPDAPLFDPNAVAESPTQVVKTT"
FT   gene            complement(166492..167895)
FT                   /locus_tag="Franean1_0138"
FT   CDS_pept        complement(166492..167895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0138"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: fal:FRAAL6751
FT                   serine/threonine specific protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09605"
FT                   /db_xref="GOA:A8LCG6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG6"
FT                   /protein_id="ABW09605.1"
FT                   /translation="MSLRLHFAVRSDVGHVREGNEDSAYAGARLLAVADGMGGHAAGEV
FT                   ASSTVISRLAELDEHLDATDLLEELSDAVRDANRRLRDMAMENSSLDGMGTTVTAMLSS
FT                   GEHLGLLHVGDSRAYLLRDGVLTQITHDHTLVQDLVDQGRITPEQANTHPQRSLLMRAL
FT                   DGREVEPDVSMRQAVDGDRYLLCTDGLSGVVSEETILEALLLPAPQDVVDRLVELALKG
FT                   GGPDNITVVVADVIDDDLDDDAPLVAGAAAEKRVVPGAAAARTGPNPRNTDSESAAAKA
FT                   ARIGRPGFHRRGSGDRHDDPDDDPERGTAHGGRRRLFMSTVVLVLVVAGAAAGWTYVRG
FT                   QYYVGVDDDHVAVFQGLKGSIAGISLSTVRSRHQLLSEVNEPFQDTVRQGIEADDLSEA
FT                   QRIAADLPTASPAASTTDTAPTTSPTRAPDAKTSRSDPLPTVDPTCLGAVTGAAPPPGC
FT                   PGVGVTPSP"
FT   gene            complement(167892..168431)
FT                   /locus_tag="Franean1_0139"
FT   CDS_pept        complement(167892..168431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0139"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   fal:FRAAL6750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09606"
FT                   /db_xref="GOA:A8LCG7"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG7"
FT                   /protein_id="ABW09606.1"
FT                   /translation="MDPTAPSELVLLLVKIGFLALLWGFVLVAVRAVRLDMFGPTKRQQ
FT                   RRQPVVARAPSPTPGGRPERVRSPRQSPRPAPAPPINPAPSRLVVTKGHLAGTTIPLGP
FT                   EAITIGRAPDSTLVLEDDFASGRHARLVPHDGQWFVEDLGSTNGTFLNRTKVTSPMPVP
FT                   LGAPVRIGKTVLELHR"
FT   gene            complement(168435..170036)
FT                   /locus_tag="Franean1_0140"
FT   CDS_pept        complement(168435..170036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0140"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   fal:FRAAL6749 hypothetical protein; putative FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09607"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG8"
FT                   /protein_id="ABW09607.1"
FT                   /translation="MGVLQRFERRLGGLVEGAFAKVFKGGVEPVEIASALARETDDRRA
FT                   SSSNRVLVPNEFAVELAGGDFARLAPYTRALCDELAEMVREHAAEQRYTFVGPVTVRLA
FT                   EAADLDIGVFRIRSSVASADPAVVGGRRPRPRPAAPGTPHLLITTRAPGGSGSGEREYP
FT                   LDAETTVIGRSVECDIRLNDTGVSRRHGEIRRLPDGQFLYVDAGSTNGSLVNGRAATQV
FT                   KLVNGDRIELGTAVVEFRREEARGATGPRGPRTPVPARSSPPPGRPTPPPADHRTPPPF
FT                   DPRQPTPSTRRGTPSPDDRYARPEPGVPGGPGGREPGYRDRPGRDPRDGDYREGPSPRF
FT                   RDDPPGRPAGDHRPDAYREGPSPRFRDEPGAPPDGYREGPSARFRDEPPARPPAGPRSD
FT                   GYREGPSPRFRDDGAPARGRPGPTPPPNARQGGERGDGGRRAPGPGRGPEYGRAGRPDP
FT                   GRGHRGEPPRAGARGAGGPADEMYRSSTDPRQRPPARTDDGLEALEPLDGFDDAETRLP
FT                   SRAANHPGDDRRRRGW"
FT   gene            170197..170282
FT                   /locus_tag="Franean1_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            170197..170282
FT                   /locus_tag="Franean1_R0003"
FT                   /product="tRNA-Leu"
FT   gene            171011..171343
FT                   /locus_tag="Franean1_0141"
FT   CDS_pept        171011..171343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0141"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09608"
FT                   /db_xref="GOA:A8LCG9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCG9"
FT                   /protein_id="ABW09608.1"
FT                   /translation="MGIGAGVFLMALGAVLTFAVDVTISGLDIAVVGIILMLAGAVGLV
FT                   LELAVFAPRRRRALVTRSNVDVYPEAGAYEEPSTQALRVHRRTTRQVDVPADYDVDGRA
FT                   GYPPVR"
FT   sig_peptide     171011..171070
FT                   /locus_tag="Franean1_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.987 at
FT                   residue 20"
FT   gene            complement(171414..172289)
FT                   /locus_tag="Franean1_0142"
FT   CDS_pept        complement(171414..172289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09609"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH0"
FT                   /protein_id="ABW09609.1"
FT                   /translation="MGESTAGAGPTSATGARRRRGTGRDRAGLGGAGRGAGRGAGRGRL
FT                   VRAAGALCAVAIILLVGGCDEVLDATAGDPTAAPAPAPGGGGVSGAGAPPGAGSALQVL
FT                   GTLPIRAEDNSPPYKRNEFGTAWSDVDHNGCDTRNDILHRDLRSITTRSNDDCIVLTGE
FT                   LRDPYTTRIIRFDRGRNSSAVQIDHVIPLADAWRTGALEWTAKERLGFANDPENLLAVD
FT                   GPTNQQKSDQDASEWLPPSPGIRCAYIARQVGLKARYGLWVEQAEADAMRQVLQSCPQQ
FT                   PPLGMAAASG"
FT   gene            172402..173202
FT                   /locus_tag="Franean1_0143"
FT   CDS_pept        172402..173202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0143"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL6746
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09610"
FT                   /db_xref="GOA:A8LCH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH1"
FT                   /protein_id="ABW09610.1"
FT                   /translation="MPGPVSWAPGNGRMGRPRAEPVFSRRAGAETAPARHLSSIPVPPG
FT                   PARARPVSRPPGSPRPLRCDAERNRERVLVAARELFVEQGLDVGVDEIVKRAGVGMGTL
FT                   YRRFPNKDALIEAILGTVVDHLRSIAEDVLATEPPTVALRSFFVRSITTEVCQWAFLSS
FT                   RLWRGRTNELLFADVVPLIGEMFTQAQQAGAVRPDVVLSDLIVLVRSMRVVLDLTDGFA
FT                   PEVWRRHLDLLLDGLRPCSGNAVLDVGPMPFDALAISAAARPLV"
FT   gene            complement(173237..175087)
FT                   /locus_tag="Franean1_0144"
FT   CDS_pept        complement(173237..175087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0144"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL6745 putative serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09611"
FT                   /db_xref="GOA:A8LCH2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH2"
FT                   /protein_id="ABW09611.1"
FT                   /translation="MDHNGERVAPAARGQPGGMAPPGEVLHPHEPRAIGPYRLLRRLGA
FT                   GGMGTVYLAESAGRRVAVKVVRPDLAADEEFRRRFRQEVDAARRVAPFCTAEVLDADPD
FT                   AAAPYLVTEFIDGVRLDHAVENGPISGSTLTGLAVGVATALTAIHGSGLVHRDLKPSNV
FT                   LLSMSGPRVIDFGIAQALEGAKAKPTAWGFGSAGWMAPEQVNGQAIGPEADVFTWGILV
FT                   AYAGTGHHPFGTGTDLELSTRIVGSRPALDGLPHDLKALVAAALAKNPDDRPNARDLLL
FT                   SLISLPPTRSGDGRDDGTGRPSASAVGQAEELLNLTRGTTLPGLAPTRVAPGTSGERAP
FT                   ASHGGPPGHGGGAGPSGVAVPAPAGAPAFSGAPGAARGPAPGGGPAGFGPSGFRPAGAG
FT                   AAPHPPTHGPNPPVQGPRPPGQGPYPPVPSGTSQPRSTWHRVLLFGAAALAVVLAAWLI
FT                   SSVAGGSDDPGAVSGAGDRPAASQQPTTPRSGGLNTPVRDDQLEFTASKISCGADHVGD
FT                   GFLARRPSGQFCLVDMKITNVGTAERVLSNSNQYLHTSDGGRHAADFLARYWINDGIWD
FT                   TISPGATVTGTFVFDIPVDAEAEELELHERPESPGVTIQP"
FT   gene            175224..175487
FT                   /locus_tag="Franean1_0145"
FT   CDS_pept        175224..175487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6744 hypothetical protein; putative
FT                   zinc beta-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09612"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH3"
FT                   /protein_id="ABW09612.1"
FT                   /translation="MSSVSESSIPERAALRCTPDQSASRHPRTGAPLMTETAGPWLACP
FT                   WCGGQVPLAHLVPSDEEPGAVVAVCAGCGRRVTIIPPDDPRA"
FT   gene            complement(175504..175902)
FT                   /locus_tag="Franean1_0146"
FT   CDS_pept        complement(175504..175902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0146"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: fal:FRAAL6743 CspB"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09613"
FT                   /db_xref="GOA:A8LCH4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH4"
FT                   /protein_id="ABW09613.1"
FT                   /translation="MPTGKVKWFDVDRGFGFLSRDDGDADVFVHKAALPSGVDRLKPGD
FT                   RVEFGIAAGRKGDQALSLRILSAPPSVAKAAANASRRSPDELHSMVEDMIKVLDDVQRD
FT                   LRRGRYPDRRAAQKVAKVVHAVANELER"
FT   gene            complement(176507..177967)
FT                   /locus_tag="Franean1_0147"
FT   CDS_pept        complement(176507..177967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0147"
FT                   /product="ExsB family protein"
FT                   /note="PFAM: ExsB family protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: nca:Noca_3933 haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09614"
FT                   /db_xref="GOA:A8LCH5"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH5"
FT                   /protein_id="ABW09614.1"
FT                   /translation="MSPWRTSTLVVGFDLDMTLLDARRGIVATFAELAAETGVTIDGEA
FT                   AVRRLGPPLEDEIARWFPADEVARRAARYRELYAVHAVPVSVAMPHAAEAVEAVRSAGG
FT                   RVVVVTAKSEPLARASLEHIGITADHVAGWLFAETKGAAIEEHGVDVFVGDHVGDVHGA
FT                   RAGGAASVAVPTGPCPPDDLTAAGADVVLPDLAAFPAWLADEVLRRRLDTLSARLGELG
FT                   SVLVAFSGGADSAFLLAAAARELGPDAVVAATAVSASLPAAELDAARRFATGLGVRHLF
FT                   PATDEMSHEGYRANSSNRCYFCKSELVDTLAPLAAELGLAHVVTGTNADDARAGFRPGI
FT                   GAAASRGARTPLLDAGLTKAQVRAASRTWGLPTWDKPAAACLASRIAYGVRVSPARLAR
FT                   VERAETALRVATAAAGLHIRDLRVRDLGDVARIEVDADHVAGLVARPDLVSVVVESGFA
FT                   RAEVDPRGFRSGSMNELLPAPGRQTEPA"
FT   gene            178026..178289
FT                   /locus_tag="Franean1_0148"
FT   CDS_pept        178026..178289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0148"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: fal:FRAAL6738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09615"
FT                   /db_xref="GOA:A8LCH6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH6"
FT                   /protein_id="ABW09615.1"
FT                   /translation="MTRVVVDVMLKPEILDPQGQAVLTALPRLGVAGISGVRQGKRFEL
FT                   DLDGEADAEALARIEHLASTLLANPVIEDYVVRVEPARVEAD"
FT   gene            complement(178340..178690)
FT                   /locus_tag="Franean1_0149"
FT   CDS_pept        complement(178340..178690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0149"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: fal:FRAAL6737
FT                   putative metallo-beta-lactamase; rhodanese-like domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09616"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH7"
FT                   /protein_id="ABW09616.1"
FT                   /translation="MSPQQIPTVNVTELPVHLPAEGGPLLVDVREPDEWAAGHIDGAVH
FT                   IPMGDFLARISEVPREREIVVVCRSGSRSAAVTAHLAREGWQARNLVDGMIGWQAAGRP
FT                   MISETPLAPTVL"
FT   gene            complement(178809..178889)
FT                   /locus_tag="Franean1_0150"
FT   CDS_pept        complement(178809..178889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0150"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /note="KEGG: fal:FRAAL6736 formamidopyrimidine-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09617"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH8"
FT                   /protein_id="ABW09617.1"
FT                   /translation="MHGQAGLPCPRCGDTVREVSFADRSL"
FT   gene            complement(178948..179829)
FT                   /locus_tag="Franean1_0151"
FT   CDS_pept        complement(178948..179829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0151"
FT                   /product="protein of unknown function DUF191"
FT                   /note="PFAM: protein of unknown function DUF191; KEGG:
FT                   fal:FRAAL6735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09618"
FT                   /db_xref="GOA:A8LCH9"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCH9"
FT                   /protein_id="ABW09618.1"
FT                   /translation="MSTPPIGSEGGAPAPDQLTLAISPCPNDTFAFHALIHGLVPGAPA
FT                   VSTTFADIDVLNARAADGRDDLVKVSYAALPWLLDRYSLLTAGGALGRGCGPLVLTAGR
FT                   TDLRDASVAIPGTRTTAYLLFRLWAEQLGIGSINVVPFDRIMPAVRDGQYDAGLVIHES
FT                   RFTYPSYGLTAVADLGDWWEGRTGLPIPLGAIVARRGLDTAALSAAVRASVAAAFADRA
FT                   ASATFVIEHAQEMAPEVANAHIELYVNDFTLDLGDEGLAAVQELLGRAAAAGLVPELPA
FT                   GALTATALATGA"
FT   gene            complement(179868..180809)
FT                   /locus_tag="Franean1_0152"
FT   CDS_pept        complement(179868..180809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6734 conserved hypothetical protein;
FT                   putative purine and uridine phosphorylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09619"
FT                   /db_xref="GOA:A8LCI0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI0"
FT                   /protein_id="ABW09619.1"
FT                   /translation="MTRTLIVTAVNAEADAVCAGLMGSWSRGRSRTPSGPGGLVSPDWD
FT                   RQLLTTSTLGPYVGRRRGPVTVLAAGPAGPASAAGTAVALAVASAAGEPFGLVISMGIA
FT                   GGFRGWAEVGDLVIADRMVAADLGAESGLDEPAEPAAPVRINEMDRNLGFHPAGAPPYQ
FT                   PGPPPGPVAAGAFLTMDDLGLGSSTLQPDADLVRRLTTVLDITGRRIVSGTVLTVSTVT
FT                   GTERRAAALTARLDPVAEAMEGYAVGIAAGAFGVPVTEIRAVSNPVGRRDRAAWNTQAA
FT                   LGSLRTAAAALVAHPEGLVPAPRAEKESGPTG"
FT   gene            complement(181053..182849)
FT                   /locus_tag="Franean1_0153"
FT   CDS_pept        complement(181053..182849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0153"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fal:FRAAL6732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09620"
FT                   /db_xref="GOA:A8LCI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI1"
FT                   /protein_id="ABW09620.1"
FT                   /translation="MKPGSTLTEGLSRLRATIRRDGAQQSGLSSLTELSFVNAAGDALV
FT                   TVALAGSLFFAVPTGEARSKVALYLLITMVPFALLAPVVGPLLDRVAYGRRTALAAICL
FT                   GRCLLAWQLAGALDGLAVYPLALGLLVLSRAFGVARSAVVPRVTPPEMTLVKVNSRISL
FT                   VNIVAGAVVAPLGLGLANIPFVGYPWVLRVCALIYMAGVLLAFNLPGHVDSAAGERTLR
FT                   ELTGPRRRGNLRTRFAAALGALPVALRATLVLRGLVGFLTFYLAFLLRTNGGNNLWLGA
FT                   LAATAGFGSGIGVLIGGRLGRRRPEGILMLGLLLAASGCLVAAVTYTRFTSLVAALLAM
FT                   TAGSMAKLALDAIIQRDIVEDTRGSAFARSETALQLGWVTGGAFGLIEMPGTLGFALAA
FT                   AAVGLALVLQSRALREARRQARERHRPTARETTGAKPPWPGPQAPAQPSAPVADTVPAP
FT                   AGYATTGYATTDRAVADPTATDPTAVGPPPVSPAGAGAVPTGSMNGWYAPDPRADVPVS
FT                   WRGPAGGGQRAGGDPDATNPLGHPPVPGPAAAEGPGGAYGPAPQLHHAYQQPTPAVPRT
FT                   LEDPDPPNGSARRGRWRRDRPR"
FT   gene            182932..184167
FT                   /locus_tag="Franean1_0154"
FT   CDS_pept        182932..184167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09621"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI2"
FT                   /protein_id="ABW09621.1"
FT                   /translation="MEALEVRSESAGARGSRGSSDGAGVPPAGTATDHSEATAPSPADE
FT                   KPRRPVRRSSRRTRAAAAEPTPPTPPDASASATDALGDPPAGGPADASVGVPAGAVSGH
FT                   ESAVPGTSEPETPEPAARARIARTGRLLREPVLDAVCAGAVDLARAAAEEEAGSPAEVG
FT                   RHLGVEAEAERLVLHRFECLSRAYVGWTWTVVVARASRIRKATVNDVILTPGEGAVLAP
FT                   AWVPWSERLRPGDVGVGDLLPTAVDDPRLALRASDAEEIDDPEAWMGLGIGRPRMLSTF
FT                   GREEAAERWYGGDSGPDASIAKVAPAACLTCGFHVRLVGALGRLFGVCANELAPDDGRV
FT                   TAVDHGCGAHSEALVAPSARPEPVPFDEDPSDLTPTDIELVGVATHSPGSVPDQPPGTA
FT                   DADAGPEPYGHS"
FT   gene            complement(184343..186652)
FT                   /locus_tag="Franean1_0155"
FT   CDS_pept        complement(184343..186652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0155"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: fal:FRAAL6730
FT                   phosphoribosylformylglycinamidine synthase II (FGAM
FT                   synthase II); TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09622"
FT                   /db_xref="GOA:A8LCI3"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LCI3"
FT                   /protein_id="ABW09622.1"
FT                   /translation="MTGTPSAPTTSPDDQADGPGEGTVDRQPYRELGLTDDEYERIVAT
FT                   LGRVPTDAELAMYSVMWSEHCSYKSSKVHLRQFRDTPATDRLLVGMGENAGVVDVGEGL
FT                   AVTFKVESHNHPSFVEPYQGAATGVGGIVRDILTMGARPIGILDPLRFGAADAPDTARV
FT                   LPGVVAGIGGYGNCLGLPTIGGEVVFDPVYGGNPLVNALCVGVMPVGRVQTSAATGVGN
FT                   AVVLLGAKTGRDGIGGVSVLASATFDEGGGPARRPSVQVGDPFTEKILIECCLELFDRG
FT                   LVTGIQDLGGAGLTCALTETTAAGIATGQPGGMEVDLDLVPLREASMAAHEVLASESQE
FT                   RMLAIVTPDALPEVLALAERWGVIATNIGTVTDSGRLVVRWHGEVVVDVPPGSLADDGP
FT                   VYERPLRRPADLDLLRADAPSALERPRTGDALRATLLRMIASPNLCSRAWVTEQYDRYV
FT                   QANTVLAQPEDAGVLRLSASGLGIALATDGNGRYARLDPFAGAQLALAEACRNVTAAGA
FT                   EPIAVTNCLNFGSPEDPEVMWQFAQACAGLADACRRLGLPVTGGNVSFYNQTGSAPIHP
FT                   TPVVGVLGLFDDVTRRTPIGFTDEGDALLLLGDTRDEFGGSEWAWATHGHLGGTPPAVD
FT                   LEREKLLGEILVGGSREGLLTAAHDLSEGGLAQALVESCLRGGHGARIELPAGADAFVE
FT                   LFSESAGRAVVAVPAAEQDRFARLCADRGLPCRQIGVVTDGEGGSLNVAGEFAIPLDEL
FT                   RAAHEGTLPRLFGRGA"
FT   gene            complement(186804..187838)
FT                   /locus_tag="Franean1_0156"
FT   CDS_pept        complement(186804..187838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0156"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: fal:FRAAL6729 putative
FT                   amino acid ABC transporter amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09623"
FT                   /db_xref="GOA:A8LCI4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI4"
FT                   /protein_id="ABW09623.1"
FT                   /translation="MGSANVSEPTSVAAEAGQAVHRRTRRTRRIRPCPRRAGRRRVGAA
FT                   AAAMLALALTTAACGDGSGGASLGSLTVADAGFTESKILADMYGELLTNAGYKVERTSV
FT                   QSTEIAQSSLESGQIDAMPQYVATYADLLNSQVNGSGATSVSSSDLNASLAGLRRLAKG
FT                   LGLSVLEPADAVDQNAFAVSRSFAAEHHLTTLTDLGASGLTVKLAAGAECATRPFCQPG
FT                   LEKTYGIKISEIVETGVATAQTKAAVRDNTAQLGLVLTTDATVNGYNLVVLTDDKKLQN
FT                   ADNLVPIVNTDSLAPEITSALNALAPVLTTADLAELNKRVDAEREKSEEVAHDFLAEKG
FT                   LLDS"
FT   gene            complement(187820..188188)
FT                   /locus_tag="Franean1_0157"
FT   CDS_pept        complement(187820..188188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0157"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   systems permease component-like protein"
FT                   /note="KEGG: fal:FRAAL6728 putative ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09624"
FT                   /db_xref="GOA:A8LCI5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI5"
FT                   /protein_id="ABW09624.1"
FT                   /translation="MDGVSTPTGVSGWQILRDVELPLAAPMIIIGLRLAAVQVVGTATI
FT                   ATLIGGGGLGRFVVDGLAHADVRQVAVGRGSPSCGRPGDNGRSGLHWQLVARQGDPGRG
FT                   RAARQRQRRQDEGWGRRT"
FT   gene            complement(188268..188987)
FT                   /locus_tag="Franean1_0158"
FT   CDS_pept        complement(188268..188987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0158"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: fal:FRAAL6724
FT                   phosphoribosylformylglycinamidine synthase I (FGAM synthase
FT                   I); TIGRFAM: phosphoribosylformylglycinamidine synthase I;
FT                   PFAM: CobB/CobQ domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09625"
FT                   /db_xref="GOA:A8LCI6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI6"
FT                   /protein_id="ABW09625.1"
FT                   /translation="MVGAAAGGGGAARAPRVGVVTFPGSLDDRDAAAAVRLAGAEPVPL
FT                   WHGDDELSGVDAVVFPGGFSYGDYLRAGAIARFSPVVGAVVEAARAGLPVLGICNGFQV
FT                   LCEAGLLPGALTRNAGLHFVCRDQRLRVATTSTAWTSAYSPGEEIVVPVKHGEGRYVAD
FT                   AATLAQLAAQDRVVVRYVGGNPNGSVDDIAGVCSENRRVVGLMPHPEHAVEELTGPGTD
FT                   GLRMFTSVLGALLRPAA"
FT   gene            complement(189121..189825)
FT                   /locus_tag="Franean1_0159"
FT   CDS_pept        complement(189121..189825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0159"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: fal:FRAAL6723 hypothetical protein; putative
FT                   ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09626"
FT                   /db_xref="GOA:A8LCI7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI7"
FT                   /protein_id="ABW09626.1"
FT                   /translation="MEIKLSLSLPRDEISIPIVRRICTQALKVLGVSQECIDDVELALT
FT                   EACANVLLHATADDEYEVSVGVDNQVAAIEVVDHGGGFDALAAFDSSGIPVREDADVAF
FT                   HNGVDPDEANPGDANPDGAVSRTGAWVARTNPGQPRQDQSNPDQPYSDQQWLEQVPTDA
FT                   VPEQGRGIFLMRALMDHVQFHTVDGPHPGTRVHLEKLLTWDESAPGAQLGQVRSSRGPW
FT                   SGQPRDPAPDGA"
FT   gene            complement(189925..190884)
FT                   /locus_tag="Franean1_0160"
FT   CDS_pept        complement(189925..190884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6721 hypothetical protein; putative
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09627"
FT                   /db_xref="GOA:A8LCI8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI8"
FT                   /protein_id="ABW09627.1"
FT                   /translation="MAKVIVAGGGIAGVACARELRARGISVEVRDRGRVIGGRMASRWI
FT                   DGRIVDAGASYFTARSPEFLEVVDDWLIRGLVRPWTHRFPVIDGPSATLSEPVPGPLRY
FT                   AAPHGIRSLVADLATRGGLRVSQSSPIGMVRPGPVVDGEPVDAVVLAMPDPQALRHLDP
FT                   DLDTERTELIGRRWSPALALLAGWEARGWPPLDGAFVHGDPTVVWIADDGRRRGDNAPV
FT                   LVAHSTAEFAAGRLTDPRAAAGDLTAALRRLLGIPTDPVWTYVQRWTFARPEQPRERTY
FT                   FLGQARVGLAGDGWGEPRVESAWRSGTELARAIAEAVG"
FT   gene            191566..192531
FT                   /locus_tag="Franean1_0161"
FT   CDS_pept        191566..192531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0161"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   fal:FRAAL6720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09628"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCI9"
FT                   /protein_id="ABW09628.1"
FT                   /translation="MPAVGPRQPCPCGSGRRYKACHGERRRAAPVLRPFAGRADEPDLV
FT                   ALREFVPSATAPLTLSAEHLTAHPGHADRRIILGTLLPQAAPAVVRDDGEILLAMQTLV
FT                   GGLDASADVAGALIAALEAKPGTVVDGGPASAPQAVERLPGGLADLPRLADLLDPAPLE
FT                   ITVHPGFTWWVPSSEDAEPSADVVATLDRANATVVPTTRLTSVPAAYWCSPGDRLHLRW
FT                   VLPLDADRTEEALLDALARLAAAGSLSVGEGSRFVGSFRADGLVVPVWDLAPGADADSC
FT                   EKPAAQLWTALRETLDDQRELTAQERRVRAGVVGRTLTLR"
FT   gene            192539..193717
FT                   /locus_tag="Franean1_0162"
FT   CDS_pept        192539..193717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0162"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; HI0933 family protein; FAD
FT                   dependent oxidoreductase; KEGG: fal:FRAAL6718 putative
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09629"
FT                   /db_xref="GOA:A8LCJ0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ0"
FT                   /protein_id="ABW09629.1"
FT                   /translation="MPPEPPSPVFDVVVLGAGPAGTSAARAAAEAGARVCVLERMAVPR
FT                   YKTCGGGLVGLSVDHAGIDLAPLVRSRVDVLTMTLDGRYPVTRCRKDGRPLLSMVMRSE
FT                   LDAALLDSAKAAGAEVRTGVHVTGLREEGTAEPGRGEVAVQVRSGPAVRARVVVGADGT
FT                   SGRAGTHVGVTCDQVDVGLEGEFEVPAPVAGEWSGRMLLDWGPVPGSYGWVFPKGDVLT
FT                   VGVIGAREHGPALRRYYDALVERLGLTAAPRLHDSGHLTRVRAAGSPLRRGRVLLAGDA
FT                   AGLLDPWTREGISFALRSGRLAGISAAAGAAGDPTALDRYPARIEGVFGPEIAAGRSVL
FT                   AVFTRRPALMHTMMTRVPGTFGLFGRIIEGRSTIARQLRRPGVAAAIAALGR"
FT   gene            complement(193839..196154)
FT                   /locus_tag="Franean1_0163"
FT   CDS_pept        complement(193839..196154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6717 conserved hypothetical protein;
FT                   putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09630"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ1"
FT                   /protein_id="ABW09630.1"
FT                   /translation="MSVVEVTGPHDAHRHDAHRHDARRHDAAASYGASTYDVSAVHSPP
FT                   PGGGPHGGAGQHGVAGQHGSPYGAHSREVRPQGWSVGGPDDAIEVGGPGGFDDPPPRAQ
FT                   RHHQAPVRPPAADPGRQIWTGDPPAPTAAPVDPWRDGAAPAPSYGRERPGSWQQARGDR
FT                   PAAPMPPVPPPTEAMRPPPPPTEAMSLGPATEAMPLPPPTGGLPLGSLPGPPAPGIDTW
FT                   PSIRPAFRDPTPPPPPAEQPPRPGHVIDGVATRTFDPIHDRFPPAPGIASRPGPTPVET
FT                   TGEYRPSTLYPAPPPPPGATGASPIPRTDPQTSGRVASWLRDPVGPPALPPARPQSAPP
FT                   ASPPGPAGTGPGLYRDDAPDQAGRGWGHGFHSGPAYGAGMPGAGIHGSEIHGSEIDSAG
FT                   INSAGMRGVDVRSAEMHAAEMHGIEMRHDPMPGDRVDADDVHDRSWPREQTWPPDEYGP
FT                   RGDPRYDDPRSGTGLPPAALLPASPDTASRGWRRLVYQVSAGALNPGPSPDEARYRRLL
FT                   ARIRTPLDDCHRIAVLSLKGGVGKTTTTVSLGSTLASLRGDRVVAIDANPDRGTLGVRV
FT                   ERTTRHTVRDLLADADQLHRYVDVRRYLSQSASRLEVLASASDPEISDAFADEDYRAVD
FT                   DLLQRHYSILLTDCGTGMLHSAMHGVLELADTLVIVSNASADGGASASATLDWLDAHGY
FT                   NDHVSEAVTVISMFPQQGETVDVDALEDHFASRTRQVVRVPFDPHLASGGHIVLDELRR
FT                   ETRRAYEEIAGAVAERFG"
FT   gene            complement(196564..197367)
FT                   /locus_tag="Franean1_0164"
FT   CDS_pept        complement(196564..197367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0164"
FT                   /product="circadian phase modifier CpmA"
FT                   /note="KEGG: nca:Noca_0169 circadian phase modifier CpmA"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09631"
FT                   /db_xref="GOA:A8LCJ2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ2"
FT                   /protein_id="ABW09631.1"
FT                   /translation="MDSERLRTLLKAVSSGQVDPEDAAAALIAGPLGGDGSGFTDLGYA
FT                   RVDTHRGIRTGDPEVVYGAGKTAAETVGIVETLRRASGVGTPTLVTRAGSATVAALRER
FT                   WPDARVSSSASASASGDERPATVVVGPLPEPRGRVVIVAAGTSDAPVAEEAAMTAEAAG
FT                   AGVEMVRDVGVAGLHRVLAARPVLDSADCLVVIAGMEGALPSVIGGLVGVPLVAVPTSV
FT                   GYGASFGGLAALLGMLTSCAPGIAVCNIDNGFGAGLFAARVARRA"
FT   gene            complement(197523..198464)
FT                   /locus_tag="Franean1_0165"
FT   CDS_pept        complement(197523..198464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0165"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   fal:FRAAL6715 hypothetical protein; putative protein
FT                   kinase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09632"
FT                   /db_xref="GOA:A8LCJ3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ3"
FT                   /protein_id="ABW09632.1"
FT                   /translation="MDPEPGVAGRFSAQRSRHALGRICSSVGLDDRDAEPIKLTVNAVY
FT                   RLPREAAVVRIASSTAMNHRVEKVVRVARWLAEHEMPAVRLFPGLSAPVTVDGHVATVW
FT                   VDAAPPTGAPAAPGGAGGAAGARDLAAILRRLHALPPPDPPLPVWDPLDDVRRRLSDAE
FT                   GLGVDDRRFLEDLALRVDEALATVRYALPRTVVHGDAHLGNLIRSATGEVVICDFDATC
FT                   QGPAEWDLVPVAVGALRFGRPPTPQLELARAYGFDVTAWEGFGVLRSVRELKLVTSVVP
FT                   ILASSPTAAAQFAVRVGSLRSGSDQTVWTPYR"
FT   gene            complement(198508..199860)
FT                   /locus_tag="Franean1_0166"
FT   CDS_pept        complement(198508..199860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09633"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ4"
FT                   /protein_id="ABW09633.1"
FT                   /translation="MPQSDGLPPLAAPAFDEIFIPPARTPPDDRPEDYPAEPPRRQAPE
FT                   DTAEHPELPRRLRAAAPPPPTPAPAGDIRSADEVSSAEEIRSAGEREVAGATADRRQFH
FT                   RCAGAAVVGALLAQSQIMEVADVLAASPVQLALERANEALGELVNTHEVVPPAHVRART
FT                   ARLRRGLERLGRRSMATEDSRRLLVLAGRVAVLGADAAFKQGDVASARQLTADGYAAGL
FT                   EAGDGPLCGSAREVGAVNEFYGGRPDEALRLARDGLRHVGSGPVRARLVCQEARALAAM
FT                   GDVRGAAGSLDHAYDLADAIPADRWGRPGPSFDTFHPVEVSYNATTALCLLGRPRAAQE
FT                   HAELALPKLDAMNAPGFRSVIRFDLALAMARQGRLELDGVCELATDAIGISWGRTVASV
FT                   SSRADQLLAATTPHGEVRQVRELAAFVREWQRSASGQRPDPGAVPAPTLDL"
FT   gene            200636..201874
FT                   /locus_tag="Franean1_0167"
FT   CDS_pept        200636..201874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0167"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6711 putative acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09634"
FT                   /db_xref="GOA:A8LCJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ5"
FT                   /protein_id="ABW09634.1"
FT                   /translation="MPLGVAVPPLIVAPGRAGGPMMPSASAVVPFGGAGSVASSSWSKC
FT                   PRGGPEVCRRARPVSPATRKREPVARRARRGGCASGGPVTADPASVAGGDALVAPKRVL
FT                   PPEDVELARELEEVAHRAWPPLREWTHGGWVLRESAGSSRRGNSVWARGDVPDLAAALR
FT                   AVHSFYTAAGLPPTFQITPVARPAGLLDALDAAGYDDGGPTDVCVAPLAALRAPRPDAA
FT                   EHRPGPAGGPGADRRVESAAADLPDERWLAVAGDVLATFAGQRVGTLAVVRAMALPQRY
FT                   VTVFVDGRPVGVGRGVLDGSWLGIYSMATLPAARGVGVAGRTLAELAHWAGARGAERAY
FT                   LQVERHSVVARGLYARRGFRPVYGYSYRRLPAPSGLQRSAVAPRVATENVASENVASAW
FT                   PAAGRAGGGTASR"
FT   gene            201871..202785
FT                   /locus_tag="Franean1_0168"
FT   CDS_pept        201871..202785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0168"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: fal:FRAAL6710 7,8-dihydropteroate synthase
FT                   (partial match); TIGRFAM: dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09635"
FT                   /db_xref="GOA:A8LCJ6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ6"
FT                   /protein_id="ABW09635.1"
FT                   /translation="MTGPRDDLFAPDAPTRVMGVVNVTPDSFSDGGAYPDPHDAVRAAQ
FT                   LMIEQGADVIDVGGESTRPGAPRVVASEELRRVLPVVAQLASAGVPVSVDTSRASVASA
FT                   AVDAGALLVNDVSCGRNAELLRIVADRGVHYVLMHSRGSSTDMAAHAVYNDVVTDVVGE
FT                   LAARLDVVLAAGVAEDKVIIDPGIGFAKTPAHNWALLANLGAVASLGRPLLVGTSRKSF
FT                   LGAAVSGPGELPRPADERDDATQATTALLADAGVWAVRVHAVRPAVDAVRVVRAWQQAA
FT                   RASGAGRPRAAVSGSAPAAGPSR"
FT   gene            202782..203795
FT                   /locus_tag="Franean1_0169"
FT   CDS_pept        202782..203795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0169"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; dihydroneopterin aldolase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   KEGG: ace:Acel_0208
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09636"
FT                   /db_xref="GOA:A8LCJ7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ7"
FT                   /protein_id="ABW09636.1"
FT                   /translation="MTAPAGGVPTGGVAADAARLDRIALTGLRVHGRHGVLPAERELGQ
FT                   FFVVDATLWLDTGPAAATDDLTLTVHYGELAQALADIVAGEPVELIETLAHRLVRACLA
FT                   ADPRVAAAEVTVHKPAAPITVAFTDIAVTVARSRDAAVTTGPSREVAATCSRDVAAAAG
FT                   PSAAGASASAGHAVVAIGSNIGDRLAHLRGAVRDLDARLGVLAVSAVYETEPVGGPEQD
FT                   DYLNAIVLVGAAPPRDLLAAARAAERTAARERTIRWGPRTLDVDIIACGDTRSDDPEIL
FT                   LPHPRAHERLFVCVPWLDVEPDAMLPGHGRVADLVARLSVVPGAAALRRTPHGLGR"
FT   gene            203792..204229
FT                   /locus_tag="Franean1_0170"
FT   CDS_pept        203792..204229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6707 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09637"
FT                   /db_xref="GOA:A8LCJ8"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ8"
FT                   /protein_id="ABW09637.1"
FT                   /translation="MRPTHIRDLLAIAVAVGAVVYALLWWSYQSLPQLPATASVSVLLV
FT                   GLIELQTASLTRRRLAGRPGTRPILPLTVARLAALAKATSVVAAVLAGGWTALLAYTAP
FT                   RTDEFGTAGGDALAAGLGLSATVVLLAGGLVLERVCRIRDR"
FT   sig_peptide     203792..203860
FT                   /locus_tag="Franean1_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.403 at
FT                   residue 23"
FT   gene            204568..205695
FT                   /locus_tag="Franean1_0171"
FT   CDS_pept        204568..205695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09638"
FT                   /db_xref="GOA:A8LCJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCJ9"
FT                   /protein_id="ABW09638.1"
FT                   /translation="MVAQGRGSPAEPGAGRAGAGGGTDHVPFEDDQRPGAGRSGGAASG
FT                   PRQSVGVGRPRQAGARLVTFGNLRTSGPGTDPGAAPPPVPLQPAAPSSPRFSPDGFPSG
FT                   YGPPADGPPADGPPSHGPVGYGPPVYGSPGAGRTGGAPSGFDPADMVTAPATDGPVRSA
FT                   PAGPRSVRPQPPGPRRDRTPPPFSPGVDDDELTTRPSVGRPPGPARPSGLEHARAAGPA
FT                   PVRAAGPGPVRATGPGPVRAAGLEPRRAAGLEPVSTTGYQERVADHPPDGYSVPGAGYR
FT                   GVPDEGYRRPGELHELPRRFDHDPDEAPAPAPRRRRNPVLTLVKIVLVGAMIVIGVSVG
FT                   RALALPGDQGSLSRMADWARDNHLSVVVDQVDRLR"
FT   gene            205839..208469
FT                   /locus_tag="Franean1_0172"
FT   CDS_pept        205839..208469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09639"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK0"
FT                   /protein_id="ABW09639.1"
FT                   /translation="MSPSTGRVPGPPGTLAHWLRALPDDTLVRLFRLRPDLATPPPPDF
FT                   DILAARLEIRGSVSRALERLDTFTLEVVQALTLLPSPVSVAELTAFCGGLDLRAALESL
FT                   RERLVVWGPDEALRLVGVAFDLLGERPLGLGRPVRACLAGYRQAQLARVAAAVGLPDAV
FT                   SDGLSASSGGLGDSDDSDLDLDLDSEFHLGAGSHPVRRESMIEMVSAAFADPHRVAALL
FT                   DGCSARARRLAERLAAGPALGATSDAERLLSVSSARSPVEELLARGLLIGIEPGTVELP
FT                   REVGLVLRGADQAGPLHPEPPEVTGREVGAGAVDPAAALAADALVRAVTTLLTAWGSTP
FT                   VTPLRTGGLSVRDLKNSARLMDVPETEAAVVIEAAAAAGLVDLTPGTDVQFVPTNVYDR
FT                   WCTETVAMRWAVLAEGWLRSPSAAWLVGGRDERGRQIAAMSLDARRPGAPDLRADVLRV
FT                   VAAAPEGFAPTPESVRARLAWRSPRRTGPLLDGMIGGTLTEAEVVGFTGRGAPSTLGQL
FT                   VARRLAAAEADDPGRGSGRSPAADEGLCRLLADAMAPLLPEPVEELLIQTDLTAVAPGP
FT                   LVPRVAAELSRMADIESAGAATVYRFTESSLRRAMDAGSSADDLHDLLGHLARGGVPQS
FT                   LTYLIDDTARRHGRLRSGPAASYLRCDDTALLTEVVASRRTQALAMRRVAPTIVISPLP
FT                   VSDLLEGLRAAGFAPVAEAPDGRIVLARPEVHRTPARARPPAAESVPTRSNQLRDVVRL
FT                   VRRGDDSTRAARAAQDAAGAQLGLARSAPVILVMLQGAVRDRRRVLLGYVNQQGTPSDR
FT                   VVRPTLLEGGWLTAWDERSEAPRRFALHRVTGVADIDDPFGGPPVPDTGDWVVPPAADD
FT                   LPGPR"
FT   gene            208620..210257
FT                   /locus_tag="Franean1_0173"
FT   CDS_pept        208620..210257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0173"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: fal:FRAAL6703
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09640"
FT                   /db_xref="GOA:A8LCK1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK1"
FT                   /protein_id="ABW09640.1"
FT                   /translation="MPDGPLIVQSDKTLLLEVDHPLAPEARASIAPFAELERSPEHVHT
FT                   YRVTPLALWNARAAGHDAEQVVDALVRYSRYAVPNALLVDVADTMDRYGRLRLENDPVH
FT                   GLVMRALDRAVLTEVTRAKRVAPMLGARVDDDTVIVHPSERGRLKQALLKVGWPAEDLA
FT                   GYVDGEKHEIVLREEGWSLRDYQKGAVAGFWEGGSGVVVLPSGAGKTVVGAAAMARAGA
FT                   TTLILVTNTVAGRQWRTELLRRTTLTEDEIGEYSGERKEIRPVTIATYQVMTARRKGEY
FT                   LHLELFGARDWGLIVYDEVHLLPAPVFRMTADIQSRRRLGLTATLIREDGREGDVFSLI
FT                   GPKRYDAPWRDIEAQGWIAPAECTEVRVTLTDDERMTYAVAEPEERYKVCSTAHSKNLV
FT                   VRRLVERHADDRVLVIGAYLDQLDELGRLLDAPVIQGSTRNKERERLFEAFRTGEITTL
FT                   VVSKVANVSIDLPEAGVAIQVSGTFGSRQEEAQRLGRVLRPKADGRSAHFYTVVSRDTL
FT                   DQEYAAHRQRFLAEQGYAYTIVDADDVA"
FT   gene            complement(210311..210904)
FT                   /locus_tag="Franean1_0174"
FT   CDS_pept        complement(210311..210904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0174"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   fal:FRAAL6702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09641"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK2"
FT                   /protein_id="ABW09641.1"
FT                   /translation="MSTVVQAPTPLRSHRPTLTLPAPPVSVADLDATALEDARVEVLDG
FT                   LCVTRPWPTPLRARVTDRLRALLAQAATSGAQVFTGVQVELSPRCLLVPDVAVVAVGDP
FT                   DRRRITETPFGVVEVADASTRRYDRTLKLDVYREHGVPVCWLVDPDSATIEAFELVGRD
FT                   YVPAGIVCGDEELSVLRPFPVTVTPAELIDPPDD"
FT   gene            complement(211645..213267)
FT                   /locus_tag="Franean1_0175"
FT   CDS_pept        complement(211645..213267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0175"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: fal:FRAAL6701 chaperone HSP60 (GroEL),
FT                   part of GroE chaperone system"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09642"
FT                   /db_xref="GOA:A8LCK3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK3"
FT                   /protein_id="ABW09642.1"
FT                   /translation="MPKIIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGV
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTNDVAGDGTTTATILAQALVREGLR
FT                   NVAAGANPMGLKKGIEAAVERVSEELSSVAKDVETKEQIASTASISAGDPAIGSMIAEA
FT                   MDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISPYFVTDTDRMEAVLDDPYILIAN
FT                   SKISAVKDLLPILEKVMQAGKPLAIISEDVEGEALATLVVNKIRGTFKSTAVKAPGFGD
FT                   RRKAMLTDIAVLTGGQVISEDVGLKLEGTTVDLLGRARKVVITKDETTIVEGAGDADQI
FT                   AGRVNQIRNEIEKSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKEKKHRIEDAVS
FT                   NAKAAVEEGIVAGGGVALLQAATSAFEKLDLSGDEATGANIVRLALEAPIKQIAFNSGL
FT                   EGGVVVEKVRNLPTGHGLNAATGEYVDMVATGIIDPAKVTRSALQNAASIAGLFLTTEA
FT                   VIADKPEKDKAPAMPGGGGEMDF"
FT   gene            complement(213806..215083)
FT                   /locus_tag="Franean1_0176"
FT   CDS_pept        complement(213806..215083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0176"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: fal:FRAAL6700 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09643"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK4"
FT                   /protein_id="ABW09643.1"
FT                   /translation="MTLAPERATLPSPDAANPAVSLSCRHCGATYPLSATHVCVECFAP
FT                   LEIAYDEDRLRKVTRASIEAGPSNLWRYVGLLPAGHVAERRVSLDAGWTPLRPAQRLAA
FT                   ELGMRTLWVKDDSANPTHSFKDRVVSVALTAARELGFHTVACASTGNLAQSVAAHAASA
FT                   GLRSVVLVPHDLEAGKTVSTAVYGGTLVAIKGNYDDVNRLCSELAGEYEWAFVNVNVRP
FT                   FYAEGSKTLGYEVAEQLGWRIPGQVVVPIASGSLLTKVDKAFGELGRLGLVEPTPYKVF
FT                   GAQAAGCNPVAAAYARGADTVAPVKPSTIAKSLSIGNPADGPYALDVARRTGGAITDVT
FT                   DDEIVDGIRLLARTEGIFGETAGGVTVACLRRLLNEGLLDPDVETVIYNTGDGLKTLDP
FT                   LVSTGGPTATIPPSLSAFEAAGLGDD"
FT   gene            215413..216213
FT                   /locus_tag="Franean1_0177"
FT   CDS_pept        215413..216213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0177"
FT                   /product="Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /note="PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; KEGG: fal:FRAAL6699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09644"
FT                   /db_xref="GOA:A8LCK5"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK5"
FT                   /protein_id="ABW09644.1"
FT                   /translation="MSVRVVYTDLDGTMVGPRGCFFRAEGGDTTLDPARALVDLHDAGI
FT                   ALVLVSGRTRPQLVEAAGIFGADGFIGELGAIIGWNTGLDTEILRGAMPDSFERVPESL
FT                   LDELTKLHPGRLELHTPWHTGREVDVMLRGRIDVAEVDGWLAESGFGWLSMRDNGLISP
FT                   AHMPDLGVHPHVYHLVPDGVSKGDAVAHDLKRRGVDPAEAIAIGDSASDLAMARSVGRM
FT                   HLVANAVRHPDIAALLPAYDNVVVEDGPLGAGWATAVRAALGAG"
FT   gene            216282..217856
FT                   /locus_tag="Franean1_0178"
FT   CDS_pept        216282..217856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0178"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="PFAM: glycosyl transferase family 20; KEGG:
FT                   fal:FRAAL6698 trehalose-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09645"
FT                   /db_xref="GOA:A8LCK6"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK6"
FT                   /protein_id="ABW09645.1"
FT                   /translation="MAPRQGTRWPTLRCVRHMLGIGEFTAPGSEYPAQADLLIASNRGP
FT                   VSFVVGDDGLLHPRRGGGGLVSGLAQVVQDTPEDGREIVWVCAALSDADRRAARSAPGG
FT                   RIDRSGYDTGGASVRMLDLDRVLFDRAYNAVANRTLWFVLHLLHAPATEPSFGASFRKD
FT                   WAAYEAYNAAFADALAELAAPGACVLVQDYHLTLVPARLRQMRPDLRIAHFSHTPWSPP
FT                   EYFRMLPDDVSAAILHGMLGADRLGFLAPAWAAAFRDCCAEILGAEVVGDTVTAGGRTV
FT                   RTSLYPLGVDAAELRDRAARPDVRARAAELRELAGGCRLVVRVDRTELSKNIVRGLDAY
FT                   RELLRSHPEWHGRVMHLVCAYPSRHDLPEYREYTAAVQRLAAEIEDEFGTDTWLPVHLE
FT                   INDDFPRSLAAMTLADVLVVNPIRDGMNLVAKEGMVVSADGGVLVLSREAGACSQMGAD
FT                   AVVVNPFDVTATAEAMHTALVMPAAERRERARRLAAVAGELPPRAWFRAQLDEIRGHAP
FT                   AEPDRAG"
FT   gene            complement(217922..218809)
FT                   /locus_tag="Franean1_0179"
FT   CDS_pept        complement(217922..218809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0179"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase; KEGG: fal:FRAAL6697
FT                   trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09646"
FT                   /db_xref="GOA:A8LCK7"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK7"
FT                   /protein_id="ABW09646.1"
FT                   /translation="MTDSSAPSPPAPAGAHATAEPAPAPRTLAGGAGLAALLTTPDKAL
FT                   VALDYDGTLAPIVSRPSDAVPAPGAMAALGRISRRVGTVAIITGRPVDAVLELTGAERF
FT                   TDLGHLLVLGQYGLQRWDAETRQTTAPEPLPGVEALRSALPDALHDAPAGTSVEDKRHA
FT                   LVVHVRRTADPDAALAALTPALTRLAEEYGLEAAPGKRVLELRPPGHDKGRALRGLVAE
FT                   RAARSVLVAGDDYGDLPAFEAVDELRAGGLGAITVCSDSPEVPDVLRERADLVVSGPTG
FT                   MVTLLEVLADRLGA"
FT   gene            complement(218865..219521)
FT                   /locus_tag="Franean1_0180"
FT   CDS_pept        complement(218865..219521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6696 hypothetical protein; putative
FT                   secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09647"
FT                   /db_xref="GOA:A8LCK8"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK8"
FT                   /protein_id="ABW09647.1"
FT                   /translation="MPRGSHDFSRHPGGDRLRMAGAALVAVLAVLAGILLVNLFNGSGD
FT                   SDDGAAPAVTGEPAAPSGEPAQGVDRPEDSSSPTPSERATPSRSPSPTPGPRPSPTPQS
FT                   APAQPPAAPGTGAPKVFAPVVVLNNSRIAGLADSAANRVEAAGFRVERVGNYLGQYNVP
FT                   VSTVFYDPEDADAARTLLETVPGVERMVPRAETRIIETDTLILVVTRDFPTDDQP"
FT   gene            complement(219531..220196)
FT                   /locus_tag="Franean1_0181"
FT   CDS_pept        complement(219531..220196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09648"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCK9"
FT                   /protein_id="ABW09648.1"
FT                   /translation="MDAAHAEARRRSVPGPTSSPRPGRSGSADTGPGGRTGHTGPGGSG
FT                   PAGTRPAGSGPANSRPTNAGPVDHGPTGSRPADPGPAGSRPAGSRPTGSGPENSGPSQA
FT                   AAGGAAGGSATGGGEGGSGENGRGANGLTEREARVLAFESQWWRYPGAKEAAIRAEFGL
FT                   SSTRYYQILNVLIDSPAALAADPMLVRRLRRLREQRRRARAGHVDDAGEPGDDGSDDA"
FT   gene            220454..220909
FT                   /locus_tag="Franean1_0182"
FT   CDS_pept        220454..220909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09649"
FT                   /db_xref="InterPro:IPR024439"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL0"
FT                   /protein_id="ABW09649.1"
FT                   /translation="MQPPEDGPGAARGADDGRRFARTPEDFACLVCGATVRGDGYTNHC
FT                   PACLWSRHVDVNPGDRAAPCRGLMRPVGVEMRARETVLTHRCESCGHLRRNRTSPADAE
FT                   SALFALAARVADEVSLRGPGDAGLRGGAAVRGTGRGSGAPRRRGRPR"
FT   gene            complement(220854..222110)
FT                   /locus_tag="Franean1_0183"
FT   CDS_pept        complement(220854..222110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0183"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   fal:FRAAL6693 glutamate dehydrogenase (GDH)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09650"
FT                   /db_xref="GOA:A8LCL1"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL1"
FT                   /protein_id="ABW09650.1"
FT                   /translation="MILGTGSAWDTACVQLADAAQHLGLDDGMHDLLRTPRRSITVSVP
FT                   LLRDDGQLLVLSGYRVQHNLARGPAKGGLRYHPACDLDEVKALAMWMTWKCALMGIPYG
FT                   GAKGGIAVEPGLLSRQERERMTRRYAAELVPLIGPDKDIPAPDVGTDEQTMAWIMDTYS
FT                   THTGHTAPGVVTGKPLSIGGSAGRAGATSRGVQLAAFAALRELGRDPRETTVAVQGFGK
FT                   VGALAAQYLHDAGCRLVAVSDVKGGIHNRAGLNPSALIRHLARGADTVVGYPGTDTITN
FT                   TELLELNVDMLVPAALEGVINTGNADRVRAPLIVEGANGPVTAEADHVLTGKGTVIVPD
FT                   ILANGGGVAVSYFEWVQDIQAYFWTEDQVNDRLRALMQRSYQEVSALARERRVSLRTAA
FT                   HIIGVARVAEAHRTRGLYP"
FT   gene            222282..224009
FT                   /locus_tag="Franean1_0184"
FT   CDS_pept        222282..224009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6692 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09651"
FT                   /db_xref="GOA:A8LCL2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL2"
FT                   /protein_id="ABW09651.1"
FT                   /translation="MATTVPRRHRARRRDRYLPGIVNSAGVAGPAGRARGPARWYAALR
FT                   GRPLIVRWVVSRAMLLTLALAGQVFGAQQSVLGDVDLYREWGHTLVGDGTVPGDEKWQY
FT                   PPGAAVVLALPAVPRELAGVPYEVSFYLLMLVVDAVLTRALARRSPAAARYWLLATLAL
FT                   GPVMLTRFDLVPAAAALAAVLALDGSAPGGAHGSGDAEPPDGAGRPGHSRRLRPFSSFG
FT                   ALGSLGRFGGWVVLGVAVKVWPGLLLVALGRRGLTRPGSPVLGRVARIVAGAGVTAAVL
FT                   AAILVLAGWWRGALGFLDAQSARGLQIEAVPATPFVVARMLGIGSAPEYSYGSLQFDGG
FT                   LARAVATACSLAEVIVIAAAVLWWWARRSPGRAVDASPRPGGDGSMDTEGTSSVAGRGL
FT                   ALVLLIVITSRVLSPQYLVWLLVLAAAVRPSTAGAERVRAESSDHSGSTGGRLGWSGWR
FT                   GRKVDAAGLLAVCAVLSQVVYPWRYNDVVQGRVVGGLLLVARNAVLVTAAWYALRAAAR
FT                   ESSGDGQSSGDGPPAQSPPTPLPPTPPPGQRRAAGRPGRAVARWRRAATASRGTAKPT"
FT   gene            complement(223795..225693)
FT                   /locus_tag="Franean1_0185"
FT   CDS_pept        complement(223795..225693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6691 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09652"
FT                   /db_xref="GOA:A8LCL3"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL3"
FT                   /protein_id="ABW09652.1"
FT                   /translation="MTTQGDPRAARRGAAVRADGPAELVGPSHPERHGRVDRGGGDRPA
FT                   WRLILAGAIAAALAMISEARLGPRDPEVADPSSWWGILPSGQPADTARGVLAATAGLAV
FT                   IGLCLSWLLLLARARRGTISPRAAGAAALAWAVPFAVGPPLFSRDVYAYAAQGELARHG
FT                   LDPATHGINSLLSREASGDLFIAAVDPRWRDTHAPYGGLGVGVERACAALGDLLGTGAA
FT                   GTVAALRVVALISTVLLVALALRLPGGPHRADQSGRSGRCRSGRTVAIVLALLAANPFV
FT                   IIHLVGGAHLDALAAALLVAALVIDRGRVAGHGRGTGRAPSWALGATAVAFACLAGSVK
FT                   ATAFLGTGWLVFVHVRDAWHSGPTAATGRPGRRAAAIGTALAADTVAAALALLVGMAAG
FT                   GFGPTWIGALATSGKLETGIAPASVFATLVDLAPRIVGLEWPGGSDAVLGATRALVLAA
FT                   VGLTVVWLALRTWPARATARLAARPAAQATRPITPDAVRPTGPEPGRRDDLVVVGFGGM
FT                   ALVLGSPVVYPWYLALSVPFLAALVALAPSPPGRQTRAAVGLIAVTSVWLCLATLSPLA
FT                   ATWRLLGRADPLLGAALVVVLAAVVSAATVPAVRRRTTVRRRTIPAPRPEARTRPR"
FT   gene            225735..227474
FT                   /locus_tag="Franean1_0186"
FT   CDS_pept        225735..227474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0186"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: fal:FRAAL6690 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09653"
FT                   /db_xref="GOA:A8LCL4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL4"
FT                   /protein_id="ABW09653.1"
FT                   /translation="MGLLATPEPPVGTTVDAPAASGIPRPGGTGRRHDSLAQTSCLAVG
FT                   PRRRNRLVEGAVTLGTAVRRRPWLLTAVLCLICVCLDVTGPDTPAQEYRVWLFEHGGAV
FT                   LWDDGWYGGHTIPGYSVLFPPLGALLGVQAVGALACVASTVAVTRLLRGPGVRRGQDLP
FT                   LLWFAVATVANLVVGRMPFALGMAFGAVALVGARERRVWLVWAGAVLSSLASPLAAGFV
FT                   LMVGLALALTGSLPRRVILAFGGAGAGIIVALAFPEEGYQPFPAVTFLSLLALIGGGLL
FT                   LVPKEHRAVRNGLLLWAGAAIVFFFVPTQVGGNITRPATLLAGPAAAVFLATRPRALAL
FT                   VAIPLIGWQIGPIHGAFVTHGDPSAAPGYYTDLLGYLDNGGPVPAGRVEIPFTQAHWEA
FT                   RYVAPKLPMARGWLRQLDSKYNALFYDGTLTAETYHEWLLARGVTYVALPNVDLDPSAV
FT                   AEAKLLRSGLPYLELAWQNADWKVWLVRDSPGLVRGPATLTELGVSSVAVSFASPGVAT
FT                   VLVHYTPYWQLTEGDACVFRAAGGWTGILTQSAGAVRLSARLSVDGLTRASALDCPADH
FT                   RLH"
FT   gene            complement(227518..229479)
FT                   /locus_tag="Franean1_0187"
FT   CDS_pept        complement(227518..229479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0187"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: fal:FRAAL6687
FT                   hypothetical protein; putative membrane protein; putative
FT                   potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09654"
FT                   /db_xref="GOA:A8LCL5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL5"
FT                   /protein_id="ABW09654.1"
FT                   /translation="MARAARLYATLLFGRMGRIGRWLRRHLLGTFLVLGLIALVLSLIG
FT                   SYQHFSAEPETFTWANVIFFASTLFLADGTMFENGGQFPPALEIARFLAPLATAVGVAD
FT                   AASTLFAHRFERFRARHAHRHVIVCGTGPTASALVDKLVGNSRVVLVAEDAEREYPDAE
FT                   RPPNLLRVIGDPVERLVLASAGIMRADVVYSCLDDTASNLAVALTARGVVRTSRAGSRR
FT                   ISSARLDHPLRCLAQVGDLSLLPHLRARRIGLENDPGFRLDFFAVEVLGAHAMLNGNAP
FT                   AWARPDEFPDLRARPAPVVVLGLSDLGQAVVMELARRWRDYSSPGSPPLRIVLSGRNAT
FT                   VEAAAMRSREPALARVELLANDSPSGELPVAVLELDDPVEGARTVPPEFVYVCHGDEEE
FT                   ALLRGLEVARTLGAASLGEHGTRVVVRTGRQRSFEDVFGPREAPDPDGPDDDPDAPVPP
FT                   PPGPGRRGGGALLDDVQGGLRFFAVNDEALPLDPGANDLIERFARIIHEKYLFKEMTGG
FT                   AVLRSRRSLRPWDELDDDLRAANLAQAIGYSDVLRRRNWMLMPAGEHDPEFVFTPEELE
FT                   ELAQAEHARWRRERESRGVRYGPVERGGSDPRHPSLVDWEQLSPADQDRDRDVVRNMPQ
FT                   VLATAGLRIVRMTPRPPD"
FT   gene            complement(229619..231301)
FT                   /locus_tag="Franean1_0188"
FT   CDS_pept        complement(229619..231301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0188"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; Protein
FT                   phosphatase 2C-like; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: fal:FRAAL6686 hypothetical protein; putative
FT                   serine/threonine phosphatase 2C, catalytic domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09655"
FT                   /db_xref="GOA:A8LCL6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL6"
FT                   /protein_id="ABW09655.1"
FT                   /translation="MGSSLVPIMLIVVLLVGAVVFVVLSSRAPRTGYGSGRKRSLETRR
FT                   SRPGSIPLRDAPEPPAPAAPDTRAPDPQSPDGVVPGFTAPASAPAAVEVAQAADGTSRG
FT                   TGGAADPGPDTGSAWSDGSAWGDSGWGDADATRIDSLRDPGHGPPGTAGSTANDTDTVA
FT                   SATESGGTGGHNIGGAYTSRADTGAAPADPSPAGAYFAGAAQPDGPHAGAHGTGGIDVS
FT                   GLDSGGRDTYMNDSRDPDATGWTPPPSGRPHHGETDDAAYRLAVDDRDPLAGGFPHQGP
FT                   SGYSGPASYPDPTAGETMRIGSTAPTVPTPDPSAPGLVAAEPAQTTAPALRLAAAGRTR
FT                   RGKRGGPNEDAYVVSDGLLAVADGVGGEAAGQIASTLTVTTVAGFRPQYAEDPADGLRQ
FT                   AVARANQVVREKPRQEPSWRGMACTLDVVILGRQQSTGETLFIAHVGDSSVWLQPQKGR
FT                   PRQVTTPHAIKNGPLLNAIGLADRIEADILREAVRSGDRVILASDGITKVMTPEQLLGL
FT                   MTELGPEPPERAADALVEAALLAGARDDTTIVVADLVSEPSAR"
FT   gene            complement(231593..233140)
FT                   /locus_tag="Franean1_0189"
FT   CDS_pept        complement(231593..233140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0189"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: fal:FRAAL6682
FT                   conserved hypothetical protein; putative metallo-dependent
FT                   phosphatase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09656"
FT                   /db_xref="GOA:A8LCL7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL7"
FT                   /protein_id="ABW09656.1"
FT                   /translation="MPHSLRGPRRSRSRSSESPASAPRDAAPRDAPPRPGGGPSHAEHG
FT                   VHLAFGADPATSMVVSWITREPVVRPLARVVTGTAEAVREVEAGTRSYTDAATGWEIYA
FT                   HHALLDELAPDTEYTYEITYQTTAAGVVREVGRASFRTAPRGRAAFTFACFGDHGTDAS
FT                   DNPFGTPASGALVAGVERVDPLFTLVDGDLAYSNVSDVPPRAWADWFAMISTSAARRPW
FT                   MPSVGNHETERGNGALGLAAYQTYFQPPDNGEEPYLAGLWYAFTVGGVRFVVLSGDDVC
FT                   YQDAGRVYLHGYSSGRQTAWLERQLAEARADQAVDWIIVALHQAAVSTAEFHNGADLGL
FT                   REAWLPLFDQYGVDLVISGHEHHYERTHPLRGVVDGSTTLTPRPVPGSVSVAGGGGGGT
FT                   ATLDTSAGTVHMLIGTGGSSTPSAGQLFDPPACRVVVGVREREPGQRQRSSIRAVEPAP
FT                   WLAARFPEHPYAFAALTVDPGEPGGTTRIQVTVYDSADAVPVPFDTFTLARPRADAT"
FT   gene            complement(233346..235850)
FT                   /locus_tag="Franean1_0190"
FT   CDS_pept        complement(233346..235850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0190"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: fal:FRAAL6680 ATP-dependent
FT                   protease, HSP 100, part of multi-chaperone system with
FT                   DnaK, DnaJ, and GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09657"
FT                   /db_xref="GOA:A8LCL8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL8"
FT                   /protein_id="ABW09657.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKGDPATAGAPAEGTPS
FT                   TSLVLDQFGRNLTAAARESKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAV
FT                   VEGLAQAIVKGEVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIIL
FT                   FIDELHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHLEKDAALERRFQ
FT                   PIQVAEPSVAHTIEILKGLRDRYEAHHRVSITDAALVAAASLADRYISDRFLPDKAIDL
FT                   IDEAGSRMRIRRMTAPPDLREFDERIANVRRDKESAIDAQDFEKAASLRDKEKTLLAEK
FT                   AKREKEWKAGDMDVVAEVGDEEIAEVLAIWTGIPVFKLTEEETARLLRMEDELHRRVIG
FT                   QEQAIKAVSQAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTELSKTLAEFLFGDEDSLIQ
FT                   LDMSEYMEKHTVSRLVGSPPGYVGYEEGGQLTERVRRKPFSVVLFDEVEKAHPDVFNTL
FT                   LQILEDGRLTDSQGRLVDFKNTVLIMTSNLGTRDISKGPGIGFATGQGAVDYERMKAKV
FT                   QDELKQHFRPEFLNRIDDIIVFHQLSENEIIQIVDLMLARVDSQLKNKDMALELTPAAK
FT                   ALLAKRGYDPVLGARPLRRTIQREIEDILSEKILYGTLRPGEIVVGDVEGEGEEAKFVF
FT                   RGEPKPNSVPDSPPIDLAKSSE"
FT   gene            complement(236419..237513)
FT                   /locus_tag="Franean1_0191"
FT   CDS_pept        complement(236419..237513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09658"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCL9"
FT                   /protein_id="ABW09658.1"
FT                   /translation="MPGPPAQRDGGGAIDCRTTQMIPAQNCATRPVGLAGFGSTLRAVA
FT                   PALDHRHAIAGSPEPADGWIDATDLRSPAGLDAALGVIRDHHQASAEVAVSYLTAWYAA
FT                   TIVGPAVTAFVLTRRVPDLDPAGISVHCREGGWFDATAFRTRRMTIMYSDPVLTAPVPA
FT                   RIASELIAQAGGPVTEQVLPAGTYDRYPDSVGPPDSASYPDSVGYPEGITADDPIEVVE
FT                   AVADVETLRARLVSQIVGHLEPVLADLRPRARLGHAALWGAVAAQCGRAFLLTERVSGD
FT                   PHAGRLEADAFFASASPPLRARPTWQQFVHHGRPYTGMRRGSCCLAHRVTAEFCTACPF
FT                   VAAEERENRLREWIDTQGPGGLAV"
FT   gene            complement(237759..238037)
FT                   /locus_tag="Franean1_0192"
FT   CDS_pept        complement(237759..238037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09659"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM0"
FT                   /protein_id="ABW09659.1"
FT                   /translation="MLISWTRPRVGSVSGQARHRSVGSQVRSVTGRRVAQSRRSATANP
FT                   SAVGSVVLRAGQAKKIEGGTRRARPPSRRRSGRVHQGGRGWVADVSG"
FT   gene            complement(238150..239568)
FT                   /locus_tag="Franean1_0193"
FT   CDS_pept        complement(238150..239568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0193"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   aeh:Mlg_2299 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09660"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM1"
FT                   /protein_id="ABW09660.1"
FT                   /translation="MSAAVVAFFNNKGGVGKTSLVYHLANMYADLGRRVLAADLDPQAN
FT                   LTASFLDEDTLERLWHPEARRSAAPARTIHGMLRPLIEGTGDIAPAPGQLVGDNLVLLP
FT                   GDLELSGFEDELSQAWPRCLEGPGNPRAFRVMSALGRLVRAVADLHDVEIVVIDVGPNL
FT                   GVINRAALVASDHVVVPLAPDLFSMQGLRNLGPALRAWRDGWADRLARAPRDVTGLPGG
FT                   GMRPLGYVMLTPHGRSDRPSRAHSRWISRMPTVYAQEVLGVAPRVPVDIAVDQHCLAQV
FT                   QHYRSLMPLAQLARRPVFALRPSDGIVGSHLQTTQRAYRDFSTLAVRIARRMAEAERRP
FT                   GPRELEPAPRVDHRPVGGRPPGTSPTAGPAAGPMAGPTAGLTVGLGAGGGPRPALGPDA
FT                   EVALSRVPLARSETAPRTAIADGPAASVSISPDSVGPVSMAAPLPPGLPPTVAMPRVRP
FT                   DRPHPDRPHPGRAG"
FT   gene            239718..240254
FT                   /locus_tag="Franean1_0194"
FT   CDS_pept        239718..240254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5505 conserved hypothetical protein;
FT                   putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09661"
FT                   /db_xref="GOA:A8LCM2"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM2"
FT                   /protein_id="ABW09661.1"
FT                   /translation="MTTSPRVLYHVVCAALPALAAADFATEARRDGWDVCVVTTPRAAA
FT                   WLDLPALAAATGHPVRTDYKFPGQPDVLPPPAAFVVVPATFNTINKWAAGIADTLVLGL
FT                   LTEALGLGLPVVAAPCLAEPQAAHPAFAASCRTLRGAGVRLLDRWTARDPGLAAGGWET
FT                   ADTHRVLAELRSAAG"
FT   sig_peptide     239718..239795
FT                   /locus_tag="Franean1_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.589 at
FT                   residue 26"
FT   gene            complement(240264..241235)
FT                   /locus_tag="Franean1_0195"
FT   CDS_pept        complement(240264..241235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6675 putative secreted lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09662"
FT                   /db_xref="GOA:A8LCM3"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM3"
FT                   /protein_id="ABW09662.1"
FT                   /translation="MRHSTGATSRFGGPRGRRGRHGRHGRTALFNRTATFNRTAPFTWT
FT                   VLFVSAALFVLLGTPMGTAGAATAAPGTLTVAALGDSYSSGEGTPPFEAAFASCRRSAG
FT                   AWPRLLATLDPPATNVLHAACGGATTEAMTKPQRGSPPQLEQLRALPTPPDVVTLTIGG
FT                   NDAGFSQVMFSCVAWKCFWDGDDRRRRDYVEDVLPDVLVATYKEVKAAAPHSRIVVVGY
FT                   PTVVPRSQSDNTCRWLDKSERRQLASLNNALNRTIRRAASDAGVEYVSTDRSLRGHEMC
FT                   TKDSWVNPIGLFGASRSLSAHPTRAGQEALAKTVHRALFDDR"
FT   gene            complement(241413..242174)
FT                   /locus_tag="Franean1_0196"
FT   CDS_pept        complement(241413..242174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0196"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bvg accessory factor; KEGG: fal:FRAAL6674
FT                   conserved hypothetical protein; putative transcriptional
FT                   activator (Baf family)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09663"
FT                   /db_xref="GOA:A8LCM4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LCM4"
FT                   /protein_id="ABW09663.1"
FT                   /translation="MLLTIDVGNTNTVLGVFDGDQLANSWRVRTDPRATADELGWLYRG
FT                   LLGDHPIGGVSVCSTVPAALREIRRMVSRTFPAMPTVVVEPGTRTGVPILIDNPKEAGA
FT                   DRIMNTLAAHHLYGGPAIVVDFGTATNIDVVSARGEFLGGAFAPGIEVALDALASRAAQ
FT                   LRNVELTTPRSVIGKSTVEALQSGMIYGVVGQVDALVRRIRAELGTPATTIATGGLAPL
FT                   VIKESETLDNHEPHLTLIGLRLVFEKNTEPR"
FT   gene            complement(242234..243262)
FT                   /locus_tag="Franean1_0197"
FT   CDS_pept        complement(242234..243262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0197"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: fal:FRAAL6673 nicotinate-nucleotide
FT                   pyrophophorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09664"
FT                   /db_xref="GOA:A8LCM5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM5"
FT                   /protein_id="ABW09664.1"
FT                   /translation="MSGGRPGPPLGPDQLSAAVLAGLKSAGLEAAAVLDVIGRALAEDL
FT                   PVATSPQVSGAPRPVDEAAPPGGEAAPQVGEPAWAVDATSAATVDAALTSTGSVVSRAD
FT                   GVVAGVPVAAAVFEVLLGAAVTVTPTLADGDRVVPGTEVLRVRGPVRGLLTAERTALNL
FT                   LCHLSGVASVTRLWADAVAGTGAAVRDTRKTLPGLRALEKYAVRCGGGRNHRMSLADAA
FT                   LVKDNHVIAAGGVAAAFTAVRARYPDLPVEVECDTVEQVVEAVGAGADLILCDNMSLDE
FT                   LRASVAVARPAGVLLEASGGLTLDVAAAVAATGVDFLAVGGLTHSAPALDLGFDLAVPA
FT                   PR"
FT   gene            complement(243259..245055)
FT                   /locus_tag="Franean1_0198"
FT   CDS_pept        complement(243259..245055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0198"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: fal:FRAAL6672 L-aspartate oxidase (LASPO)
FT                   (quinolinate synthetase B); TIGRFAM: L-aspartate oxidase;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09665"
FT                   /db_xref="GOA:A8LCM6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM6"
FT                   /protein_id="ABW09665.1"
FT                   /translation="MPVLPHRLGAPRPGWTRHADIVVIGSGVAGLTTVLHARAASPDSR
FT                   VLLVTKALLDAGSTRWAQGGIAAALGVGDSPAEHHRDTLVAGVGLCDPVAVDILVTEGP
FT                   ARVRELAALGARFDREPDGALSLTREGGHLRDRIAHAGGDATGLEVERALIAAVRADPS
FT                   IEVLEHALVLDLLTDRGGRAVGATLHVLGEGSRDGVGAVTARAIVLATGGMGQIFASTT
FT                   NPAVSTGDGVALALRAGAVVTDLEFVQFHPTALWLPEHESGQQPLVSEAMRGEGALLVD
FT                   AAGRRVMAGVHPLADLAPRDVVAKRMSRVMAEQGVRHLFLDARHLGTETLLRRFPTITA
FT                   RCRAAGIDPVTMPIPVAPAAHYASGGVRTDVWGRTSVPGLYACGEVACTGVHGANRLAS
FT                   NSLLEGLVFAARIAEHIAGLPGVRPVDGPGGTPSTGEPTGARGSGLTDPTERGDLARVM
FT                   TDGAGVLRSAESLRATSKMLAGLGDLRVSGATVQAGPAAWEMTNLRTVATALVAAAELR
FT                   TETRGCHWREDFGARDDEHWRGHVLTRLDQEGKLIVTYEAPPAEERSNGARAAQGPSAR
FT                   SQAPSAPSAPSGRSAASQARSA"
FT   gene            complement(245060..245509)
FT                   /locus_tag="Franean1_0199"
FT   CDS_pept        complement(245060..245509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0199"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: fal:FRAAL6671 aspartate 1-decarboxylase
FT                   (partial match); TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09666"
FT                   /db_xref="GOA:A8LCM7"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LCM7"
FT                   /protein_id="ABW09666.1"
FT                   /translation="MFRTMLNSKIHRATVTQADLHYVGSVTIDADLMAAADLLPGEQVT
FT                   IVDINNGARLETYAISGPAGSGIIGINGAAARLVHPGDLVIIISYGIMDDAEARRHVPK
FT                   VLFVDAENRIVGQGGDPAAALPGDPSSLRGDVLDPAGARGLGGGA"
FT   gene            complement(245513..246595)
FT                   /locus_tag="Franean1_0200"
FT   CDS_pept        complement(245513..246595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0200"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: fal:FRAAL6670 pantothenate synthetase;
FT                   TIGRFAM: pantoate--beta-alanine ligase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09667"
FT                   /db_xref="GOA:A8LCM8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM8"
FT                   /protein_id="ABW09667.1"
FT                   /translation="MPAQSPARPISGPAAPTSLPSPAAPTSPSASAGPGGGTTASGSPA
FT                   RTGRPAVARTRAELATLLSEPAASPVGDGPARGVRAVVMTMGALHRGHAELIRAARRRA
FT                   DQVVVTIFVNPLQFGPGEDLDRYPRTFEADLDLCAREGVDAVYAPTQVHDPAPLVTLSA
FT                   GRLGDVLEGASRPGHFDGMLTLVGTMLHLVRPDVAFFGRKDAQQLVCIRRMVADLAFQV
FT                   EIVGVPTVRDTDGLALSSRNAYLGPEQRRSALALSRALSAGTRQAGAGAAAVLSAAWSV
FT                   LAAEPGVDVDYLTLANPSDLGPVEVGPALLLVAARVGNTRLIDNVELVLTGAGPAPVDD
FT                   EARSKDHNEARNDAGKDKEV"
FT   sig_peptide     complement(246497..246595)
FT                   /locus_tag="Franean1_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.720 at
FT                   residue 33"
FT   gene            complement(246842..249385)
FT                   /locus_tag="Franean1_0201"
FT   CDS_pept        complement(246842..249385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0201"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6669
FT                   hypothetical protein; putative multidrug efflux transporter
FT                   AcrB transmembrane domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09668"
FT                   /db_xref="GOA:A8LCM9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCM9"
FT                   /protein_id="ABW09668.1"
FT                   /translation="MRTRPPTASTPRRSPAPSGSGASDGPADRGPRHAHRAAPTSASPD
FT                   SPTHATHLAARAARWSVRHRRLAIGGWILGVVLVTLLGSLIGTSTLGDDDYSVGEDGRA
FT                   QSTLDAHGFTSPANENVLIQRPAQAASPEELLADPELRAALADVAARLDGTGEVTNLRA
FT                   PIALPGVEANPGLVSTDRRSVMVTFEMRGDEDTATDRIDPVLAAVAAAADEHPGLLVEE
FT                   VGEASADKALGDTIGKDFKRAELLAIPLTLGILLAVFGAVVAALVPVALALTAFVGALG
FT                   VVAFTSRLLPTDETATSVMLLIGLAVGVDYALFYIRREREERAAGHSPQRALEIAADTS
FT                   GHAVLVSGLTVAVSMAGLLLTGLSVFSGIAGGTVIVVLIAVLGSLTVLPAVLSWLGDRV
FT                   ELLRLPWHRRADARAAAAGAPGADRKTTSSTTSTTSVAGTAGVDLTRPGLMGRLLRRPG
FT                   IVAVVTGGLLILLAVPALGLRTVEPGMDDIPDDLPIMQTYDRVQAAFPGEQTAAVVVVS
FT                   AADVRAPQAVGAIDALRERALASGMMYEPITTEISADGQVAKISIPIAGGGTDDASLRV
FT                   LDTLRGEIIPSTIDPVSGMSADVTGWTAGSADFNAQLNGRTPLVIGFVLVLAFLLLLAA
FT                   FRSAIVAAAAVALNLLSVAAAYGLLVVVFQHHWADGLLGYTSTGAITNWLPLMLFVILF
FT                   GLSMDYQVFVLSRVREAYDSGLPMRDAVLVGVRRSAGVVTSAAVIMVAVFSIFATLSQV
FT                   SMKQLGVGLGAAILLDATVIRVILMPAVLTLIGERAWRRRPAADDDDRGTAVPVPAGDR
FT                   RPQLPAQAPAPAAPPAPAGHGPFSGMGDFPRHRQD"
FT   gene            complement(249519..250583)
FT                   /locus_tag="Franean1_0202"
FT   CDS_pept        complement(249519..250583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0202"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: fal:FRAAL6667
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (SAICAR synthetase); TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09669"
FT                   /db_xref="GOA:A8LCN0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCN0"
FT                   /protein_id="ABW09669.1"
FT                   /translation="MLPAAAGIRIPTRTPGRSPRPGSAAGQPSGGITKRHVERASRAGG
FT                   YRYGRTMPLTHEEFAGLTHLGSGKVRELFAIGDDAVLLVASDRISAFDVVLPTEIPDKG
FT                   AVLTGLSLWWFDQLGDLVPSHVISSSVDEYPAELAPYAEQLRGRSMLCRRLDMVQIECV
FT                   ARGYLTGSGLKDYRRSGTVSGHPLPAGLEDGSRLPNPIYTPSTKAPIGEHDENISRDDA
FT                   AGRVGAELAAELERLTLQIFGRASDLAAERGILLADTKFEFGHDADGVLRLADEVLTPD
FT                   SSRFWPADAWTPGGTQPSYDKQFIRDYLVSTGWDRNPPAPELPDDIVESTRARYVEAYE
FT                   RLTGISFKDYLSTA"
FT   gene            250592..251191
FT                   /locus_tag="Franean1_0203"
FT   CDS_pept        250592..251191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6333 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09670"
FT                   /db_xref="GOA:A8LCN1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCN1"
FT                   /protein_id="ABW09670.1"
FT                   /translation="MASAGDTAGGSTADGAFRAAARAILFPPTGHPRHAVYGTVLAAGL
FT                   IAAQDPDQDSAAEIIAAVATTMVVFWLAHGYAHAIGHRVRRDTGDGIGRVADRRAGSDA
FT                   GSDAGWPGARRALVENWPMVRASFLPLAVLAVARAAGASVSDAQEAALWTSLLLLCAWG
FT                   LFSGRAGGLRRWRLAGYTAGIALLGIILIGLEVAIH"
FT   gene            251195..251440
FT                   /locus_tag="Franean1_0204"
FT   CDS_pept        251195..251440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09671"
FT                   /db_xref="GOA:A8LCN2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LCN2"
FT                   /protein_id="ABW09671.1"
FT                   /translation="MLRSSRQPPGVAGIRASVKVRCGGGWLGSGPGRSGPILALGYSPF
FT                   RFFLAVSGGFFGRTLPERARRMSKGEQATGVCGVDP"
FT   gene            251873..252466
FT                   /locus_tag="Franean1_0205"
FT   CDS_pept        251873..252466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09672"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDQ7"
FT                   /protein_id="ABW09672.1"
FT                   /translation="MSRHDPALARALAVACRQKGALTRVQARCAGLTDHRLHQLVQNED
FT                   WLNPVQGGYVVPTCDTYLGRCQAALLVLPCATLCGLTAARLHEFPTLPPRSDDEPIHLL
FT                   LPPGSSRRRNKGVVLWYDAMSAEQQEQVHGLRATSVARTLVDLLASGPRDTAASLLDRA
FT                   VEGGLVAPEELDELRGALDAQPEATRPDPVRPDT"
FT   gene            complement(252538..253845)
FT                   /locus_tag="Franean1_0206"
FT   CDS_pept        complement(252538..253845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0206"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: fal:FRAAL6665 adenylosuccinate lyase
FT                   (adenylosuccinase) (ASL)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09673"
FT                   /db_xref="GOA:A8LDQ8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDQ8"
FT                   /protein_id="ABW09673.1"
FT                   /translation="MIGRYTLPDMGRVWSEANKYELWCKVEVLVLEAHAAAGRVPADAV
FT                   GPVRAAAAPTPEAVAEIEAVTQHDVIAFLTAWADQTEPRSAAAYVHFGMTSSDLLDTAL
FT                   ACQLVEATDLLLARADRLVAALRDLGLAHRGTLRVGRTHGIHGEPTVFGHRVADLAFGM
FT                   ARCRDRLRAARADVGVAKISGAVGTYSNIDTDVEGYVADKLGLTPAPVATQVVLRDGIA
FT                   SWVAALAGLATVCEAVALEVRHGQRTEVRELSEPFGSGQKGSSAMPHKKNPIMSERIAG
FT                   IARIVRAQYVPVLEGVPLWHERDISHSSTERIALPDAACGVDYLLHLTTRLVDGLVVDR
FT                   ERMRANLDATGGLVYTSAVLLELVETGLSREDAYAVTQAAAMETWQTGVPFRETLRKHA
FT                   GDRGLPLDEARLDEVSRPERYVERLTPLFDRLAALS"
FT   gene            complement(253842..254405)
FT                   /locus_tag="Franean1_0207"
FT   CDS_pept        complement(253842..254405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0207"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: fal:FRAAL6664 phosphoribosylaminoimidazole
FT                   carboxylase = AIR carboxylase, catalytic subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09674"
FT                   /db_xref="GOA:A8LDQ9"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDQ9"
FT                   /protein_id="ABW09674.1"
FT                   /translation="MSVSQGKSSQGNGARGGSMDPRVAIVYGSPSDTQTMSKAGATLER
FT                   FGVAYEEVSLSAHRAPRTLAEYVGKLRAREIQVVIAGAGLAAALPGAVAALTTLPVIGV
FT                   PISGGALDGMDSMLAIAQMPPGVPVATVGLNNSTNAAILAIQILALGDPDLGLKLATFK
FT                   DEFEQAAADSLADVAAAATAAARA"
FT   gene            complement(254402..255721)
FT                   /locus_tag="Franean1_0208"
FT   CDS_pept        complement(254402..255721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0208"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: fal:FRAAL6663 phosphoribosylglycinamide
FT                   synthetase (GAR synthetase); TIGRFAM:
FT                   phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09675"
FT                   /db_xref="GOA:A8LDR0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR0"
FT                   /protein_id="ABW09675.1"
FT                   /translation="MKVLVVGSGGREHALCRALARDPNVGSLVCAPGNAGTAELAEPRP
FT                   LRVDDPDAVAALAESVRADLTVIGPEVPLVAGAADEIRARGLRAFGPSAAAARLEGSKA
FT                   FAKEIMRAAGVPTADSRDHTEISSALADLDSFGPPYVVKYDGLAAGKGVTVTTDRDAAV
FT                   DAVRASLRGPDDRVVLEEYLDGPEVSLFAIVTESGSVVPLLPAQDHKRVGDGDTGPNTG
FT                   GMGAYTPLPWAPRNLTAEVVRTVIRPTVDEMARRGTPFTGLLYAGLALTSRGIRVVEFN
FT                   VRFGDPEVQAILALLNTPLTDVLSGRRPPVWRSGAAITVVVAAAGYPANPRLGDPIRGL
FT                   AAAGALAGVDVLHAGTRRDEQGQVVASGGRVLSVTAIGSNLESARGSAYEAISRISLDG
FT                   AHYRTDIGDPSRMRGAVDVHRAGSGVGDLHQSQDQQDKKE"
FT   gene            complement(255770..256045)
FT                   /locus_tag="Franean1_0209"
FT   CDS_pept        complement(255770..256045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09676"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR1"
FT                   /protein_id="ABW09676.1"
FT                   /translation="MHSFSRRASSKRIKGRRQRRRAPPKPRGPSRAPGGGPDHATRRWS
FT                   VEAARVLPWSLLADEQADIAGTSRSPGHSGRHRRQGHKAKDDQRAR"
FT   gene            complement(256145..257083)
FT                   /locus_tag="Franean1_0210"
FT   CDS_pept        complement(256145..257083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09677"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR2"
FT                   /protein_id="ABW09677.1"
FT                   /translation="MAGYPSQASWDDEHADGADGAGSEITNETLATARPSTELEPATAP
FT                   RQPGPARWSPTVHPDHPLRRGIDPATWPVGFSPTGEALPEALTDVLLRGSHAIRSSKRA
FT                   EAQRLERAAAIAEHVQAQIDDFLGFCAAERLTPPVIVRTNGRRAERSHDDVPDWNGTPR
FT                   LRTSTTGRAAARAGEDGSRQDRRRGEDDADPDTASPPPTGRHGRRSGTTPARRRLLRRE
FT                   RLHAWPLLYWRCESFPAPGRSLHLFVEPDGRTFEGRDAPAPLTVLGREVQVWPVDAPSI
FT                   VEGMAEVDARRCALHLVHGMAHMLWQAGVGL"
FT   gene            complement(257313..258596)
FT                   /locus_tag="Franean1_0211"
FT   CDS_pept        complement(257313..258596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0211"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   fal:FRAAL6660 adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09678"
FT                   /db_xref="GOA:A8LDR3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LDR3"
FT                   /protein_id="ABW09678.1"
FT                   /translation="MPALVLIGAQWGDEGKGKATDLLGGAVDYVVRYQGGNNAGHTVVI
FT                   GAESYALHLIPSGVLRTDCVPVIGNGVVIDPGVLLSEMDGLQARGVDVSRLLISADAHL
FT                   IMPHHRALDRVTERYLGKARIGTTGRGIGPAYGDKVARTGIRVQDLLDPGIFRQKLELA
FT                   LREKNQVLTKVYNRRRIEVDEVVEEYAAYAERLTPHIADTGLLLDTALREGKVVLLEGS
FT                   QGTLLDVDHGTYPFVTSSNPTAGYAATGAGIGPTRINRVIGIIKAYTTRVGAGPFPTEL
FT                   DDKVGEELRRIGGEFGVTTGRARRTGWFDAVIARYAVRVNGLTDLFLTKLDVLSGFDTV
FT                   PVCVGYEINGQRTDEMPMTQTEFHHAKPIYVELPGWHEDISGVTRFADLPEAAQAYVAT
FT                   LEEMAGAPVSAVGVGPGRAQTLVINELI"
FT   gene            complement(258685..259113)
FT                   /locus_tag="Franean1_0212"
FT   CDS_pept        complement(258685..259113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09679"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR4"
FT                   /protein_id="ABW09679.1"
FT                   /translation="MTTPPANQNLLSGPPPTLLPSDAAAADALRAGDTPDTVAARFPAI
FT                   SLGWAVLAEDALRAGRPVEAYAYARTGYHRGLDQLRRSGWKGHGPVPWSHEPNRGFLRA
FT                   LAALSRAAAEINDSEEAARCRQFLTDSDPAAAAELGLA"
FT   sig_peptide     complement(259036..259113)
FT                   /locus_tag="Franean1_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.622) with cleavage site probability 0.599 at
FT                   residue 26"
FT   gene            complement(260033..260776)
FT                   /locus_tag="Franean1_0213"
FT   CDS_pept        complement(260033..260776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0213"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; KEGG:
FT                   fal:FRAAL6658 hypothetical protein; putative signal
FT                   peptide; putative lysozyme-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09680"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR5"
FT                   /protein_id="ABW09680.1"
FT                   /translation="MRSHDRVPARSNGRGGRHRATQGPSTATRVLRTTGAVTALVGTGL
FT                   AVTAAPAGAATADDFAKLRKCESGGNYAINTGNGFYGAYQFDQRTWTGLGYPGRPDQAP
FT                   PAMQDEAAYKLYDSRGWSPWPGCTSKLGLTRNGPAPASSGAGGDVIAQALTPAEPPMTL
FT                   ERARAEVGGQFGGEVLNVGMGDDVRADAFIWQAEMRDRRFVLTVDGKFGPESQGIAALY
FT                   SYLTRVSDGQPGVVGQNLWNATVSG"
FT   sig_peptide     complement(260612..260776)
FT                   /locus_tag="Franean1_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.606 at
FT                   residue 55"
FT   gene            complement(261118..261900)
FT                   /locus_tag="Franean1_0214"
FT   CDS_pept        complement(261118..261900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ago:AGOS_ADL112W ADL112Wp"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09681"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR6"
FT                   /protein_id="ABW09681.1"
FT                   /translation="MFQLRPAGVSPDIPPAADHVLSQPRFPHQHELGTLRRPGSSAAKT
FT                   RRRQDRMTRPHGADPAVRAGAVRGSPQRSARHGRRYGLRRQAGVEVPMPGAVFSSVIHP
FT                   MIGRTLRQPSRRGARPTADSARSSPPHDLLRPRPQEEPSTPVIPAGGRVPHRPGHARRG
FT                   RPARSRRPCRSSLRRAPCPRAHNPINLHLVTSDIQNVIILEKTTNERQTYFRGAVETRR
FT                   HAARPTPEDVRPRPGGNVIRISASSHNRLRHSSISPFG"
FT   gene            complement(262173..262856)
FT                   /locus_tag="Franean1_0215"
FT   CDS_pept        complement(262173..262856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0215"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   Transglycosylase domain protein; KEGG: fal:FRAAL6657
FT                   N-acetylmuramoyl-L-alanine amidase (autolysin)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09682"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR7"
FT                   /protein_id="ABW09682.1"
FT                   /translation="MSDARTSGRQRRSSTRSRARTLVSVPVIAAAVGGTLALSQPANAA
FT                   TTWEGLRQCESGGNYTTNTGNGYYGAYQFSPGTWRSLGYSGLPHTAPPAVQDTAALQLA
FT                   LRSGFGQWPVCGSGMGSEQLLPGASSSGAGVQASRAAERTSLVAQPAAAGVPNLTRTYT
FT                   ASMVNQVSDEIRSWQAKMTSLGYPLTVDGSYGPRSAAAARDFQAARGLVVDGVLGPQTW
FT                   AATFG"
FT   sig_peptide     complement(262722..262856)
FT                   /locus_tag="Franean1_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 45"
FT   gene            complement(263232..263471)
FT                   /locus_tag="Franean1_0216"
FT   CDS_pept        complement(263232..263471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09683"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR8"
FT                   /protein_id="ABW09683.1"
FT                   /translation="MRFSHITACGPASARRYEFSSCLMTAWPAAGSLLAYSARLSTARP
FT                   MATIFHQCDLSVRTTLHDAVAKLMSAHARAIPAP"
FT   gene            complement(264473..265507)
FT                   /locus_tag="Franean1_0217"
FT   CDS_pept        complement(264473..265507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0217"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: fal:FRAAL6655 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09684"
FT                   /db_xref="GOA:A8LDR9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDR9"
FT                   /protein_id="ABW09684.1"
FT                   /translation="MPIASPDVYAEMLSRAKSNAYAYPAINVTSSQTLNAALRGFAEAG
FT                   SDGIVQVSTGGAEFLSGTTIKNMVLGAEALAEYAHHVAKAYPVNIALHTDHCPADKLDT
FT                   YIRPLIAISKERVAQGRDPLFQSHMWDGSAVELEENLKIADELLADCRAARIVLEVEIG
FT                   VVGGEEDGVVGAIDEKLYTTPGDMFRTAEVLGTGEKGSYMLAATFGNVHGVYKPGNVKL
FT                   RPSILREGQQHVAEKLGLAADAKPFNLVFHGGSGSDLSEIRETLDYGVIKMNVDTDTQY
FT                   AFTRPIVDHMLRNYDGVLKVDGEVGVKKAYDPRTYGKAAETAMAARVAQACDDLRSAGR
FT                   SIGV"
FT   gene            265674..266399
FT                   /locus_tag="Franean1_0218"
FT   CDS_pept        265674..266399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0218"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   fal:FRAAL6654 putative integral membrane protein (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09685"
FT                   /db_xref="GOA:A8LDS0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS0"
FT                   /protein_id="ABW09685.1"
FT                   /translation="MPSRASDGCGSTRHRRKAAGCLLPARRARQTGRVDIESLSGMTLY
FT                   VILFAVIFAESGILVGFWLPGDTILFAAGLVAADPAADVSIVVVAVGVAVVASAGAVVG
FT                   YATGSHLGRPYLERRHARALGRTEEFYRRFGAVTLIAARFVPWARTFAPVLAGAVAMPR
FT                   HRFGVAVVIGAVVWGTGLTLLGYEAASIPGLRDAALWIALVVIVVSVLAGAVGELLRRR
FT                   VARPRGLGGSSGTSGTSPH"
FT   gene            266560..268047
FT                   /locus_tag="Franean1_0219"
FT   CDS_pept        266560..268047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0219"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: fal:FRAAL6653
FT                   conserved hypothetical protein; putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09686"
FT                   /db_xref="GOA:A8LDS1"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS1"
FT                   /protein_id="ABW09686.1"
FT                   /translation="MHSERPERGRAAPSGPGLRVRPGSNARPSAHARPALRARSSRAAD
FT                   PPGPAGPVQDVVRGRRHRRRPTPRRAGGLRAAAGLVALTLVTLGLVAASGEVPSTSSAA
FT                   GRGLSGSNRVVADGSVAGGTGAGTADHTAGTDAVGAPPGSASRSGRGALAGYGGSSADP
FT                   VWPADRGPVSGVLVLRADPALLAIMAADGQPGSAPGEPWVLYLLSGPVNVIRWAMGEPF
FT                   EASIDTRQLPNGDYTLSEVIFRATHAPLVRTGRVPVANPLPPGADQTAPGGAAPRSAAA
FT                   AAADPGDGTAPGTPAGPAGSASAGVSGSPTGAGLPSGAEPAAGASTAAGASTAAGAVAG
FT                   PAPAPVASGARLAGTPTGAGGGAGSAATAALIEEVVTRTNAQRSAAGCPALTVDARLAA
FT                   SAQEHSADMAARNYFDHNGRDGRSPFDRIAAAGYVFSIAAENIAAGQRTPADVVADWMA
FT                   SPGHRANILNCSLSQIGVGLATGGDYGTYWVQDFGSP"
FT   gene            268359..269465
FT                   /locus_tag="Franean1_0220"
FT   CDS_pept        268359..269465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0220"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; KEGG: fal:FRAAL6652 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09687"
FT                   /db_xref="GOA:A8LDS2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS2"
FT                   /protein_id="ABW09687.1"
FT                   /translation="MVRSVVTGAAGFLGGAVAHELRRRGDEVIGLDVRRAPGVTLADVT
FT                   MSGSWEKALEGADLLVHAAAVGMGGVGELAPVRAGRATPPSGITTAQMRKVLLGGTATV
FT                   LDAAQRAGVRRVVHLSCVSALGDDAPHAADESAPVGLTGEPRADAIAAAEQTVSAAAAH
FT                   GAPVTVLRIADAYGPRAGRWTLWPVLLMRAGRFVLVDGGRGMLSPVHVDDVVSAVMAVA
FT                   AAPGETVTGQVLHVTGPGPATVAEFFGRYAAMAQVRAPRSVPARLCEVVDAVDRLPSRQ
FT                   PASAGGRPGLLRGIGAALMANVDPRVRVDLGPLTIQDVTRRGTVSGDRIAALVGWRGEV
FT                   DLDEGMRRTGSWLRDRGLLGVPEPARRG"
FT   sig_peptide     268359..268415
FT                   /locus_tag="Franean1_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.939 at
FT                   residue 19"
FT   gene            269458..270021
FT                   /locus_tag="Franean1_0221"
FT   CDS_pept        269458..270021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6651 hypothetical protein; putative
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09688"
FT                   /db_xref="GOA:A8LDS3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS3"
FT                   /protein_id="ABW09688.1"
FT                   /translation="MGEGPTLTTARLRALPLTVWNAGFVAEELAQAMVAANHGAPVRLA
FT                   AGELFGGAVDSAPADSAPADSVATDPTGVRRELRRRIGAGRGILTWVLRADDGTALGLL
FT                   AADMHAARAAVGVRVSAAHRRDGYAAEAVRAVASWLEYRGVLVGTRVRVGDIAAKRLAQ
FT                   STAFVPTGVLLTERRRLWIRPPPG"
FT   gene            270648..271739
FT                   /locus_tag="Franean1_0222"
FT   CDS_pept        270648..271739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09689"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS4"
FT                   /protein_id="ABW09689.1"
FT                   /translation="MSVDARREVPTGTRSSEVTYDHLIIPPHWRRPAGPGPGEPNPLFP
FT                   AGEQATAPPPGPAVTGASPINPMTGPMTGPLLVGTTARAFAKLDDMVRLGDDDRAVIDD
FT                   RRAEAERALRSIFPPRCALPLVGVATIGSAGRDTMIRPLDEVDIFVVFSAANSAWKRFR
FT                   WDSRDLLVCVRNAIGGDRVQTIGTRGQALRIVYDAAPDVHLVPAFDHPRAGYVIPDRVG
FT                   GWLPTRPERHASWTMDLGPRVISAVRLLKAWNRVCGSHLRSFHIEALAGQVLAGRGLNT
FT                   RQGLAEVFRHMDEVGLVVGDPSDIRGDLSSYLRQDDLEDLGAFVRQARTYSAKAVAAER
FT                   AGDHEEAVSLWGTVFGPEFPTFG"
FT   gene            complement(271810..273219)
FT                   /locus_tag="Franean1_0223"
FT   CDS_pept        complement(271810..273219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0223"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: fal:FRAAL6648
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09690"
FT                   /db_xref="GOA:A8LDS5"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS5"
FT                   /protein_id="ABW09690.1"
FT                   /translation="MTRAEPEPSVEDAAPPLQPPPAGAEPDDGYHHLHPLTPLLRGWLL
FT                   VAAVAVSILKNFAEELTVRSVTLTLSALLPAASAYGYCAWRFTRYRVEAEDLRLETGLL
FT                   IKRIRHVRLDRIQSVDVAQPLIARAAGLAVLRLDLAGTHDGDAEESGTRLSYLSLERAR
FT                   LLRAELLARAAGVAPGAGEAPERPLAYVPPLRLAAAITLSPAPWLALGAAFILVTPALL
FT                   TGTFAGFIAVAPALVGVWRTTFDRFATGFRFTVSESPDGLRIRGGLLDRAHHTVPHGRV
FT                   QAVSLRGSPLWRWLGWVELQINVAGDARSMLLPVAPRGQAVNVIERLLPAVDVDGMALP
FT                   RPPGRARLIAPVRWRRMRCGADDRVFVVRGGVLWQRTDIIPHGKVQSIRVVQHPAHRLL
FT                   RLADVHLDCAGGPVRIHARLLDVRQAHAIAAAQAERSRLSRVAAVPIVTGSPAWTPLRP
FT                   LSGARDPDAVH"
FT   gene            complement(273286..273810)
FT                   /locus_tag="Franean1_0224"
FT   CDS_pept        complement(273286..273810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0224"
FT                   /product="membrane-flanked domain"
FT                   /note="PFAM: membrane-flanked domain; KEGG: fal:FRAAL6647
FT                   conserved hypothetical protein (putative integral membrane
FT                   protein); putative cation-transporting P-type ATPase B"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09691"
FT                   /db_xref="GOA:A8LDS6"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS6"
FT                   /protein_id="ABW09691.1"
FT                   /translation="MHTAPADTPGPGWSSHSWRIDPGGWRGLSPQLRRLRRLLLLIGAI
FT                   PVIVLVSLIGGAFLGLPGLAVGAVPTAATVWGWRSIGRAWSAWRYAEREDDLLISHGTF
FT                   VRRLVVVPYGRMQLVDVTAGPLAQRFGIAQVRLHTAAATTDAVIPGLSPVEAARLRDSL
FT                   TERGEAQAAVL"
FT   gene            complement(273938..276175)
FT                   /locus_tag="Franean1_0225"
FT   CDS_pept        complement(273938..276175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0225"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: fal:FRAAL6646
FT                   conserved hypothetical protein; putative multidrug efflux
FT                   transporter AcrB transmembrane domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09692"
FT                   /db_xref="GOA:A8LDS7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS7"
FT                   /protein_id="ABW09692.1"
FT                   /translation="MGLPRPGATLRTRRFRWAVVLVWLLIGVAVSPLALMLTDAETNDA
FT                   AAFLPEGAESTRLLEAQRQLPGGDAVPAVVVLARDGGLTKADLDVATTLRTELAGFAAT
FT                   TTIPGVIPAPDHRAVIITVPMPQTTDADRFTADVARMRTIARQAAAAEPGLDSAVTGPA
FT                   GLVSDTYDVFVKIEGALLLVTASIVAVILLAVYRSPFLWVVPLLSVGIADQTAAGLIYL
FT                   LAEHAGLTVNGQSAGMLRVLVFGAGTDYALLLISRYREELTRHAEPATAMLVALRRAGP
FT                   AILASAGTVIIGMLCLLLGELNSHRGLGPVCAIGIAVALVTMLTLLPAAMVVGGRRLFW
FT                   PFVPRLGQAERSVEAGAWARAGAVIGRRPRTVWVTTVAVLGALVIGMLVLPGVLRQDQA
FT                   FRDNVESVQGQRLAERSFPPGVTAPTFVVANSARADAVAEAVRATPGVAAAAESGRTSE
FT                   LVQFLVVLDAPPDSPESFRTVEKLRTTVHALPGADALVGGNTAVNLDIRDAAVRDRELI
FT                   IPVVLVVVLLILGLLLRSVVAPLLLMGTVVLSFFAALGASALVYHYVFDFPGIDPALPL
FT                   IGFIFLVALGVDYNIFLMTRVKEETEHIGHAAGVRRGLAVTGGVITSAGVVLAATFAVL
FT                   LIFPLVQLAEVGFLVAFGVLLDTLVVRSVLVPALALDVGPVVWWPSHPERARPAGPVNG
FT                   QLTDQLTDHETLADFGALGVPLSAMEPAAAALESAEARARAEEDEDTEANR"
FT   sig_peptide     complement(276071..276175)
FT                   /locus_tag="Franean1_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.433 at
FT                   residue 35"
FT   gene            276572..277366
FT                   /locus_tag="Franean1_0226"
FT   CDS_pept        276572..277366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09693"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS8"
FT                   /protein_id="ABW09693.1"
FT                   /translation="MDVRNSGSWRPWRSGPASAGRGGLALAAAALVVASCQSGGSGAAG
FT                   IVPAATSAPPGPSQASVVSRTPAEPTLRAEDYVLTEGAITAGFTASPADPQSNSDDLTM
FT                   VQVAQCLGVPAEQFSDEHLDTADGPDFTSDVDELVTMSSSAQIVTEEKVAADLEILNNP
FT                   RFAECFGQTMQAEFDADTGSGATVEIVAAESPAPPAGASGLLRISMGVTAGGETVGLVL
FT                   DNVFFFEGQVEVVVNYANVDNTPPQVHLQRIADQISGKLQIQ"
FT   sig_peptide     276572..276703
FT                   /locus_tag="Franean1_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.744 at
FT                   residue 44"
FT   gene            complement(277387..278307)
FT                   /locus_tag="Franean1_0227"
FT   CDS_pept        complement(277387..278307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0227"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   fal:FRAAL6645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09694"
FT                   /db_xref="GOA:A8LDS9"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDS9"
FT                   /protein_id="ABW09694.1"
FT                   /translation="MISPGPGLAVSAEVSAALAAGRPVVALESTLIAHGLPRPRNRAVA
FT                   VELEEMLRERGVTPATVAVIDGVPTIGLDDATLSRVADDPAVAKASVRDLPAAAALRRT
FT                   CATTVASTSMLAARAGIRVFATGGLGGVHRGAGESFDESADLPTLGGTPITVVSAGVKS
FT                   ILDVGATLERMETLGITLLGWRTSEFPGFYLPGSGHRLDWRVDDARQVAGTMAARDRLG
FT                   LTSAIVVANPVPREQALDPGVHDRVLAEALRRAEAGGLRGKAVTPFLLETFRTETAGAS
FT                   LEVNVAVVRSNVAVAAEIATAWAAG"
FT   sig_peptide     complement(278248..278307)
FT                   /locus_tag="Franean1_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.727 at
FT                   residue 20"
FT   gene            278506..279408
FT                   /locus_tag="Franean1_0228"
FT   CDS_pept        278506..279408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09695"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT0"
FT                   /protein_id="ABW09695.1"
FT                   /translation="MTRRTILVVRVMKSAEIPRAGAPGRRPWIPGMSMALRAGVGLLAL
FT                   LVVATACTGGSSTRARGADRRSDSTDADVGVEDVNRGGTNGANGTGGRRTPSPAPSPLT
FT                   AADFVLTAGPETMGFSQDPPQPASGPNSVASAPSSMFDGTVATCAEATDAQIGASSTGD
FT                   ADGPVFTHDTSGADLRSFASVYADTATVAGHREIVRLDRFAGCYGRALVDELDSDELGA
FT                   TLIGTETVPPPPGATDRITVTIDIVTAQQQSFRTYVDLIMIFTGRAEGTITLVTPFQPA
FT                   DPALLATLTGQVERKIAAQ"
FT   gene            complement(279463..282075)
FT                   /locus_tag="Franean1_0229"
FT   CDS_pept        complement(279463..282075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0229"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: fal:FRAAL6643 ATP-dependent protease, HSP 100, part
FT                   of multi-chaperone system with DnaK, DnaJ, and GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09696"
FT                   /db_xref="GOA:A8LDT1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT1"
FT                   /protein_id="ABW09696.1"
FT                   /translation="MNADRLTARSQEALSSAISRATGDGSPLVDPLHLLTALLEAPDGV
FT                   GAALLEAVGTPAADIRSRAEAAVGRLPRAAGANVAPPQLSRQLVAVLNNAERQAARLGD
FT                   EYTSVEHLVVALAEEGGEASRILAEAGATPDALRGAFDRVRGGARRVTSRDPEGAYRAL
FT                   EKYSIDLTARARDGKLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   LRVAAGDVPESLRGRRIVSLDLGSMVAGSKLRGEFEERLTSVLTEIREAEGQIITFIDE
FT                   LHTVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRTRIEKDPALERRFQPVMV
FT                   GEPSVEDTIGILRGLKERYEVHHGVRITDSALVAAATLSDRYVTARFLPDKAIDLMDEA
FT                   ASRLRMEIDSRPVAVDELERAVRRLEIEDMALSKENDDASRERRDRLQRELAEKREELS
FT                   ALTARWQREKNSISEVQKIKEELENARRAAEMAERDLDLAKAGELRYGTIPTLEKRLAE
FT                   ATGALAGSDSPGGAMLSEEVGPDDVAEVVASWTGIPAGRMLEGETSKLLRMETELHRRV
FT                   IGQDEAVRTVADAVRRARAGIADPDRPTGSFLFLGPTGVGKTELAKALADFLFDDERAV
FT                   VRIDMSEYAEKHSVARLIGAPPGYVGFESGGQLTEAIRRRPYSVILLDEVEKAHPDVFD
FT                   VLLAVLDDGRLTDGQGRTVDFRNTILILTSNLGSVYIADPTLPPQVRHDSVMVAVRDAF
FT                   KPEFLNRLDDVLVFEQLGRDDLTKIVDIQIDRLRRRLADRRISLEVTDAAKVWLADAGY
FT                   DPVYGARPLRRLVQTSIGDQLARELLAGQIRDGDGVVVDVDGQRSALSVHSAARAQAI"
FT   gene            complement(282472..282981)
FT                   /locus_tag="Franean1_0230"
FT   CDS_pept        complement(282472..282981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0230"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: fal:FRAAL6642
FT                   putative heat shock protein HspR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09697"
FT                   /db_xref="GOA:A8LDT2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT2"
FT                   /protein_id="ABW09697.1"
FT                   /translation="MVPPSPGGNSPMNGSGTVHDPGATYYQPPGPAAGPAHDDDAPVYV
FT                   ISIAAQLAGMHPQTLRSYDRLGLVTPGRTAGRGRRYSARDVALLREVQRLSQEEGVNLE
FT                   GIRQILHLGAQVVALQAQVRQLAEELAEARADADRRVAEAHASHRRDLVPIERGAVVVW
FT                   RPGHRR"
FT   gene            complement(283089..284270)
FT                   /locus_tag="Franean1_0231"
FT   CDS_pept        complement(283089..284270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0231"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: DnaJ central domain protein; heat shock
FT                   protein DnaJ domain protein; chaperone DnaJ domain protein;
FT                   KEGG: fal:FRAAL6641 heat shock protein (HSP40),
FT                   co-chaperone with DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09698"
FT                   /db_xref="GOA:A8LDT3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT3"
FT                   /protein_id="ABW09698.1"
FT                   /translation="MSVRDMVEKDYYAALGVPKDASAADIKKAYRKLARELHPDKNPGD
FT                   VKAEARFKEVSEAYDVLSDENRRREYDEARALFASGSYPGAGGRGGGMGGFGTPGGYGP
FT                   GAGNLNLDDLLNGNGGGGLGGIFDNLFQRTPTGRAPRRGTDIAAEVTISFEKSLTGLEA
FT                   TVRLPGAATCATCAGIGARPGTSPRTCPVCRGLGVISRSQGGFALSEPCRDCLGKGSLI
FT                   DHPCPDCHGTGRREREQRIRIPAGVSDGQRLRVRGRGSPGERGGAAGDLEVTVHVQSHP
FT                   VFGREGHNLTINLPVTITEAALGASVKVPTIDGTPLTVKVPAGTSSGRRLRARNRGVPR
FT                   PGGENGDLIVTLEVTVPKPSELSPKARTALQEFARAHPEDPRESLIAQMEGRA"
FT   gene            complement(284442..285278)
FT                   /locus_tag="Franean1_0232"
FT   CDS_pept        complement(284442..285278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0232"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: fal:FRAAL6640 heat shock
FT                   protein (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09699"
FT                   /db_xref="GOA:A8LDT4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT4"
FT                   /protein_id="ABW09699.1"
FT                   /translation="MTSAHGEHRLDDSRAGGDGGPEEPIVKDRRRIDPETGQVRGSAAG
FT                   AATPGAEPMGPAGAGPADSDSELVASLRGQLGERTADLQRLKAEFDNYRRRAARERDAA
FT                   GDQAVSKLLGGLLGVLDDIGRARDHGDLEGPFKAIAESLETALESTGLERFGTPGEVFD
FT                   PHLHHALMHSYRSDVSETTCVEIFRAGYRRGNAVLRAAQVAVAEPSEDGGDALYEDGPD
FT                   AGISDRVTEVGPPGEYDAAEGQPAAGASPGRENAPLPDDTGSVPGPDRGGPTVSAD"
FT   gene            complement(285275..287113)
FT                   /locus_tag="Franean1_0233"
FT   CDS_pept        complement(285275..287113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0233"
FT                   /product="chaperone protein DnaK"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: fal:FRAAL6639 chaperone HSP70 in DNA
FT                   biosynthesis/cell division; TIGRFAM: chaperone protein
FT                   DnaK; PFAM: Heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09700"
FT                   /db_xref="GOA:A8LDT5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT5"
FT                   /protein_id="ABW09700.1"
FT                   /translation="MARAVGIDLGTTNSVVSVLEGGEPTVIANAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVERTIRSVKRHMGTDWKMTVDSKEFTPQEISARILQKLKRDAE
FT                   AYLGESVSDAVITVPAYFDDAQRQATTEAGTIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGDGVVEVKSTSGDTQLGGDDWDQRITDHLIKTFNGQHGV
FT                   DLGKDKMALQRLREAAEKAKIELSQSTQTSINLPYITASAEGPLHLDVSLSRAELQRMT
FT                   QDLIDRCKGPFQQAVKDAGIKISDVDHVVLVGGSTRMPAVVDLVRELTGGKEPNKGVNP
FT                   DEVVAVGASLQAGVLKGEVKDVLLLDVTPLSLGIETKGGIMTKLIERNTTIPTKRSEIF
FT                   TTAEDSQPSVQIQVFQGEREMAAYNKKLGMFELTGLPPAPRGMPQIEVTFDIDANGIVH
FT                   VSAKDLGTGKEQSMTITGGSALPKDDINRMVQDAEQYAEEDRQRREEAETRNRAESLVY
FT                   STERFLAENGDKIEAGVKSDVEEKLSTLRGAVGGTDIAAIREAADELTKASQAMGESMY
FT                   AQAAGAQGAPGAPGAGAGQADDDVVDAEIVDEEDKK"
FT   gene            complement(287131..287700)
FT                   /locus_tag="Franean1_0234"
FT   CDS_pept        complement(287131..287700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09701"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT6"
FT                   /protein_id="ABW09701.1"
FT                   /translation="MGESWLSLNRRAFLDLAPPGAPGLSWRLLAVIGACPQAARPGAWR
FT                   LQSPAIPVTPDAPRPRGSRGGTGPASGVTSRPHKVILAVSDPASPSDGAILSGQDSGSP
FT                   GYPKSVHPESTVLKSAPGAGARDRNRVATRDSSATATPPQSHHQHPHHQHPHQRSRAHD
FT                   RRFGAGRSPGLTPTRASRRSPPGGPA"
FT   gene            complement(287881..289170)
FT                   /locus_tag="Franean1_0235"
FT   CDS_pept        complement(287881..289170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09702"
FT                   /db_xref="GOA:A8LDT7"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT7"
FT                   /protein_id="ABW09702.1"
FT                   /translation="MATSTRPATPRAGRPGFSQHTEYLRARENQAMVRRDRLAREVPRA
FT                   AIRAAVVGMGLGLVIGFGLGLPGLGVAVFVVLLIVWPGGIAVAAFGVSPDVETLREAAE
FT                   AERKTARAISRLRRHGYVIMHDRAVPYSQATIGHLLIGPGGVMILGSDTNKGIVRYAKG
FT                   GAMVDGESLKPAIDKTSWLGGEVRNQVRAALPTTKIPVYPVLVMVEASVLWSDGALDGV
FT                   TIISVKDVVKYVRSKPGRLNPGQVQQVLAAAQRLFPPYSSNRLAEHVVVDRDQWLTLMD
FT                   ALRTIRERGGDASEMLERLAQIEADLGRQADLIDRAGMPLARAADQPDGPTDSPPPASG
FT                   TDTATDAIGLLDVDGTGTAKSLEGPPRARPGEGRRGRILAAVRQPRGSESISTSSRPPG
FT                   GDGPTTAKGDQPPAPGDDRAHPTSGPGSGS"
FT   gene            complement(289198..289536)
FT                   /locus_tag="Franean1_0236"
FT   CDS_pept        complement(289198..289536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09703"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT8"
FT                   /protein_id="ABW09703.1"
FT                   /translation="MSGRQPPEPRLSAPSVLIWPPHEPQVGPHGPITGWHVLWHSAGRR
FT                   PVARGSSRALMSTLVMTMSLPAPWVGASVRAVTGSRRDQVGPEVSVGRLQRCRDDARRA
FT                   PENGLQPR"
FT   gene            complement(289568..289963)
FT                   /locus_tag="Franean1_0237"
FT   CDS_pept        complement(289568..289963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09704"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDT9"
FT                   /protein_id="ABW09704.1"
FT                   /translation="MLTGVDRRQPVPPGDAASLPVPAGNFLSATAAPPLAINAERSAAT
FT                   ATRATAIGPTPKRKPSRDRTTRDERSDQRHVTIIGRASPPLRKPHNDTIRGGSRWPSPL
FT                   DSPPLTPNTPDPATAWSEWGGIGDLLG"
FT   gene            289991..292210
FT                   /locus_tag="Franean1_0238"
FT   CDS_pept        289991..292210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0238"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224 cysteine-rich
FT                   region domain protein; KEGG: fal:FRAAL6636 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09705"
FT                   /db_xref="GOA:A8LDU0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU0"
FT                   /protein_id="ABW09705.1"
FT                   /translation="MRIAIGLAITLIALAVAGRRVFWLTRLIRSGQPAEGRLDDLPTRI
FT                   WTEISEVGGQRKLLKWSVPGLAHAFTFWGFTILGLTIVEAYGALFDHDFHIPLFGHWAA
FT                   IGFLEDFFAVAVLAGLITFTAIRLRNAPARLDRKSRFYGSHIGPAWVILGMITLVIVTL
FT                   LITRGAQFNAGTHPQGDTKWAFASWLVSLPLDAFSEHTNEHIETVFLLLNIAIIMGFLV
FT                   LVVYSKHLHIGLAPINVILKREPVALGPLGTTPDIEKLMEEDEPIVGVGKVEDFSWKAM
FT                   LDFSTCTECGRCQSQCPAWNTGKPLSPKLLIMDLRDHLFAKAPYLLAPKGAEDGESAEE
FT                   TTKAATSASEDGSGKHKVHHVPESGFGRVPEPGQPQVDRPLVGTAEEGGVIDPDVLWSC
FT                   TNCGACVEQCPVDIEHVDHIVDMRRYQVMIESAFPSEAGVMLRNLENNGNPWGVSPRSR
FT                   TEWTDGLPFEVRILDEGEQIPDEVEYLYWVGCAGAIEDRAKKVARSFAELLHTAGVEFA
FT                   ILGSQESCTGDPARRLGNEYLYQEMAKANIELLNETGVKKIVATCPHCFNSLAREYSSL
FT                   GGTFEVVHHTQLLGKLVEERKLVPITPIDSSVTYHDPCFLGRHNKVYTPPREILEAIPG
FT                   IRGQEMHRCKDRGFCCGAGGARMWMEEKIGKRVNVDRMEEALGLDPDVVSTACPFCIVM
FT                   LSDAVTEKKLAGEAKESVEVLDVSQLLARSLVAPTPTPAAEPLSS"
FT   gene            complement(292294..292899)
FT                   /locus_tag="Franean1_0239"
FT   CDS_pept        complement(292294..292899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0239"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: fal:FRAAL6635
FT                   2'-deoxycytidine 5'-triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09706"
FT                   /db_xref="GOA:A8LDU1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LDU1"
FT                   /protein_id="ABW09706.1"
FT                   /translation="MLLSDRDIRAEITAGRVRLDPYDEGLIQPSSVDLRLDRAFRVFQN
FT                   HRYSHIDPAVEQEDLTELVAPEGDEPFVLHPGEFVLGSTLEVVTLPEDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVATLPIKLWPGMKIGQLCLFRLSTPAEHPYG
FT                   SAIYGSRYQGQRGPTPSRAYRDFTRAAVPEIPNGSHGA"
FT   gene            293188..293994
FT                   /locus_tag="Franean1_0240"
FT   CDS_pept        293188..293994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0240"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   fal:FRAAL6634 glucose-1-phosphate phosphodismutase;
FT                   beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09707"
FT                   /db_xref="GOA:A8LDU2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU2"
FT                   /protein_id="ABW09707.1"
FT                   /translation="MLGLPDHIEACLFDLDGVLTRTAAVHAAAWKEMFDDFLENWARRS
FT                   GDPFVPFDIATDYADHVDGRPRIDGVRAFLDSRGIHLPPGAPDDPPSGMTIQALATRKN
FT                   ILLLEKLKEMGVEVFAGSVRYLEELERAGVPRAVVSSSANCAEVVRAAGIEHLLLARVD
FT                   GLVAEERGLAGKPAPDTFLAGAEALGVAPGAAAVFEDAIAGVQAGRAGGFGYVVGVDRV
FT                   GHAEALRGNGADRVVEDLAELLGGGSTGPASAGSASAGPVTGGGDA"
FT   gene            293991..296393
FT                   /locus_tag="Franean1_0241"
FT   CDS_pept        293991..296393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0241"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   fal:FRAAL6633 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09708"
FT                   /db_xref="GOA:A8LDU3"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU3"
FT                   /protein_id="ABW09708.1"
FT                   /translation="MIVRPSYPIESWSLTEHGLDIDDLARSESLFSLSNGHVGMRGNLD
FT                   EGDPHGLPGTYLNSVHELRPLPYAEAGYGYPESGQTVINVTNGKIVRLLVDDEPFDVRY
FT                   GDLLAHTRTIDFREGVLRREADWVSPAGQRVRIRTQRLISFSQRSAAAIHYEIEPVGDT
FT                   ARIVIQSELVANEQLPGRRGDPRAAAVLESPLISERHRARETMVELVHRTRHSDIRVAA
FT                   AMDHIFDGPRSLGVTSESEPNTGWVTATAVLKPGETLRMVKFLAYGWSEQRSLPALRDQ
FT                   ATAALVAARQTGWDGLVAEQRAYLQDFWNRSDVEVDGDAEVQQAVRFALFHVLQAGARA
FT                   ERRAIPAKGLTGPGYDGHAFWDTESYVLPVLTYTAPAAAADALRWRHSILPLARERAQL
FT                   LNLDGAAYPWRTIHGEECSGYWPAGTAAYHVNADIADAVLRYLWATEDEQFELEVGLEI
FT                   LIETARLWRSLGHHDLSGRFRIDGVTGPDEYSALADNNVYTNLMAQRNLIGAADAVRRH
FT                   PERARAFGVDAETAANWRDAADDMFIPFDERLGVHPQSEGFTEHQVWDFERTRPEQYPL
FT                   LLHFTYFDLYRKQVVKQADLVLAMQRRGDAFTAEQKARNFAYYEALTVRDSSLSACCQA
FT                   VMAAECGHMSLAHDYLREAAFMDLKDIEHNTGDGLHMASLAGSWIALVEGFGGLRDTGE
FT                   LLSFSPRLPEGLSRLAFGLRVRSRQLRVEVLESSATYTVLEGEAITILHHGEKARVSPD
FT                   QPCKLDVPPVPAQERPRQPAGREPLRFLHHGNGTEVTRAADLHPVDG"
FT   gene            296491..296564
FT                   /locus_tag="Franean1_R0004"
FT                   /note="tRNA-Gly1"
FT   tRNA            296491..296564
FT                   /locus_tag="Franean1_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(296616..297503)
FT                   /locus_tag="Franean1_0242"
FT   CDS_pept        complement(296616..297503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0242"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL3306 putative serine/threonine-protein kinase
FT                   PkwA; WD40 domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09709"
FT                   /db_xref="GOA:A8LDU4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU4"
FT                   /protein_id="ABW09709.1"
FT                   /translation="MMIDRARVAAALPGYELGDQIGAGAFGLVLAGWHRNLHRDVAIKV
FT                   LSARGHDRAAAGSAIEARLLARFDHPHIIRVHDYVAADDLHLIVTEMMAGGTLTSHQAD
FT                   ITQQGACAIGLAVACALSYAHSQGVLHRDIKPDNMLFDTAGLLKVADFGIAKLLDGAAA
FT                   TVNTVIGTPLFMAPEQVAGARLGPATDLYALAVVLYLLLTGTAPFDPAPTLDRATPAPD
FT                   GVPAPVMRIVLSALNRKPAARPPSAHTFAVDLARAAAHTHRAPRQDPPQGGRTTPTSQP
FT                   GPPLGGPGVAPRKK"
FT   gene            297807..298133
FT                   /locus_tag="Franean1_0243"
FT   CDS_pept        297807..298133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0243"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   fal:FRAAL3370 FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09710"
FT                   /db_xref="GOA:A8LDU5"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU5"
FT                   /protein_id="ABW09710.1"
FT                   /translation="MGVSIETLSQGDGKTFPKKGDRVTIHYVGTLRDGRQFDSSRDRGA
FT                   PFVTEIGVGRVIKGWDEGVPQLSLGEKAVLTITPDYGYGPGGFPPVIPPNSDLFFEVEL
FT                   LAIN"
FT   gene            298302..298592
FT                   /locus_tag="Franean1_0244"
FT   CDS_pept        298302..298592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09711"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU6"
FT                   /protein_id="ABW09711.1"
FT                   /translation="METKCRVPRVGEDDVTRGHSGGLGGLGEVLRRLGEGASQVRAALD
FT                   RGDQERQCGQVPPPARAGGCRIRIDAGTSGQVDVKQAESPGGQGRSPGCAP"
FT   gene            complement(298650..300521)
FT                   /locus_tag="Franean1_0245"
FT   CDS_pept        complement(298650..300521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0245"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG: sco:SCO4377
FT                   putative serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09712"
FT                   /db_xref="GOA:A8LDU7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU7"
FT                   /protein_id="ABW09712.1"
FT                   /translation="MRSTPPRTAGSDPHPPPSGGHAPQPASFPPETPTRGTSAAGGTFT
FT                   RAWDAVFTPLTAHDPDEISGYPLRARIGEGGMGAVYLSHTPGGRPLAVKVVRPEFAADP
FT                   DFRARFTKEVAIAQRVQGPYTVPVIDADPDAVRPWIATAYVPAPSLAIAVARTGALPAT
FT                   TVLMLIAGVAEALQSIHRVGVIHRDLKPGNVILAADGPRVIDFGVARALDAATAAMTQT
FT                   GARLGTPAFMAPEQVRGAQLDRSGDIFALGATAYYAMTGRPPFGVDAAVFHRIEHQQPD
FT                   WDDCPPQVRDVLARCLEKDPARRPTPTELIELCRLITPIGQLTSDEQLTTGAGWLPPTV
FT                   AAEVTRYHLAPLPTPPPTPAPSPAFAEPPTAAPAGAGGVAAGGAPRRSGHGRRPWLVGA
FT                   IGAVAFVVVCALAAVLLTRSDEPSPSAPMVASAVNGPTADPARPPSDPKAGVPGPVAPG
FT                   PGLPVPGAPPGGLGAGAPGSPPAGAGGPTAPLTPPPAATMPGATAPQAPAPTPKPAPSS
FT                   TAVSGCPGSPDHGYNGDGYGVLTEATSLRSGPYAACGAVASLAQGKKVWLHCSVVNGHN
FT                   NLWWWARLDGSTTAGWIYDGSLKLSYVDDNDDGRTRIYSCDGTYVNR"
FT   gene            complement(300704..301759)
FT                   /locus_tag="Franean1_0246"
FT   CDS_pept        complement(300704..301759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0246"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   msm:MSMEG_3559 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09713"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU8"
FT                   /protein_id="ABW09713.1"
FT                   /translation="MSAQATPPATARTPAAAARTPWAPDRSALRGRVAVVAGATRGAGR
FT                   GIAAALGEAGATVICTGRSSRTGVLRSDYDRAETIEETAELVTKLGGAGIAVPVDHLDP
FT                   EQVRRLADRVRAEHGHLDVLVNDIWGGEVLKGGPSEWDTPVWEHDLDRGMRILRLAVDT
FT                   HLITSHHLLPLLIDRPGGLVVEVTDGTTDYNAANYRISVYYDLAKVAVNRLAFSQGHEI
FT                   ASHGGTAVAVTPGWLRSEMMLEAFGVTEETWRDALTPPDSASPSGAPPSGAPPDFAFSE
FT                   SPRYVGRAVAALAADPGRARWNQRSVTSGRLAAEYGFTDVDGSQPDIWPRLERPAEAPA
FT                   PAAGQEPHPRR"
FT   gene            complement(301785..302174)
FT                   /locus_tag="Franean1_0247"
FT   CDS_pept        complement(301785..302174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0247"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fal:FRAAL2474 putative MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09714"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDU9"
FT                   /protein_id="ABW09714.1"
FT                   /translation="MSPDTPQPPSTARPGRSYHCHVEVTVDVIGGKWTPVVLAHLKEHD
FT                   RLRFAQLRRLIPDITEKMLAQRLRELEAIRIVDRIPVSTAPPHVEYALTAQGRSLGPVL
FT                   QAMWEWGRDWAATNRLAVDPVQFRR"
FT   gene            302323..303096
FT                   /locus_tag="Franean1_0248"
FT   CDS_pept        302323..303096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0248"
FT                   /product="globin"
FT                   /note="PFAM: globin; Antibiotic biosynthesis monooxygenase;
FT                   KEGG: fal:FRAAL2473 conserved hypothetical protein;
FT                   putative dimeric alpha+beta barrel and globin domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09715"
FT                   /db_xref="GOA:A8LDV0"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV0"
FT                   /protein_id="ABW09715.1"
FT                   /translation="MIVEYIRYRIPEHSTDEFEKAYSRAAAVLERSRNCLSFELTRCVE
FT                   TNVQYILRIQWDSVAGHLDGFRRSAEFREFLAQIGSYVEHIEEMQHYSPTAVAGRGGGA
FT                   PEPPTLYEWAGGAEAFERLLTRFYEIVVEDDLLAPLFAGMNPAHAHHVAMWLGEVFGGP
FT                   AEYTEKRGGYENMLAHHVGRAITEPQRRRWVSLLVDAADEVGLPGDPEFRAAFMGYVEW
FT                   GTRLAVENSTPGATPMPHAPVPRWGWGVAPPWQPS"
FT   gene            complement(303104..304078)
FT                   /locus_tag="Franean1_0249"
FT   CDS_pept        complement(303104..304078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0249"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix type 11 domain protein; KEGG: sma:SAV6536
FT                   DeoR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09716"
FT                   /db_xref="GOA:A8LDV1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV1"
FT                   /protein_id="ABW09716.1"
FT                   /translation="MLETSARLLRLLSLLQTHRDWSGADLADRLGVTARTVRRDVDKLR
FT                   SLGYPVHAAPGTAGGYRLGAGAQLPPLLLDDDEAVAVAVSLRTAAGGSVEGIAESAIRA
FT                   LTKLEQVLPTRLRHRVLALHSVTVSLRGTNPAAVDPDVLMAVATACRENQQLRFDYRDH
FT                   NGIPTARITEPHTLVHTGWRWYLIAWDVGRGAWRNFRLDRIAPKTPTGPRFTPRDPPAD
FT                   DIQAYTSWSVSTAGYRYQARVRYHAPAGVIAASLSPTSAVIEALDDESCLVRTGSNSLD
FT                   ALTIYLSLVDADFDVLEPPELVDRVRELAGRLARAAPPPPPTG"
FT   gene            304371..305261
FT                   /locus_tag="Franean1_0250"
FT   CDS_pept        304371..305261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0250"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   fal:FRAAL6624 conserved hypothetical protein; putative
FT                   glucosamine--fructose-6-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09717"
FT                   /db_xref="GOA:A8LDV2"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV2"
FT                   /protein_id="ABW09717.1"
FT                   /translation="MCHLFAMSSGSERIQATFWLLDAPDSPRAQTRRPPDGAGFGFFDD
FT                   EGRPEVVRQAIRSRADTAFAREAQQVTSSTFVAHVRHASTGRVDDRNTHPFVQDGRIFA
FT                   HNGVIEGLGKLDAELGTTGSGVLGDTDSERYFALITREIAARDGDVAAGITAAANWIAE
FT                   NLPLYSINMILASGDDLWALRYPDTNGLHVLQRAPGGRNNRHLDHASPFSEIRVRSVDL
FT                   TTRPAVVVESERMDEDPRWRLMASGELLHVGPDLKVTSSIAVAGPPAHPLTLDDLRPEA
FT                   AASQTTAVPDLPVSA"
FT   gene            305715..306239
FT                   /locus_tag="Franean1_0251"
FT   CDS_pept        305715..306239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09718"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV3"
FT                   /protein_id="ABW09718.1"
FT                   /translation="MSPRVVMVGSGPSPLEPPPWWHPGHPGAALPKHRVRKAGQIRNTG
FT                   QVRDTSQIRKGRSSAQRRVQALAGPKAADRLDESSHRMAGWWGRLSSGIPASGRNTRHR
FT                   TPRIRGRWCHRRPLTDMKDIDDLRRHQRPRWTEWTARTGSSDRKGTDVPNRRGDIPIRT
FT                   TSRREEDRGIG"
FT   gene            306334..307206
FT                   /locus_tag="Franean1_0252"
FT   CDS_pept        306334..307206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09719"
FT                   /db_xref="GOA:A8LDV4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV4"
FT                   /protein_id="ABW09719.1"
FT                   /translation="MPAGQWPRGTAERRDTAQELEELGYEMVWLGGATADLELPAALLE
FT                   STENLCVGTGILNIWTEPVDLLADTYGMLEKAHPSRLLLGVGTGHAKRVEATTGRRYHH
FT                   PYGAVLSYLDALDAVGIPVSVRVLAALGPRMLGLAAQRAAGAHPFLVTPEHTRMAREIL
FT                   GDGALLAPEQKIILEVDADRARAIGRAALAVYLDLPNYTNNLRRLGFTDADLAGGGSDR
FT                   LVDALVAWGNMDTIRARLDEHRAAGADHVCAQILTGSRELPREQWRDLAAGLDLRPRAG
FT                   AGAAHGTGP"
FT   gene            307361..307921
FT                   /locus_tag="Franean1_0253"
FT   CDS_pept        307361..307921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgr:MGG_05575 predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09720"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV5"
FT                   /protein_id="ABW09720.1"
FT                   /translation="MPADRFSLDEAARTGAIRTPAAPTLVGPADASARPTPSAPAEVPA
FT                   TPAPAGKPDGSEDAPRPRAAADASCEVSAAGPAQTPSAPVAAVADGPASGPASFLSESG
FT                   GLLDSLMTGMDVGERSRMLGMISSSVEAEREAALDGRIRRQVDVGPRHRRRREPGQEPD
FT                   PASAGAGPDDVSDPAERSRRADR"
FT   gene            307918..308355
FT                   /locus_tag="Franean1_0254"
FT   CDS_pept        307918..308355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0254"
FT                   /product="Sulfate transporter/antisigma-factor antagonist
FT                   STAS"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: fal:FRAAL6621 putative anti-sigma
FT                   factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09721"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV6"
FT                   /protein_id="ABW09721.1"
FT                   /translation="MIPEGFLVALDDPMALKITVRLNPWGATAALDGDLDMATEAPARA
FT                   ALDAVLTAVAARRTHSPGPVGPVGLVLDVSRVFADVRGLTVLHRLWRAGERRAVAVALS
FT                   GAGPLLRRMVELLTSPGVPLYPDVAEAWNALLTMSERVERV"
FT   gene            308413..309117
FT                   /locus_tag="Franean1_0255"
FT   CDS_pept        308413..309117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0255"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: fal:FRAAL6620 putative transcriptional activator
FT                   protein TraR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09722"
FT                   /db_xref="GOA:A8LDV7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV7"
FT                   /protein_id="ABW09722.1"
FT                   /translation="MEIDKARLDTSLTRLHHLVPERVELGELLSEAVRAITDVFGLDGA
FT                   GILVVDADRALRSVAASNSSGRLLEQVQEELGEGPCVESFVLDELVVSPDLAGEPRWPQ
FT                   ARPRLLAGGVRAVLGVPIRMGGGPIGTLNVADDSPREWTSAEREALERFGQVLESILLA
FT                   GMVADRSTKLARQLQFALDYRVPIDRAVGYLMAVWDTDAVTAFERLRRAARSSRRRVSE
FT                   LAEEILAGRVRL"
FT   gene            309460..310581
FT                   /locus_tag="Franean1_0256"
FT   CDS_pept        309460..310581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fal:FRAAL6619 putative ABC transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09723"
FT                   /db_xref="GOA:A8LDV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV8"
FT                   /protein_id="ABW09723.1"
FT                   /translation="MIEARGLTKRYGRTVAVNDLTFTVQPGKVTGFLGPNGAGKSTTMR
FT                   MILGLDHPSAGKVLIGGRRYRELKEPLREVGALLEAKWVHPNRSARAHLRWMAASNRLP
FT                   AKRVDEVLEIVGLTAVAGRRAGGYSLGMAQRLGIAVALLGDPGVLLFDEPVNGLDPEGI
FT                   LWIRQFMHRLADEGRTVFVSSHLLSEMALTAQELIVIGRGRLIAQTSTKEFINSASDSS
FT                   VRVRGPEMERLHGVLTGQGLAVQETPAATDTPAALVVRGSSTEQVGELAGAVGLVLHEL
FT                   SESRGSLEQAFIQMTGGDVEYHAGGVGPTGPLVGTGPAGAPGALGVPGPQPGAVPAPTS
FT                   PGATPAGPSGPGGPSIPAPTSPGTDAWTGVNKP"
FT   gene            310578..311339
FT                   /locus_tag="Franean1_0257"
FT   CDS_pept        310578..311339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09724"
FT                   /db_xref="GOA:A8LDV9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDV9"
FT                   /protein_id="ABW09724.1"
FT                   /translation="MTLLTVERIKLFSTRSPWWCMILAVALTVGLTAVFSAATKPSDLA
FT                   DLTPSVTQFAYNFGLVVMMVMAALAVTTEYRFGTIRSTFLAVPSRTPALLAKTVVVAGL
FT                   AGIVGEITAVASWGIARLIQPDAPLVLNTSQEYRNVFGIGLIYLLAAIFAIGLGLLIRH
FT                   TAGAIVVMLVYLFLAESLLPVIPRIGDHIQDWLPFIVGNNFIVAGQPETSDGPPVVEGL
FT                   PFGPWGSLIYFAAVCLGLLVIGLAAAKRRDA"
FT   sig_peptide     310578..310688
FT                   /locus_tag="Franean1_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.428 at
FT                   residue 37"
FT   gene            311560..314049
FT                   /locus_tag="Franean1_0258"
FT   CDS_pept        311560..314049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6617 hypothetical protein; putative
FT                   membrane protein; putative efflux transport protein (PET
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09725"
FT                   /db_xref="GOA:A8LDW0"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW0"
FT                   /protein_id="ABW09725.1"
FT                   /translation="MRQLWWRGAGRPRLFGAFDSDPGHFCLTSAARVAIVAPALLALVS
FT                   TLVGDVRMSLFAWFGAYALLEFVDFDGPRPARLTAYLTLATTGAGMVVLGTLGSRSPWL
FT                   AASMTAVVAFVVMFSGVLNAKVAVAGRSALLAFVLPVMTPGPISAIPERLVGWGLASVA
FT                   SITAAMLLWPRRPPDRLRAETADVCHALATAVSWQPQVPDPPAAVSRGPAADVSRRPAP
FT                   DLWPALRRLRRQFVATAHRPTGVGGRAAALGHLVVDVNWLVPFALPWPERDRTARACFP
FT                   AEAAELHAAVTATLRAAATRIEPSDHGRPRPRPRPRADGGGGGMRVGDDRLGIARLERS
FT                   ERAMRSALLRQLREPAPACPPDLAAAEAFRLRRLARGARELALNVLRVTGPLPPRPPAS
FT                   PVRRAVDAFHHARRLVRERGTAATDLAAGYASPRSVWFRNSVRGSLGLTTAVIIAQAAG
FT                   LQHGFWVVLGTLSVLRSNAMATGSAAVRALAGTGVGIVVGGLFVVAVGTHTAVLWAVLP
FT                   LAVLLGSYSRRRSGFVLGQAGFTVSVLMLFNIVEPAGWRVGIVRIQDVMIGFGVSIVVG
FT                   ALLWPRGAVAVIRTRAESAYRSAVTFLDLVVPHAPGAPEHPAVAPAAREAIRAGRLLDD
FT                   AVRQFLAEQPPGRFDVDALMTIVAGALRIRRTAQLLWNGDVPWPPDLTPDLPRATGAGR
FT                   AEATGFAVAQGILIEDMRDLCRWYTAYATALGAARRPPEPEAGSGRAATAGLIMIHRAA
FT                   RAHRCPEILAGAALTSRAAYLDILRDLQPRLTAAATALDQTSDGGRDRPRKPVDQAPGP
FT                   QGSRPAPERSRAFIRAS"
FT   gene            complement(313980..314747)
FT                   /locus_tag="Franean1_0259"
FT   CDS_pept        complement(313980..314747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09726"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW1"
FT                   /protein_id="ABW09726.1"
FT                   /translation="MAIRRRTGVGFGRMFAVELTTPAVHPPRTISVFVVHRVLLRRRPR
FT                   ATPIVPVASGGPSKIGLIVSGPAGHARTVTSAHAPNTAGRHDRHTSWAAQKPTARAAPT
FT                   PPPSSATPATPAEPAADRTVPQVDDATSAAAGKLSEALEWVERARGALYSFHQLSGRAD
FT                   LILGEALDALREAGHPRLAAEVRRELHGRNVLDGRWTFQIVEEYDDLYYRPFVSTEERV
FT                   RALLTDGQRHVYEARMKARERSGAGRDPWGPGA"
FT   gene            315208..315296
FT                   /locus_tag="Franean1_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            315208..315296
FT                   /locus_tag="Franean1_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(315411..316859)
FT                   /pseudo
FT                   /locus_tag="Franean1_0260"
FT   gene            complement(316856..317458)
FT                   /locus_tag="Franean1_0261"
FT   CDS_pept        complement(316856..317458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09727"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW2"
FT                   /protein_id="ABW09727.1"
FT                   /translation="MCQDASVAPSEGQPGNGGWVRINDPRLPGWLYVRFEPDDRGRLRP
FT                   RDLFLEGADEPITARHLRSVPLEDAEAWANGMRGQDSVAGRLPIVAPDLRGYAATFATT
FT                   YGKPVSAPTKKAPPRPPIPDAPTVERAPLRRPEGRALPDAFLEEVAGAYSALAQNGQKP
FT                   APVIAAEAEVPVTTVHRWIKEARRRGLLAPARRGATG"
FT   gene            317552..317767
FT                   /locus_tag="Franean1_0262"
FT   CDS_pept        317552..317767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_7031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09728"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW3"
FT                   /protein_id="ABW09728.1"
FT                   /translation="MVVPRDADAGPTRLLYRPEGAARQLDMSRAKLFRLLASGQIDSVK
FT                   IDGIRRIPHSSLVAYVERISAEQSAA"
FT   gene            318039..318338
FT                   /locus_tag="Franean1_0263"
FT   CDS_pept        318039..318338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09729"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW4"
FT                   /protein_id="ABW09729.1"
FT                   /translation="MSPPNGERRPGMGSQSGARVSAASDDRSQRNPRAQVEVTDTDVRV
FT                   IAKFSPDLRDGLRTLGAHWVPGHWSVPVEHRAEAVEIVADILGAPVVDDLRGGR"
FT   gene            318335..320977
FT                   /locus_tag="Franean1_0264"
FT   CDS_pept        318335..320977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4830 putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09730"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW5"
FT                   /protein_id="ABW09730.1"
FT                   /translation="MTAAAPLERFADAYTAATGWGIDPTRAQQDVRCPAHPDGSPSLSV
FT                   GTGRDSRVLLTCQAGCDLDAITAAVGLVQADLFPPRDEQVKPQIVASYPYTDEQGTLLF
FT                   TVHRKEPGKDGARKQFVQQAADGSWKTRDIRKPLYRLPDVVEAVKNGTTIYVVEGEKDA
FT                   DRLAGCGLAATTCPQGAGKWKPEHTTTLDGAADVRIVADDDGPGHKHAAHVEAALRPVV
FT                   RSVRMLLPAAGKDVSDHLNAGHGLDDLRPLVDDEGQAPAAAPPAATDGGKGERGPSQAS
FT                   QLVTLARERYELFMSEDGRPYGVKTDGPNIALPLRGRAGLRSQLARIYTDTSGGAVPSA
FT                   SALADAMTVLEGIAQSVDPRVPHLRVARDDDGRIVVDLGASDGRCVIVGPAGWERAGRS
FT                   PVLFRRSGAMKPLPDPVRDGDGLAKLRGLLNTTEAGFRLLVAWLVAAFIPGIPHPILTF
FT                   RGEQGTGKSYSAKMVIGIVDPSGAPKRTAPRDIKSWATQAFNSWALCLDNVSIVPDWLS
FT                   DALCRAVTGDGIVDRALYTDDDVVVLEFRRVLAMTTIDAGALNGDLAERLLTIELRLIP
FT                   DSARREEADLDAAYADAHPAILASLFDLLAKVLKALPDVVLTERPRMADFARVLAAVDK
FT                   VTDWKTLESYKDTARDAVADVLDGEPFAKAVVELVDRSGPDGLLLTASELLEKVATPDR
FT                   LPKKWPKDATRASGQLKRLAPALRTIGIDVDDSQRGPKPKKQRLLRLTASTERRCETAV
FT                   PASPDGQNGPLTWENRGDASESFTASPLDAWGDAVDVEGDADPFVASPHDTGSDLHEYG
FT                   RGDAGTAGDAEMHPLSEQVTTGVVLHIADHAPTDIPPGAAGPCVTCHRTTRRYGAGGNP
FT                   RCPRCREAS"
FT   gene            321432..322007
FT                   /locus_tag="Franean1_0265"
FT   CDS_pept        321432..322007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09731"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW6"
FT                   /protein_id="ABW09731.1"
FT                   /translation="MTTTENVVHDHRFTCGLCRLATEMVSEDEHRHHVEAFGRLGAADV
FT                   ELLDNLDAARALSDYVSRIFRIEACFDSWDNDQSLILFNSKSPGDVEPIGDVARRYLEM
FT                   ARTWYDAAAALADDLGAPYWVPGIPDNPLREITEAAIAEALSARNKVLVSWARLTLGTA
FT                   GPTPTIVGEHVETDSTAVLVRGSALRTA"
FT   gene            322084..322320
FT                   /locus_tag="Franean1_0266"
FT   CDS_pept        322084..322320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09732"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW7"
FT                   /protein_id="ABW09732.1"
FT                   /translation="MIKSSSITVCAECEWRTRFAFHATDEAFQGHTDHTMPMISAHLES
FT                   TGHAVRTTVTTYQSGPDGEDETTVIRIGPKIAA"
FT   gene            322364..322633
FT                   /locus_tag="Franean1_0267"
FT   CDS_pept        322364..322633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09733"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW8"
FT                   /protein_id="ABW09733.1"
FT                   /translation="MEVLMHDRIAHDVQPVHPVAVEVARRALATVTRHARGPEDLALLA
FT                   EALGLPLTAGGGPPAPGARTGYVELARAVALVDEGQAPGVEVGL"
FT   gene            322950..323435
FT                   /locus_tag="Franean1_0268"
FT   CDS_pept        322950..323435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09734"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDW9"
FT                   /protein_id="ABW09734.1"
FT                   /translation="MSAGRSGGRSGGFGGVDAADYATLRRRVRGFSADLDKELKKALKA
FT                   AGDIGVQAVRQQIATVPASGSGRTSLRATVARNTRTQVRAKDVRVIQGARGITGKNARG
FT                   LPRRLNQDAPFQHPVFGRGTVSQRPWRHFDKPIESKRAAMTAEAEAALKRAVDRIAE"
FT   gene            323432..323875
FT                   /locus_tag="Franean1_0269"
FT   CDS_pept        323432..323875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09735"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX0"
FT                   /protein_id="ABW09735.1"
FT                   /translation="MSRSTEGGGDAAPSLLRVLVATRQTQGQEPGDFTWAVPGELVRAS
FT                   DICARDEGDPDGSCGCGRSWVGLASGLATTTALVAELAFTRAAYLAAHVDAEAAALIVD
FT                   GLGPMDAEQVEHVEACAADLLDVAAELPVGTVVGHRLDEVIVR"
FT   gene            324319..325530
FT                   /locus_tag="Franean1_0270"
FT   CDS_pept        324319..325530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09736"
FT                   /db_xref="GOA:A8LDX1"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX1"
FT                   /protein_id="ABW09736.1"
FT                   /translation="MYPVRPGAGTRAGDPPGPHRGPDRLSGVRARPLQPPGWCVQGRPG
FT                   EPPRPSAYEDHPAAGHPARAPVPRLVVDHHHHERIITMHQAPDLGDEVRYRAQLWTVTK
FT                   VTGSRVELRRGGGYTAYQYATAHHRELRFERAGSSRWKRPAEPEPFDADGFVRAVVAGA
FT                   VERAQDAAEAYHVANPLLTAYHEGAHAIVADAYGMELIGAWADPSSDRARQGQTDYFAW
FT                   GSTDLARVESAVVALAGKVGERMCPAWRDDQDLVSGHHDDLDQARAVLGDDPAVIRAME
FT                   DQARAILTERAGTLEHLAELLVARGADGVKGAELERILSTPRTRLPSQREDRGHAGQPM
FT                   THWSDRARHGHWCGRSVPCPPGCAETLPYTSAPPPAGLRDLMDRARSAERAGGAYRAAP
FT                   GWAA"
FT   gene            325527..325739
FT                   /locus_tag="Franean1_0271"
FT   CDS_pept        325527..325739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09737"
FT                   /db_xref="GOA:A8LDX2"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX2"
FT                   /protein_id="ABW09737.1"
FT                   /translation="MIAIDAGAIRGRARDVDLARVVLTVLAAAPYLVGWVAARLVTLTI
FT                   AAALFAVTAVALGYRDVRPASKEKK"
FT   gene            325736..326326
FT                   /locus_tag="Franean1_0272"
FT   CDS_pept        325736..326326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09738"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX3"
FT                   /protein_id="ABW09738.1"
FT                   /translation="MTTIMDPVHTHRPISESADPVARAECSWHASAHLVAGLSVGLDPW
FT                   ELDLADPCASLPVLPDTYGGIRQDAVIAAAGRVGERMAPGRLDRPRVTIVCPGDVPAVP
FT                   VQHGLDDEVLEVARLWWRRIDAIGQALEVAGRLAAKDAVALFRADLEALPRYPLGDGEP
FT                   ARLSVRVWGCVEAGDLRGEMAARRHLAALGYGA"
FT   gene            complement(326817..327074)
FT                   /locus_tag="Franean1_0273"
FT   CDS_pept        complement(326817..327074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09739"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX4"
FT                   /protein_id="ABW09739.1"
FT                   /translation="MATACPDREPLRPAPRIPQAPRRPEVHVLPHSGGTTVQIDHGVTA
FT                   AEIGLALQLQVPALAPWLGTAVDEDGVAEMQFGRPGPIPR"
FT   gene            327230..327460
FT                   /locus_tag="Franean1_0274"
FT   CDS_pept        327230..327460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09740"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX5"
FT                   /protein_id="ABW09740.1"
FT                   /translation="MPTVATPADEPARPGDLIDIAGVRALLGVGKARAYQLSRDKSWPD
FT                   PWLDHPQLRLWLRADVEAWLDRHRPGWRDEH"
FT   gene            complement(327682..328056)
FT                   /locus_tag="Franean1_0275"
FT   CDS_pept        complement(327682..328056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09741"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX6"
FT                   /protein_id="ABW09741.1"
FT                   /translation="MSTWKPSPTQRRMDTAWMLTDISRALLGPTEYEELSDSTVELLSR
FT                   LTSVLMGVADACGDRDDRATWAAAGQPEQAPDRDPDINVTDAELIVDVAERMFTGAFRR
FT                   RNDERRAARDRAAEAEQDAA"
FT   gene            complement(328053..328334)
FT                   /locus_tag="Franean1_0276"
FT   CDS_pept        complement(328053..328334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09742"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX7"
FT                   /protein_id="ABW09742.1"
FT                   /translation="MAHRPHWRCPVSVSDFGIGERFEMAQMLSNLAAMAVTVDDSRAEP
FT                   DMLTDAAAIELLPLVRQLDRAIRAHARSDYEHGVAYALLADLNLGGSL"
FT   gene            complement(328301..328534)
FT                   /locus_tag="Franean1_0277"
FT   CDS_pept        complement(328301..328534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09743"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX8"
FT                   /protein_id="ABW09743.1"
FT                   /translation="MSTRLTSSLYIDPTDLAPRFELATLPDLPPQVILPGEIRMSASFS
FT                   AEDQAAAEWFHQLAAVAEQAAAWHTARTGGAL"
FT   gene            complement(328531..329010)
FT                   /locus_tag="Franean1_0278"
FT   CDS_pept        complement(328531..329010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09744"
FT                   /db_xref="GOA:A8LDX9"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDX9"
FT                   /protein_id="ABW09744.1"
FT                   /translation="MGTAQVVLAEAPTPRPGPDPILSKQERTVSHIFSVVAFIATMLLT
FT                   LTRRISPTERARVVIRHAHLAGSGLPVTRADVIADLATLDGRGFPDGKPAVTPDPEPPL
FT                   PDPAPDDIVTLDVAAARLSVSVATIRRYCAPSSGRLIRAGSGVTRASLEAVAATR"
FT   gene            329052..329246
FT                   /locus_tag="Franean1_0279"
FT   CDS_pept        329052..329246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09745"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY0"
FT                   /protein_id="ABW09745.1"
FT                   /translation="MGIPKLWTSKDVAGRLKVSSERVRQLSHRDDFPDPVGEVGHIRVW
FT                   AESDVEEWIKKNRPDKADG"
FT   gene            329996..330460
FT                   /locus_tag="Franean1_0280"
FT   CDS_pept        329996..330460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09746"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY1"
FT                   /protein_id="ABW09746.1"
FT                   /translation="MRDACAGVRQDGPVPPRRSTGRRAIPAPLAPNTAPRAVSVTLPIR
FT                   PGPSAQQALPMPVESSRQPARLRDFPTAMSCGGCAEHWSDLEAAHCRACHQIWPSAVGF
FT                   DDHLVECPAAPEIAPRKPKRIPDQRRRPAEGAEAGPDVPADAARDEWNVA"
FT   gene            330616..331425
FT                   /locus_tag="Franean1_0281"
FT   CDS_pept        330616..331425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6608 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09747"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY2"
FT                   /protein_id="ABW09747.1"
FT                   /translation="MTVCGLLRLDGADVRHSALTGMLAASSIGLPAARRVHLDGPFGVV
FT                   TAADSATGPMPSVLVGPSGLVIVIAEHAADGWVVPGVGSVTVLRPGRSWRPVPLRSLRG
FT                   GKPDGDAVHLGKRRDPGDLGDASGTVDDELGDLGSRGERDRAADGDHGTGVASALMRAY
FT                   RAAGQRALETLGEHLLAIVWEPGRRRMIVSRGGRRADELVVWSDGRYFAFGMERAQVLA
FT                   ARPFGLARPRRLAAGETLPVTVATRIRRPPFVDLPEPRGSEADVPAT"
FT   gene            complement(331468..331896)
FT                   /locus_tag="Franean1_0282"
FT   CDS_pept        complement(331468..331896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09748"
FT                   /db_xref="GOA:A8LDY3"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY3"
FT                   /protein_id="ABW09748.1"
FT                   /translation="MTASSDPVTSRSAAPASGRPATPGGGRSAPAAVRSALLRYQIIAY
FT                   VVGVVLIALVVVGVPLKYLADEPSVVAAIGPIHGVLYMVYLAATLDLASRIRLPSSRTV
FT                   LVMLAGTIPFLSFVAERKIAGLVRAGLAGAAGTGRAPV"
FT   gene            complement(331893..332435)
FT                   /locus_tag="Franean1_0283"
FT   CDS_pept        complement(331893..332435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6606 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09749"
FT                   /db_xref="GOA:A8LDY4"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY4"
FT                   /protein_id="ABW09749.1"
FT                   /translation="MRRILLSPWWLARHALALLLIAFFLRMGVWQWTKGESDHGSMQNL
FT                   FYGVEWPMFAAFVVYWWYRMISEDLRPRDPDDPGPQWGKGGRIAPEAPAPTGGDPLNGP
FT                   GSLVAVPRQGKAGTVAVTSAPARLGRPTAGDPLAGDPLAEVETDEDRELAAYNRYLASL
FT                   YERDAAGSDNDTKGDRR"
FT   sig_peptide     complement(332340..332435)
FT                   /locus_tag="Franean1_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.428 at
FT                   residue 32"
FT   gene            complement(333017..334603)
FT                   /locus_tag="Franean1_0284"
FT   CDS_pept        complement(333017..334603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09750"
FT                   /db_xref="GOA:A8LDY5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY5"
FT                   /protein_id="ABW09750.1"
FT                   /translation="MIRDRFISSSSRRRVDGHGTAGGQAGTGDRAETGSVAASAPVSDG
FT                   SGAATATPPSSQDFTSTLRSLLARELTEHDPDTERIRARIAAMDPSAARHLAPAARPVD
FT                   HPVIPAPRTTPLAGTTSPAGAPPPTGPTPSTGPVEPGPAGTPPPAGAAARPRATARQRR
FT                   PRRTRPRLLIPTVVGTAATALVGVVLLSGTLFTPRPDTGTVTAAPTRIPRTASADAGNA
FT                   SPADSLGVTPAPSSAGPPSPAPGDGDPAVLSPEGLPSQGAGTSAAPSGAPDGPASQSDQ
FT                   GTGGSAPQDTRPGSGGSGGNDAAPRRDDSRHSGDWDGSGSADRGSGEADTPPGRDGARR
FT                   DSGDSGDSGGSGGSGGVSVSTAPFSRGQEVSLPTAGCLDWVLFGADGVQTRADIPRPGI
FT                   GTARIERGPGSGSGGFANRFSWHGGRPVSSGSRDDDRLVVEGSVRLDVALAGQARRLDL
FT                   YLGSPDGSVRVTVGDGRNAWSRSVALSARQRGDADGVLSVWLPRGQGSIAVTVAAGSGV
FT                   GLLTLAAGVLY"
FT   gene            complement(334755..335654)
FT                   /locus_tag="Franean1_0285"
FT   CDS_pept        complement(334755..335654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0285"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; RNA polymerase
FT                   sigma-E type; PFAM: sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: fal:FRAAL6604 putative RNA polymerase ECF-subfamily
FT                   sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09751"
FT                   /db_xref="GOA:A8LDY6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY6"
FT                   /protein_id="ABW09751.1"
FT                   /translation="MSTDAAASGALPQRQGSDDGLTGSDDRLLGRHTARDEAGWSDLED
FT                   PEPVPGEAAGPESAGGTGTPLNAPVEFREFFERHHRELSRFAYLLTGDHDAADDLTAEA
FT                   LTAAWSKWERVSSADSPLAYVRRIVANLATSRLRRVIRERRGMTVLGMLAERTEHAADD
FT                   ADVPAAVDLRAALMTLPARKRACVVLRYAFDLSEADTARTLGISVGTVKSQTSKAVAEL
FT                   ERVLGTRPELTHSDPPDGTPARKPDARPLAPQAPRRAGATRGRRRAAGGTDPASVARSA
FT                   LNRLRDSEAPGRLRGSEG"
FT   gene            336555..337505
FT                   /locus_tag="Franean1_0286"
FT   CDS_pept        336555..337505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0286"
FT                   /product="Quinone oxidoreductase putative PIG3"
FT                   /note="TIGRFAM: Quinone oxidoreductase putative PIG3; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: fal:FRAAL6600
FT                   putative quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09752"
FT                   /db_xref="GOA:A8LDY7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY7"
FT                   /protein_id="ABW09752.1"
FT                   /translation="MSWSEVPDLPPPGNGEVTVDIVATAVNRADLLQRQGFYPPPRGAT
FT                   EIIGMECSGRVAALGPGVDGFALGDEVCALLVGGGYATQVNVPAAQLLPVPSGVDLIHA
FT                   AGLPEVACTVHSTVFERAALADGEVFLVHGGASGIGTFAIQAVRALRPSAVVATTAGSA
FT                   EKLVRCRELGAHITVAYRDEDFVARVRAETGGHGADVILDNMGASYLERNVDLLATEGR
FT                   LVVIGLQGGTKGTLNLGALLPKRASVHALSLRARPDAQKARIVAGVREEFWPEVAAGRI
FT                   RPVIDRVLPITEVATAHRVLEESGHVGKVVMTVGG"
FT   gene            337539..338171
FT                   /locus_tag="Franean1_0287"
FT   CDS_pept        337539..338171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09753"
FT                   /db_xref="GOA:A8LDY8"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY8"
FT                   /protein_id="ABW09753.1"
FT                   /translation="MTGRDVRRATGMDSSDQEGRMVGMTDQPEPRVVVVGPDGALQEAP
FT                   GAVGVPLTPSAGHGGRAGDDGPGEGKNPFAGMVSQPDKVMRIGTMIKQLLEEVRAAPLD
FT                   DASRVRLRQIHQSSITELSDGLAPELRAELDRLSLPFDEDATPSDGELRIAQAQLVGWL
FT                   EGLFHGLQTALFAQQMAARAQLEEMRRRALPSGQQQGDNEPFGGAYL"
FT   gene            complement(338215..339744)
FT                   /locus_tag="Franean1_0288"
FT   CDS_pept        complement(338215..339744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6598 conserved hypothetical protein;
FT                   putative coiled-coil domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09754"
FT                   /db_xref="GOA:A8LDY9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDY9"
FT                   /protein_id="ABW09754.1"
FT                   /translation="MSEGLLVTGTTQAIRASHEILERALELSRADGAIVIASESSTVNL
FT                   RWANNTLTTNGAARDRSVTIISVIGRSFGVRSTSTVDGPGVGADLAGLEALVRASEAAA
FT                   RESDDAEDYSDLVVPAAAAVGGRSFTDPAERTSSEVFASFADDLAEAFGAARAEGRRLF
FT                   GFAEHDRTTTWLGTSTGLRLRHSQPTGSVEWNAKSAAPGGSVWHGQSTQDFTDVDVAAT
FT                   DARLRARLRWCDRSVELPAGRYETLLPPSAVADLMVYLYWSAAGRDAAEGRTVFSRAGG
FT                   GTRVGEALGPAGLRLWSDPSAAGLTSAPFVTAGASSATSSVFDNGLPLGPTDWIRDGRL
FT                   NALVQTRSSARAASLAAPAAAPNSTSNSSGNGISAGAAGLAGQGIAVTPFVDNLLLDGG
FT                   GTATLDEMITSTRRGLLLTCLWYIREVDPQVLLLTGLTRDGVFLIENGEVVGAVNNFRF
FT                   NESPVDLLGRIAEIGASTRTMPREWADWFTLARMPALRIPDFNMSSVSPAS"
FT   gene            complement(339741..341312)
FT                   /locus_tag="Franean1_0289"
FT   CDS_pept        complement(339741..341312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0289"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   fal:FRAAL6597 conserved hypothetical protein; putative
FT                   signal peptide; putative cysteine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09755"
FT                   /db_xref="GOA:A8LDZ0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ0"
FT                   /protein_id="ABW09755.1"
FT                   /translation="MATSVPRDPAEPALPPHEIDEEFRALPTAALTDAALQAARDLGAA
FT                   HADIRIERLKESSLSFRDAGLESRSDGVTAGFAVRVVHDGTWGFAAGVDLTVDEAVRVA
FT                   REAVAMAKVARPLNSEPVELADEPVHAGATWVSSYATDPFSVDPRDQVERIGGLCRSLY
FT                   SAEDVDHVDGRFAAVMENKFYADTAGTDTTQQRVRVLCQLEATRVDPAGGFESMRTIAP
FT                   PAGRGWEWMVGGSAAGCWDWESETELIPSLLAEKAKASSVEPGRYDLVIDPSNLWLTIH
FT                   ESVGHATELDRALGYEAAYAGTSFATLDKLGSLRYGSPAMTVTGDRTAPHGLATIGYDD
FT                   EGVQTRRWDIVRDGVLVGYQLDRRMAAQNASTLGVDRSNGCAFADSPGHVPIQRMANVS
FT                   LLPAPGGPSTEDLIGRVDRGIYVVGDRSWSIDMQRYNFQFTGQRFYEIRKGRIVGQLRD
FT                   VAYQATTTDFWGSLDAVGGPETYVLGGAFNCGKGQPGQVAAVSHGCPSALFRDVNILNT
FT                   RREGGR"
FT   gene            complement(341569..342840)
FT                   /locus_tag="Franean1_0290"
FT   CDS_pept        complement(341569..342840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09756"
FT                   /db_xref="GOA:A8LDZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ1"
FT                   /protein_id="ABW09756.1"
FT                   /translation="MTQGCGRCEMTALTSIEPGTEIPVGDLVVIGVALTVVAACLGRLR
FT                   AAFILGIPTLLLAGIATILGWLLGGTADSGNTVPPPARSLSPEATAGAAPGGGTHWGAF
FT                   FLTVLGAVLIILGTVVWAIWSKRHSERFELGNGAGSVPQPDPTALRWTHSDLPVSLSEL
FT                   DDDFYPDLPVQHQTPPDLNAWAPETAPADGRESTMGGPGQPRSRRNHQDQPTDPFFENI
FT                   AARIDRIVGLYLNAVTPRPGRPARVDLLAPDAQYFVSALTTTLDLFGGTAPADRMEPLV
FT                   EAVREVERRWDAVIGTRIGPNTPDETETARAPSAAPPRPAPGRPARDTKSTDEHADVPR
FT                   PTAASKHRLRIPPRPTPPPRPALPLVPGGTNSDGDRRRRRLPGEHPARNHRIRPELDRP
FT                   AEPDEPDGPSSPRESDRPDRPDRT"
FT   gene            complement(342837..343637)
FT                   /locus_tag="Franean1_0291"
FT   CDS_pept        complement(342837..343637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09757"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ2"
FT                   /protein_id="ABW09757.1"
FT                   /translation="MRRQRPSGGPAPAWRRRQARRGLGAQAPYGGDQKLPWDLHEMLTR
FT                   SQFDLRLISGEARPLDGDRAGFGQIQPRTGARSTRGREWGHTHPVRPLFARPPATATDK
FT                   SGVAWRSPDRLAVRYDGIVEPSRPQQRTTLTDCDSRRIRTSDPKAPRTIKIGQEVVIQL
FT                   PDVDRNGHWTGFAKTRRLFRLKYLRFAARTVTIRVGPGGGQGLKVLPHPRRCMDVWHGG
FT                   MAIHRTTIVNAAVVPYVHACPTICDAPEHAFAAHSRGSPGARPR"
FT   gene            344266..345102
FT                   /locus_tag="Franean1_0292"
FT   CDS_pept        344266..345102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0292"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   fal:FRAAL6593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09758"
FT                   /db_xref="GOA:A8LDZ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ3"
FT                   /protein_id="ABW09758.1"
FT                   /translation="MGVVLARLRGERGLTGERLGALVHMSQAKISKIERGVARPSPADV
FT                   ERIAVALDAPQALVSSLVDQAGADQDHAGTTRGPARRGTVGQQDFSAEETRAHRIRNLE
FT                   PILIPGLLQIGEYTRRVINEYFGLTHGDAESKWADTAATVSLRARRQELLYDLSREFEF
FT                   VIFETVFRNRFAPPGAMLAQVDRVEAVAQLANVTVKVVPDTADLGYPPMQGFTILDDNV
FT                   VLAESMDATILRDRKSVDFYTRFFDQYASRGVDDLEPILSRYKTLYADLARPRGDG"
FT   gene            complement(345121..345927)
FT                   /locus_tag="Franean1_0293"
FT   CDS_pept        complement(345121..345927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0293"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: fal:FRAAL6592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09759"
FT                   /db_xref="GOA:A8LDZ4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ4"
FT                   /protein_id="ABW09759.1"
FT                   /translation="MVDWLLVSRPVLVATDLDGTLIRTDGTVSDRTRDALRQVENSGST
FT                   VVFVTGRPTRVMADVVRQTAVSGLAICANGALVYDLDTGVPVSQTILETPAALKLAAAI
FT                   RAAVPDATFAVESGVRFGREPDFLTMWPDPGELVAGFHELLEHLPATKLLVRRGGASLA
FT                   DVYETVVALAGTEAVVTTSSHDLIEIAGPGVSKAVALAELASERGVLAAEVVAFGDMPN
FT                   DLPMFAWAGHSVAVANAHPDVLAAADEITASNDDDGVAQVLERLFS"
FT   gene            346178..346627
FT                   /locus_tag="Franean1_0294"
FT   CDS_pept        346178..346627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0294"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   fal:FRAAL6591 phosphoribosyl-ATP pyrophosphatase (PRA-PH)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09760"
FT                   /db_xref="GOA:A8LDZ5"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ5"
FT                   /protein_id="ABW09760.1"
FT                   /translation="MAFSDASEASRSPVTGGAGGTDGGSGGGVPGGESAAAGGTPGGTP
FT                   PLPSVVGSSRGARAGRERKTFDELFAELGGKWRERTPGSGTVAALDLGVHHLGKKLVEE
FT                   AAETWMAAEHESRERAAEELSQLLYWSQLMMISLGLSLDDVYSHL"
FT   gene            346689..347537
FT                   /locus_tag="Franean1_0295"
FT   CDS_pept        346689..347537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0295"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: fal:FRAAL6590 ATP phosphoribosyltransferase
FT                   (ATP-PRTase) (ATP-PRT); TIGRFAM: ATP
FT                   phosphoribosyltransferase; PFAM: Histidine biosynthesis
FT                   protein HisG domain; ATP phosphoribosyltransferase
FT                   catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09761"
FT                   /db_xref="GOA:A8LDZ6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ6"
FT                   /protein_id="ABW09761.1"
FT                   /translation="MMLRIAVPNKGGLAAASSQLLCDAGYLARRESAELVVADVENDIE
FT                   FFFLRPRDIAVYVGTGRLDLGITGRDLLVDSNTSAQELVPLGFGQSAFHYAAPAGTMSD
FT                   IKELDGLRVATSFPGLVRTDLAGRGISVQIVKLDGAVETAVRLGVADAVADVVETGRTL
FT                   RAAGLELVGESVLRSEAIMIAKRGADLSAAHERLLRRVQGVLVARRYVMMDYDVPSSVL
FT                   EKACEVTPGYESPTISPLQREGWVAVRAMVLKADVNRTMDDLWDLGARGILVSGIQACR
FT                   L"
FT   gene            347677..349551
FT                   /locus_tag="Franean1_0296"
FT   CDS_pept        347677..349551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0296"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: cyclic nucleotide-binding; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; glutaminase;
FT                   KEGG: rha:RHA1_ro06842 probable glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09762"
FT                   /db_xref="GOA:A8LDZ7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ7"
FT                   /protein_id="ABW09762.1"
FT                   /translation="MRAGGNARPAKDSRLRAPDAGPMERMLADIHEAFRTDRSGKVASF
FT                   IPELATADPALFGLAVTTMDGLRYRAGDSDVPFTIQSVSKPFVYALALRDRGTDGVLAR
FT                   VGVEPTGDAFNAITLEPETGRPLNPMVNAGALLTSSLVGGGDAAERFDRVLTGLSAFAG
FT                   RQLTVNERVFASERDTGDRNRAIGYLMRGAGALRGPVDEICEVYFRQCAVEVTAADLAV
FT                   MAGTLARGGVNPLTGERVLNEEHVNHVLTVMATCGMYDRAGTWLFRVGLPAKSGVAGGV
FT                   CAVLPGQLGIGVFSPPLDEVGNSVRGVRACERLASRFALHLLAPQGEPPHPVRGTHRGD
FT                   ALSSKRMRGARERAVLAVRGSAIVIHELQGDLVFASAERVVRTVRQHLDDVRWVVLDLR
FT                   RVAAVREPALELLRVLLDELASRDVNVLFADPRGLPGVDRLMRGDWSTQRVPDLETALE
FT                   WAEEALLMREDLATLPPTAHVPLGAQELLTDLGKEGTRVIGAMCERRTYERGATVFDEG
FT                   DPADALYFVTRGLANAQAPNADGTRWFRLSSVPAGSAFGELALVDGGRRSTRIVVAETM
FT                   TCEVLSVAAFDTLVREHPDVYNALVRAIARSLSAQLRRATREIQSLEE"
FT   gene            complement(349657..350430)
FT                   /locus_tag="Franean1_0297"
FT   CDS_pept        complement(349657..350430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0297"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: fal:FRAAL6589 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09763"
FT                   /db_xref="GOA:A8LDZ8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ8"
FT                   /protein_id="ABW09763.1"
FT                   /translation="MTSDSDQAQTIVRQAGELNAGSSGLDQGVSPESATESNVSDNVTD
FT                   AKDAGSGAGNGVEARRLKRPEMVRPFDHERVARAVRELLIGIGEDPDREGLRKTPDRVA
FT                   RAYQEAVEGLGRDPAEVLTTVFDEGHDEMVLVRDIDFSSLCEHHLVVFAGKAHVAYIPN
FT                   EKGQITGLSKLARLVDLYARRPQVQERLTSQVADALVDVLDPRGVMVVVEAEHLCMSMR
FT                   GVRKPGATTVTSAVRGQFLSPATRSEGMSLIIRGR"
FT   gene            complement(350427..352688)
FT                   /locus_tag="Franean1_0298"
FT   CDS_pept        complement(350427..352688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0298"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: fal:FRAAL6588 cell division protein FtsH
FT                   (ATP-dependent zinc-metallo protease); TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase central domain protein; peptidase M41 FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09764"
FT                   /db_xref="GOA:A8LDZ9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8LDZ9"
FT                   /protein_id="ABW09764.1"
FT                   /translation="MTPRRIFRGWVPLLLLVLFVIILTTGVLSGPSEYQKADLSFVQQQ
FT                   IDQSAGAKPETRVVDATIQDSKQIIRIELGNGKKYESSFATEQALVLANELKQQNIKYN
FT                   VSVDRGNVLVSLLLNLLPVLLIVFLLLFFMNQMQGGGNRVMNFGKSKAKLVSKDTPKTT
FT                   FADVAGADEAIEELQEIKEFLENPGKFQAIGAKIPKGVLLYGPPGTGKTLLARAVAGEA
FT                   GVPFYSISGSDFVEMFVGVGASRVRDLFEQAKANAPAIIFVDEIDAVGRHRGAGLGGGH
FT                   DEREQTLNQLLVEMDGFDVKGGVILIAATNRPDILDPALLRPGRFDRQIVVDRPDLLGR
FT                   EAILKVHAKGKPISSDVDMLIIARRTPGFTGADLANVLNEAALLAARSDVRFISSALLE
FT                   ESIDRVMAGPERKTRAMSDREKKRIAYHEGGHALVAHALPNADPVHKITILPRGRALGY
FT                   TMQLPLEDKYLSTRSEMLDRLAVLLGGRTAEELVFHEPTTGASDDIEKATQIARAMITQ
FT                   YGMSDKLGAIKFGSESGEVFLGRDMGHQRDYSEEVASEIDDEVRRLIEAAHDEAWEILV
FT                   TYRDVLDNLVLRLMDTETLSKDDVLEVFATVQKRPSRGSYTGVGRRIPSDRPPVQTPAE
FT                   LGLVPSKVSDLVKGNSGPAGHATNGGGTNGGGSANGGGVSGGNGTAGHPRPAGQADPGT
FT                   AGGPAGLGHGDPAQSGPGHSASSPAHGTPPPGSPPPEGPRIANPWAPPTWDNDDDRRRR
FT                   "
FT   sig_peptide     complement(352599..352688)
FT                   /locus_tag="Franean1_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.976 at
FT                   residue 30"
FT   gene            complement(352989..354815)
FT                   /locus_tag="Franean1_0299"
FT   CDS_pept        complement(352989..354815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0299"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: fal:FRAAL6587 hypoxanthine
FT                   phosphoribosyltransferase (partial match); TIGRFAM:
FT                   hypoxanthine phosphoribosyltransferase; tRNA(Ile)-lysidine
FT                   synthetase; PFAM: phosphoribosyltransferase; PP-loop domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09765"
FT                   /db_xref="GOA:A8LE00"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LE00"
FT                   /protein_id="ABW09765.1"
FT                   /translation="MPAPAVAAVRLAVRDAVADVPPGGLVLVACSGGADSLALAAALAF
FT                   VAPRRALRAGLLTVDHGWDDTSRPRAEEVAASGRLLGLSPVEVLAAPSPRSEGAARDSR
FT                   RAALLAAGERLGAHAVLLGHTLDDQAETVLLRLARGSGARSLSGMPATDGAIRRPLLRL
FT                   RRDQTRQACQSLGLEFWDDPTNADPAFARARTRSTVLPVLEAELGPGIAEALARTADLL
FT                   RADADALEAQAESVYAELAGSAAGTTAPRAPRTPLAAEAEPGPRVEFDVAALAGLTQAL
FT                   RSRVLRRAALAAGSSASALRADHIWAVEDLVTRWRGQKPVPLPSGVLARRTGGRITLVG
FT                   PDAPVRPDTPAGAGHPGRPGVVRTPGERGGPTSRAPASGTLTPGTPASGDRGPGDPARN
FT                   EEDRPVSQAATAKPDHDGTSIPAGGPPRAHPDIDEILVSQDEIAAKIAELAARVDADYA
FT                   GREILLVGVLKGAVMVMADLSRALSVPITMEFMAVSSYGSTTSSSGVVRILKDLDRSIE
FT                   GRDVLVVEDIIDSGLTLSWLLRNLRSRGPASLEVLALFRKPEAITVDVDVRYVGFDIPS
FT                   AFVVGYGLDYAEHYRTLPFVGTLTPEAIARRA"
FT   gene            complement(354886..356019)
FT                   /locus_tag="Franean1_0300"
FT   CDS_pept        complement(354886..356019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09766"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LE01"
FT                   /protein_id="ABW09766.1"
FT                   /translation="MDAELVDWELAVTTAKKLVRPGPQRSRAEADEIVSELRRLAVVAE
FT                   GHVQDYTQLVPAGPPTPIAVVDRPEWVRSNVAGLRVATMPLIEKLSDQSRGRLAAAVGR
FT                   RVTGVQVGSALAYLAGKVLGQFEVFLPPEEYEAGSAASAPSLAKPGAPTPVGRLSLVAP
FT                   NIAHAEETLRVVPRDFRLWVCLHEQTHRSQFTAVPWLREHLESEIAAFIGATDLDPDVL
FT                   ADRLRSAVTALRSAVRDHGPDTPSVVEALQTPAQRAVLDRLQALMSLLEGHADQVMDAV
FT                   GPQVVPTVADIRGKFDNRRSGGSPIDRFLRRLLGLDLKMQQYRQGGAFVRAVVAEVGVE
FT                   GFNHVWQSPRTLPTRPELTDPGAWMLRVLGTRPSMSA"
FT   gene            complement(356152..357639)
FT                   /locus_tag="Franean1_0301"
FT   CDS_pept        complement(356152..357639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0301"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C; KEGG:
FT                   fal:FRAAL6585 conserved hypothetical protein; putative
FT                   signal peptide; putative penicillin-binding protein 6
FT                   [precursor] (D-alanyl-D-alanine carboxypeptidase fraction C
FT                   (DacC)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09767"
FT                   /db_xref="GOA:A8LF22"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF22"
FT                   /protein_id="ABW09767.1"
FT                   /translation="MPLGARAGGLTALAGALLAGSLSPGPAAPPGGASPAPPGVRAEAS
FT                   ALPGLDPDAPKADPAAVAARLLGPLSDPVLGGPATLVVDALTGQVLFANRPTEPTAPAS
FT                   TVKIATATAALTALDPDARLRTRAVYLPPASAPPAATAGSPAATTGSAAAPGRAPLAPG
FT                   GTLWLVGAGDPTLTAATGAAGYPPAARLSDLAEQVRKAGITAVGSVVGDGTAYEGPGMA
FT                   PGWRDGYVTDGNVTPVSALSVDAGRAAPGSAGPRSLTPDAAAAAAFGTALTAAGVSVGS
FT                   VSTGRADAAAREVGSVQSPPIPVLVERMLTDSDNDLAESLGRQVAIARGLPASFDGATR
FT                   GVLGALRDAGIPTDGASLRDTSGLSIDNRIAPATLVAALRTAALPGHPALRTVLSGLPV
FT                   AGFTGTLGDRYGPGDTSPGAGVVRAKTGSLRIVTSLAGMVTDSDGRLLLFGLFAPVEEQ
FT                   GLTKMALDRVAAALASCGCPPAGAGPPSAGPPVPPGG"
FT   sig_peptide     complement(357538..357639)
FT                   /locus_tag="Franean1_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.533 at
FT                   residue 34"
FT   gene            358256..358798
FT                   /locus_tag="Franean1_0302"
FT   CDS_pept        358256..358798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0302"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: fal:FRAAL6584
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09768"
FT                   /db_xref="GOA:A8LF23"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF23"
FT                   /protein_id="ABW09768.1"
FT                   /translation="MDLEFDVTIEIPKGQRNKYEMDHHTGRIRLDRMLFTSTHYPSDYG
FT                   FIEGTLGRDGDPLDALVLLEEPTFPGCLVRCRTIGMFRMTDEKGPDDKVLCVPVADVRQ
FT                   EHLRDIRHLPEFDRLEIQHFFEVYKDLEPGKSVEGASWVDRGAAEREILDSITRLKDSE
FT                   GVEHGADEDGAAHARTA"
FT   gene            complement(358958..359029)
FT                   /locus_tag="Franean1_R0006"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(358958..359029)
FT                   /locus_tag="Franean1_R0006"
FT                   /product="tRNA-Thr"
FT   gene            359498..360229
FT                   /locus_tag="Franean1_0303"
FT   CDS_pept        359498..360229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0303"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: fal:FRAAL6583 two-component
FT                   system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09769"
FT                   /db_xref="GOA:A8LF24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF24"
FT                   /protein_id="ABW09769.1"
FT                   /translation="MTGAGEGAPGTTRGASLLVAEDDEASRIALARSLERFGYRVLEAA
FT                   DGEAALRLFQTTEIDLVVLDVAMPRMDGFAVLSRLRQTSEVPVIMLTGRAEEVDRVVGL
FT                   ELGADDYVVKPYSLRELVARVRARLRRRPVEAPPQRTGDGNEPLIYGDVSIDLRAREVA
FT                   VAGERVDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKVE
FT                   GRPPQRRLVTTLRGMGYRFDP"
FT   gene            complement(360189..360857)
FT                   /locus_tag="Franean1_0304"
FT   CDS_pept        complement(360189..360857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0304"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pst:PSPTO_5383
FT                   phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09770"
FT                   /db_xref="GOA:A8LF25"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF25"
FT                   /protein_id="ABW09770.1"
FT                   /translation="MQRRVWLVRHGESTANAGQPSADPHGIGLTDLGVRQADAVAGMIP
FT                   YDPSLIVVSWYLRARLTAEPTARRFPATPLEVWDVQEFTYLGSLHGQKLTDLERAPFAR
FT                   QYWHQANPYSVDRPELGCESFAGLMDRADRLLARLHQAPPGLVVVFTHGMFIRAVDWCL
FT                   RARAGTAERLDMGGYREHHRRRPVPNGSIIELQEGDRELREATEPDLRDRTGSPSPGAW
FT                   "
FT   gene            complement(360969..362006)
FT                   /locus_tag="Franean1_0305"
FT   CDS_pept        complement(360969..362006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0305"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: fal:FRAAL6582
FT                   hypothetical protein; putative signal peptidase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09771"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF26"
FT                   /protein_id="ABW09771.1"
FT                   /translation="MPMMCAVSFSRRGRLYYADPGPYSPRVGDRVLVPTDEGPEVATCV
FT                   WAPQWVSEDVGGLPVLAGLADEDDLRRDDAARRRRAQARVAARRLVREHGLPMKVVGVD
FT                   VVPDSNAFTVYFTAENRVDFRALVRDLNRTLSARVQLRQLSARDSAKLQGGIGSCGRDL
FT                   CCSTFLTDFEPVSVRMAKDQNLSLNPMRISGACGRLMCCLRYEHPLYEEFTAAVPAVGA
FT                   RASTPDGDGRVVAHDVPRQQVTVALDGGGRHACSRADVCGSRKAYEATHAAGPAAPAGT
FT                   AEAAGMAGPADMAGPAATAEPTGTAEPAGPAGTAGPAPDGGEDGSPDTAGGRSHRRRSR
FT                   RRTEH"
FT   gene            complement(362170..363108)
FT                   /locus_tag="Franean1_0306"
FT   CDS_pept        complement(362170..363108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0306"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sco:SCO7376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09772"
FT                   /db_xref="GOA:A8LF27"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF27"
FT                   /protein_id="ABW09772.1"
FT                   /translation="MRVAAVGDLHVVPGSAFRLRPLYQRAAIVADVLLLAGDLTNDGEL
FT                   DSAAELCTVVRGLDLPVVAVLGNHDHDAGEGPRVAAMLGDAGAIVLDGTAATIGTAAGP
FT                   VGVAGVTGFADNHLADGGPGGRTPEDAAADAFHLCDALASLDTDVRIALTHYAPVRETL
FT                   TGEAPGLHRFLGSSLLGAAIDGSRAAGAGRGTGPGRGATAARRSGMAGTGATAGTLDPP
FT                   GPASVFPSDGPAPAPADGSWHGSVTPGSVTPGCGAGALDAPATALAVHGHAHHGQETGR
FT                   TPGGTPVRNVARPVIVAPFAVYQVPGGARIG"
FT   gene            complement(363151..364407)
FT                   /locus_tag="Franean1_0307"
FT   CDS_pept        complement(363151..364407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0307"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: fal:FRAAL6581 DNA polymerase III delta'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09773"
FT                   /db_xref="GOA:A8LF28"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF28"
FT                   /protein_id="ABW09773.1"
FT                   /translation="MHDNDGVTVWDTLVGQDAVVATLTAAATAAALVTEGGSLAAARAG
FT                   MTHSWLFTGPAGSGLADAARAFAAGLLCENIPPGCGQCPGCHTVLSDTAADLRTVRPEG
FT                   LSIGVRDVRALIRDAASAPSAGRWRILLIEDADRFTDSAANALLKALEEPAERAVFLLC
FT                   APSVDDVLPTIRSRCRSVALRLPNPKNVADVLIREGTAEDLAAVLAQASQGHVGQARRL
FT                   ATDPQARARRESVLRLPSRLRRVGDCLAAAADLVDAANADAQAANAERDEVETEALKTA
FT                   LGVGATSSGTRSTSARGAKAGAKPRSLQVRGAAGALKELERTQKSRGRRTVLDSLDRAL
FT                   VDLAGLYRDVLVQQLRGQVTPVHLDQADAVAQLAAAATPEQTLRRWEAVLATRQALADN
FT                   PGLVPQLAAESLALTLRDA"
FT   gene            complement(364424..366553)
FT                   /locus_tag="Franean1_0308"
FT   CDS_pept        complement(364424..366553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0308"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; major facilitator
FT                   superfamily MFS_1; KEGG: fal:FRAAL6580 thymidylate kinase
FT                   (dTMP kinase) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09774"
FT                   /db_xref="GOA:A8LF29"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF29"
FT                   /protein_id="ABW09774.1"
FT                   /translation="MPSPPRARTTGGSDGDLRAVLRIPEFRRMWIQLSLSSLGDWMGLL
FT                   ATTALVTQLTESFSGQAFAISSLLIVRLLPALVLGPLAGAIADRLDRRMTMVITDVMRF
FT                   GLFLSIPIVGTLGWLLIASFLVECVSLVWAPAKEASIPHLVPRNRLAAANTLSLITTYG
FT                   TAPLAAAIFTLLATVSRALGPSIHFFRDSSLDIALYFNAATFLGSAIVIWGLRSIGRAE
FT                   RPEHSTEPGFFASITEGWKFVGQDRLVRGLVVGILGGFAGAGCVVALGKLYVEILGGGD
FT                   SAYGVLFGAVFIGLAAGMGAGPKLLGDYSRTRLFGVCVTAAGITLVVVAIIPNLVIACI
FT                   LVVFVGALAGVAWVTGYTLLQAEVADELRGRTFALVQSLVRVDLLVVLAAAPALVGLIG
FT                   SHQVHLWGDINVRADGVTVVLLAGGLLAVAVGLFSYRQMDDHTGEAVLPELWNALRGRR
FT                   PGTARRRHGGLFITVEGAAGAGKTTQLELLRSWLSSSGREVVPAYETDGTSLGAGLRDL
FT                   LDDPANRLHARTELLLDAADRAEHVARVIEPALARGAIVLTDRYVDSAIACQALGQRID
FT                   SDELTVLTQWASHSLLPDVTILLDLPAEQALARGGSDPHLGRESEGDGSGHDGGAGRGG
FT                   GAGHGAGPDRSGTDPVAAVAYHRRVREHFRRLADEDPDRHVILDATLSPQELHRQIRAV
FT                   IAGRLRPAITGDDPR"
FT   gene            complement(366844..369915)
FT                   /locus_tag="Franean1_0309"
FT   CDS_pept        complement(366844..369915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0309"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: fal:FRAAL6579 DNA topoisomerase I
FT                   (omega-protein) (relaxing enzyme) (untwisting enzyme)
FT                   (swivelase); TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM
FT                   domain protein; DNA topoisomerase type IA central domain
FT                   protein; SMART: DNA topoisomerase I ATP-binding; DNA
FT                   topoisomerase I DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09775"
FT                   /db_xref="GOA:A8LF30"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF30"
FT                   /protein_id="ABW09775.1"
FT                   /translation="MPPRTNSTSRTTAGSPTPVAEPTKPAAASATAASATAAKAEAAET
FT                   AEAGATAGRASGARATGGRRPARATTNGNGTRLVIVESPAKAKTIAGYLGPGWQVESSI
FT                   GHIRDLPRSAADVPTAHKGKPWARLGVDVDNGFEPLYVVSPDKKVQVSKLKSLVKDASE
FT                   LYLATDEDREGEAIAWHLLQTLKPTVPVKRMVFHEITPQAIQRAVDSPREINENLVNAQ
FT                   ETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRILVERERARMRFRTAEYWNIEG
FT                   VFQQNVAHDGAALDTTPLPATLVALDGRRLASGRDFAPTGELTSDGVALLDEAGARALA
FT                   GRLTGAAFAVRSVETKPYRRSPYPPFMTSTLQQEAGRKLRFSSQRTMQVAQRLYENGYI
FT                   TYMRTDSTNLSETALVAARDQARTLYGAEYVPDRPRVYAKKVKNAQEAHEAIRPAGDHF
FT                   RTPGEVRSELDGDSFRLYELIWQRTVASQMADARGTSATIRLGATSSSGEDAEFSASGK
FT                   VITFPGFLRAYVEGADDPDAELEDRERRLPDVRRGDPLATRTLTPRGHTTSPPPRFTEA
FT                   SLVKTLEELGIGRPSTYASIIGTIQDRGYVWKKGSALVPSFVAFAVVGLLEDHFTRLVD
FT                   YQFTASMEDDLDAIAAGTAASTDWLTGFYFGLPDTTDTGGSGAVEGLKHLVGERLGEID
FT                   AREVNSIPLGKADDGEPVVVRVGRYGPYVQHADGRASVPDEVAPDELTVERALELLAAP
FT                   SGDRLLGTDPKTGASITAKAGRYGPYVTTDSEPPQTASLLRTMSLETVTLEDALRLLTL
FT                   PRVLGTDAEGAEVTAQNGRYGPYVKRGADSRSLESEDQLFTVTLDEALALLAQPKARGR
FT                   RQAAQTPPLRELGPDPATERPMVLREGRFGPYVTDGETNASLRKGDAVETITVERAAEL
FT                   LADRRARGTTTPRRTTKTTAKAPAKATAKPRTAAKTTTKAKTAGKTSGGTAKSGSRASK
FT                   SAASDAGATGTAAGDASGTDSATGATSGGSQRSS"
FT   sig_peptide     complement(369787..369915)
FT                   /locus_tag="Franean1_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.847 at
FT                   residue 43"
FT   gene            complement(370571..372931)
FT                   /locus_tag="Franean1_0310"
FT   CDS_pept        complement(370571..372931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0310"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: fal:FRAAL6577 pyrophosphate-energized proton
FT                   pump (pyrophosphate-energized inorganic pyrophosphatase)
FT                   (H+-PPase) (membrane-bound proton-translocating
FT                   pyrophosphatase); TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09776"
FT                   /db_xref="GOA:A8LF31"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF31"
FT                   /protein_id="ABW09776.1"
FT                   /translation="MSPIHTLQAEDPPIDLSGGAVGLVAGVAIVAALALLVAAYLVREV
FT                   LAANAGTPKMIEVGRAVQEGAAAYLRRQFRTLAGFVIVIPFVLLLLPADDTGARVGRSV
FT                   FFVVGAVFSALVGFVGMSLATRANTRTAAAAIESGERAAMRIAFRTGGVVGMFTVGLGL
FT                   LGAAVVVLAFRDTAPQVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQGIPE
FT                   DDPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGVKAFGENGLVYPLLIPA
FT                   VGVLTAIIGIFAVSPRDGDRTGMTAINRGFFISAVVSAIGVVIVSMVYLPGSFAEFPGL
FT                   EGSTQSGDPRVIAISAVLIGIVLAAAIQLLTGYFTETNRRPVLGVAEASTTGPATNILA
FT                   GIGVGLESAVYSALLIGAAVFGAYLLGSGSVTIALFAVALAGTGLLTTVGVIVSMDTFG
FT                   PVSDNAQGIAEMSAGPEGIDERAGAILTSLDAVGNTTKAITKGIAIATAVLAATALFGS
FT                   FTDTVTTALADAGASTEAARGTVGGLNIAYPDALVGLIIGAAVVFLFSGLAINAVGRAA
FT                   GRVVMEVRNQFRTKPGIMEGTEKPDYGAVVDICTRDSLRELVTPGTLAVMAPIAVGFGL
FT                   GYPPLGAFLGGAIAAGVLMAVFLANSGGAWDNAKKLVEDGNYGGKGSDVHAATVIGDTV
FT                   GDPFKDTAGPSINPLLKVMNLVSLLIAPLVVKFSVGEDENTAARIGIALAAVVVIVAVV
FT                   ATSRRRGSSVGDGPPTPSAPPTRTPPSGSEVKV"
FT   gene            complement(373694..374212)
FT                   /locus_tag="Franean1_0311"
FT   CDS_pept        complement(373694..374212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0311"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: fal:FRAAL6575 putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09777"
FT                   /db_xref="GOA:A8LF32"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF32"
FT                   /protein_id="ABW09777.1"
FT                   /translation="MPTVELHFAALPGHVRTARMIATAVSRRAGVPAGAVDEIKLAVGE
FT                   ACARAVRVNRRSNPEALVHVALTDAPETFTVIVSDSGAPGDEVAPGPDGGLISAPALLD
FT                   LGGADLGGAAALGSAALTAPGLDGDPDADQPFPPGLGLALIEGLVDEVAVRRGTGRHGH
FT                   RRRDDLAHR"
FT   gene            complement(374249..374590)
FT                   /locus_tag="Franean1_0312"
FT   CDS_pept        complement(374249..374590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0312"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   fal:FRAAL6574 anti-sigma-B factor antagonist
FT                   (anti-anti-sigma-B factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09778"
FT                   /db_xref="GOA:A8LF33"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF33"
FT                   /protein_id="ABW09778.1"
FT                   /translation="MDLSLTTRQEGTHTVVVVGGEIDVYTAPKLREQLIDLVSAGSYHL
FT                   VVDMEGVEFLDSTGLGVLVGGLKRVRAHEGSLHLVCTQERILKIFRITGLTKVFPIHSS
FT                   VEEALAARD"
FT   gene            374926..377373
FT                   /locus_tag="Franean1_0313"
FT   CDS_pept        374926..377373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0313"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; Helicase superfamily 1 and 2
FT                   ATP-binding; SMART: DEAD-like helicases; KEGG:
FT                   fal:FRAAL6573 putative ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09779"
FT                   /db_xref="GOA:A8LF34"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF34"
FT                   /protein_id="ABW09779.1"
FT                   /translation="MGSPAVTEHDPARVGTVLGRLARDSRRAANITHVESVPARRGQPA
FT                   AWPEWADPLLVSRLRAAGIEQPWTHQVEAARAAHEGRGVVLATGTASGKSVGYLLPVLT
FT                   RLLAEPSSRAIYLAPTKALANDQLRSVRSLMLTGVRASTYDGDTPGPEREWVRAHATLV
FT                   LTNPDMLHRGILPAHRRWAPFLRGLRFVIVDECHGYRGVFGAHVAQILRRLRRVCARYG
FT                   TRPVFVLASATVADPGLSASRLTGVDVDVVDADASPRGPMDFALYEPPLLGVRAGRPST
FT                   PADGTEVGGPDVDGAGVDGAGAPVPHGENDAPVRRAATAESADLLADLVTEGVRTLVFV
FT                   RSRRAAEVVAAAARRGLGEAAPELVERVAAYRAGYLPEERRSLEGRLRTGELLGVAATS
FT                   ALELGVDISGLDATVIAGFPGTLASLWQQAGRAGRTGQAALAVLVARDDPLDTYLVHHP
FT                   EAVFGRPVEASVFDPDNPYVLMPHLECAASELPLTEDDLELFGPGARAAVDDLVRRGRL
FT                   RRRPTGWFWTQRHRPDVDIRGVGGPPVRIVETATGRLLGTVDAATSHSTVHAGAVYLHQ
FT                   GASFIVTELDLDDAVAFVEAATPDWATVAREHTDIRVVESTRSARFADVEIHLGTVEVT
FT                   NQVIAFQRRRLTTGEVLGQEPLDLPPRQLRTRAVWYTVTDELLAAAQIEPAEVPGAVHA
FT                   AEHAAIGLLPLFATCDRWDIGGVSTDLHPDTGRTSVFVYDGHAGGAGFAERGFLRVANW
FT                   LRATRDAVAACECPAGCPSCVQSPKCGNGNEPLEKAAAVRLLDAVLAAVDGDPADPSSP
FT                   RRE"
FT   gene            377482..378504
FT                   /locus_tag="Franean1_0314"
FT   CDS_pept        377482..378504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09780"
FT                   /db_xref="GOA:A8LF35"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF35"
FT                   /protein_id="ABW09780.1"
FT                   /translation="MVTVGVVLLLLAGVLTADIVLENSGQTEVMIMGQSLSFDVWGLFV
FT                   LGLATGVLVVAGTQITLQGFARDRHRRRLERQRARDLAAMTRAVPTPAPRHSAPTAPTT
FT                   ASAPTAGSAATTGPTPVGAAPRSGPAPVPAGGPGAVIPGGAAGTAPSRRSAVPTPAMPA
FT                   QTGSVPTTAPDPVVRAQPSRQAAAAAADTGPLRMGRRGTGEGQPGEGRAAGAPTQQGAA
FT                   VTVPVGQAGGGRANATAPTPVAAPESAPGSGRPAGRRPARAERAATTGSPAAPARPVPT
FT                   AHPGDRVVARVSDLRRKKREAQAAETAPGAPTAPGPVSGASGAAPASGSPTPPAGVRTP
FT                   "
FT   sig_peptide     377482..377535
FT                   /locus_tag="Franean1_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.643) with cleavage site probability 0.554 at
FT                   residue 18"
FT   gene            complement(378962..379357)
FT                   /locus_tag="Franean1_0315"
FT   CDS_pept        complement(378962..379357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0315"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: fal:FRAAL6569
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09781"
FT                   /db_xref="GOA:A8LF36"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF36"
FT                   /protein_id="ABW09781.1"
FT                   /translation="MPAPVRQPHADHDDDGGQVTAELAMGLPSLVTVVFMLIWMIGAVS
FT                   AQTRCADAARLGARAAARGEAEAATRAWAQRVAPPGAAIEITRAEGAVRVRVTVAVGGD
FT                   DIGRLVPVVTVAAVAVAAVEEGPVEHP"
FT   gene            complement(379368..379640)
FT                   /locus_tag="Franean1_0316"
FT   CDS_pept        complement(379368..379640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09782"
FT                   /db_xref="GOA:A8LF37"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF37"
FT                   /protein_id="ABW09782.1"
FT                   /translation="MSPEATMLFLYALLRPRRSVPSPRPRHRRWYRSPRSNAGVPTDAG
FT                   MSTAEYAVGTLAAVAFAGVLYAVISSSATRSLISSVVQRALTVAF"
FT   gene            complement(379814..381373)
FT                   /locus_tag="Franean1_0317"
FT   CDS_pept        complement(379814..381373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0317"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   fal:FRAAL6567 hypothetical protein; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09783"
FT                   /db_xref="GOA:A8LF38"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF38"
FT                   /protein_id="ABW09783.1"
FT                   /translation="MTTGGRGRRVATSRLVGGAARLGLIVAVTALAGPLAGLAVIVARA
FT                   AQLAIRRAADQRYEAELRGAAEDVLAALSTELDAGAAPDEALRTALYSVGDLPTRPGRR
FT                   RRGAGHGQAGVTGQAAGGLDLARLRELLPGAEDPARLLARCEAPALRQLATAYRVCRLA
FT                   GVRLAPVATMLADAARADAARADELASALAGPRSSGRLVAGLPLLGLALGALVGASPVE
FT                   VLLTGSAGRACLTAGVLLDLAGLRWLRRIADGVQARVPPVCAGPLPAGRRWGGSTSREY
FT                   RRRLLADLPLALDLVAACLRSGATTQHALEVVGVATGGAAGSQLKAAGRAMRRGVPFDE
FT                   ACDRLLAAGGAPRPDAARAGTGRAGAARAVGRRGGDRRAAGRREGLRHESSRHESGGPG
FT                   RGPTRHSRRSWRADPHRTGRGSNRRRETRVVTATAAAIGRTESSGAKLAATLTRIGDRA
FT                   RQEAHAAAIAAARRAGVLAVAPLGLCFLPAFLLLGVVPVVIGSVPDLGPAFGPTTPPTH
FT                   QG"
FT   sig_peptide     complement(381275..381373)
FT                   /locus_tag="Franean1_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.907 at
FT                   residue 33"
FT   gene            complement(381370..382914)
FT                   /locus_tag="Franean1_0318"
FT   CDS_pept        complement(381370..382914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0318"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   fal:FRAAL6566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09784"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF39"
FT                   /protein_id="ABW09784.1"
FT                   /translation="MNGRQSLPSPGNRPHLPGVARASSPLPGTGGAGGTGGIGGLSATS
FT                   GIDRIGQISQISRFGAMAGMAEIGGITGGGPGRTGEREAAPRIPGASAGGEQRLGPLSV
FT                   LLRDPEVTDVLVNGPDQVWIERAGRLRHTAVRFPDDAALRGLAVRLAGSGGRRLDTAMP
FT                   FVDVRLPDGIRLHAVLSPPALGGTCLSLRRPRARPFTLDELAALGTIGPSEVIVLRAVL
FT                   AARLTTVISGGTGTGKSTLLAALLDAVPAGERIVLVEDTAELVLARFNLVRMEARPPNI
FT                   EGAGEITQRELVRQALRMRPDRLVVGEVRGPEVLDLLMAMNTGHEGGLGTVHANTAETV
FT                   PARFEALGALAGLPRAALHSHLAAAVHVAVHLGRDGDGARRVTGIGVVRRDTDGIVRIV
FT                   PALAGGTGPVHRDTHGNDRARGDQRAHDDHRSHDDHRSRGGQRTSGDQRPPGGRGVHGG
FT                   RPFAGVEREGLPILRALLRDRGFSLWPFDQATPVRRGPRPAPVTAPPPPASAPEAR"
FT   gene            complement(382911..384383)
FT                   /locus_tag="Franean1_0319"
FT   CDS_pept        complement(382911..384383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6565 hypothetical protein; putative
FT                   septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09785"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF40"
FT                   /protein_id="ABW09785.1"
FT                   /translation="MTPAKPLTSADENHRQRPLVVTDAPDLLDDLLRLAAAAGAAVTVV
FT                   PTARAASRYWASAPLVVVGADRAAACVAAGLPERSDIVLVGTDVDDHRTWNLALLINAE
FT                   HVIFLPEAETWLVNLLSRAADAARRRSRTVGVLGGRGGVGSTTLAVALARAGLRRGVRS
FT                   VLLEVDPFGGIAVGDDKPPTAGPSAATMPSTAAPPADPPGVGRGPFTTAPRGARPVPPG
FT                   DRSRRHRPGPPSGAHGRPGGGTATGGSPREAPIANEEDGFLDGLLAGPTMTGGDLPVLS
FT                   WDRGAIPVLPPAAVGALFATARGSADLIVADLPRSADPACDVGLFLCETVLVVVTTQPW
FT                   ATAAAARVIAYAARTCSDVRLVVRLPPSGPGGRGELMLPGGTDLSGRPATAGAVAARLG
FT                   LPLAGVIHDEPGASPAALAAEGRRREADGEGDRPTTGRTSGKPRSDATDGTTKRGVVDN
FT                   AATGLEPRIGASIIEFSDLFIAELGLDGGARR"
FT   gene            complement(384542..385531)
FT                   /locus_tag="Franean1_0320"
FT   CDS_pept        complement(384542..385531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09786"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF41"
FT                   /protein_id="ABW09786.1"
FT                   /translation="MTARSSVSVVGTDPLSQVAAIPGVDEAATAARAAVDALLRHRILR
FT                   RRSAEVTAEASLRAARASAALEGHDIALDALRARLGETGRDNDQPAVSVSQSADPWERS
FT                   LAVTLGAVRLYAELGTLSSAWERAPRQALARMHVLAGRGLLPDDVLGRPRTDVSWSPTS
FT                   ITGAAVTDVAGSPPVPAMPAAEMSQRLDGLTAVLTVPTRAPAIVVAAITHGELLAIHPF
FT                   GALDGIIARAAARLVLVSRGLDPKALVATDVGHLELDRDRTGPAGAAGTGAVVPGVGVG
FT                   TEPDYRAALAAYVAGGAEGVGVWVRHCAGALELAARESLAVCEALSRG"
FT   gene            385842..386333
FT                   /locus_tag="Franean1_0321"
FT   CDS_pept        385842..386333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0321"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   fal:FRAAL6563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09787"
FT                   /db_xref="GOA:A8LF42"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF42"
FT                   /protein_id="ABW09787.1"
FT                   /translation="MTTDSSRAGREPTLGELVALATRDMSLLIRQEIELAKAELARQAV
FT                   SAGLGIGFLVAAAGLGLGAFIAGTVFLGELFTWAGLERFWAYLLTAVLYLAAAGLLVIF
FT                   AVTRFKRLSPPERTIQTVRDDIAWLRNPTNGSNGSARARTKPGNTGTPPAHLDDGPSAH
FT                   "
FT   gene            386441..387490
FT                   /locus_tag="Franean1_0322"
FT   CDS_pept        386441..387490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0322"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: fal:FRAAL6562
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09788"
FT                   /db_xref="GOA:A8LF43"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF43"
FT                   /protein_id="ABW09788.1"
FT                   /translation="MRAMEDATPESATVLVDGPWRHRDVSTNGTRLHVAEAGEGPLVLL
FT                   LHGFPQFWWTWRSQLRDLPRAGYRVVAADLRGYGASDKPPRGYDAFTLADDVAGLVRAL
FT                   GERDAVIVGHDWGGLLGWTTAVRRPRVVRALAVIGMPHPLRIRRQIAADPRGQGLASCH
FT                   LAAYQLPWRPERRLVADGAAHVGELLRSWGGPGYPAPETEARYRLAMRIPGVAHSSLEY
FT                   HRWVVRSLFRPDGARFAELLRTPVRAPTLQLHGRLDRCFLPSTAAGSDRHVAASYSWRL
FT                   YDGLGHFPHEEDPDTVTRDLITWLAETAPEQAPTAEGAAEPAPDAEPAAEPDAEPDVRP
FT                   EPGREYGRR"
FT   gene            complement(387501..388682)
FT                   /locus_tag="Franean1_0323"
FT   CDS_pept        complement(387501..388682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0323"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; Colicin
FT                   V production protein; KEGG: fal:FRAAL6561 serine
FT                   proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09789"
FT                   /db_xref="GOA:A8LF44"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF44"
FT                   /protein_id="ABW09789.1"
FT                   /translation="MNLLDLVLIVLVVMFAVSGYRQGFAVGALSFVGFLGGGVLGAKVA
FT                   RPFAELIGREEDGALVGLIVVVGLALVGQIAGTALGAALRGRLTWRPGQRLDAVAGAVL
FT                   SGMSVLLVAWLVATAVDRSPFQTLARAARGSEVLGTVDTTMPDDVRHTFADLRRLMDDQ
FT                   GFPEVFAGLDGERIVATDPPDPAVVSAADVQNAAASILKVRGQAPSCGKQVEGTGFVIA
FT                   PQRVMTNAHVVAGVTEAVVELDSGSLPAEVVLFDPDRDVAVLHVPGLLRPPLRFQSAPP
FT                   GDMGDSAVVAGYPQDGPYTTVPARIRNEQVARAPDIYSRGTVRREIYAIRGRVRPGNSG
FT                   GPLLSSAGTVYGVVFAAATDDNDTGYVLTADEVSEPARQGAQALVPVSTQSCD"
FT   sig_peptide     complement(388611..388682)
FT                   /locus_tag="Franean1_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.440 at
FT                   residue 24"
FT   gene            complement(388702..389118)
FT                   /locus_tag="Franean1_0324"
FT   CDS_pept        complement(388702..389118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0324"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   fal:FRAAL6560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09790"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF45"
FT                   /protein_id="ABW09790.1"
FT                   /translation="MTSRSARSALVALATAVAVLTALTGCGSGGGDAGTPSAAATLTPS
FT                   VSDGTQVFAVVGQVDQTFSARELVAHPGTIRVDFSVAKGSAPHNFVISAIPGATTRIVS
FT                   AGNSQSITFTADKPGRYPVVCTLHQGMTATLVIV"
FT   sig_peptide     complement(389017..389118)
FT                   /locus_tag="Franean1_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.498 at
FT                   residue 34"
FT   gene            complement(389115..389951)
FT                   /locus_tag="Franean1_0325"
FT   CDS_pept        complement(389115..389951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0325"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fal:FRAAL6559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09791"
FT                   /db_xref="GOA:A8LF46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF46"
FT                   /protein_id="ABW09791.1"
FT                   /translation="MSDPAPSGDPSSQDAHSASADGDAPPASADGDTRPASGGGAPVPP
FT                   WLTALMAAVGDGIPVQTRHARQTRPGGRAAAVLILFGEGPDGPDVLLLQRAADMRDHAG
FT                   QPAFPGGGADETDASRAATALREAEEEVGLDPAGVEVLATASPLYLAASHFLVTPVLAW
FT                   WRTPTAVDAVDPAETSSVARVPVAELADPANRILLWHPSGFGSPAFRVRGMTVWGFTAG
FT                   VLDALLRLGGWERPWDTETKVDVPEITVAISAAMALPHAVVEPRGPLDEAGGTVGR"
FT   gene            complement(389948..390673)
FT                   /locus_tag="Franean1_0326"
FT   CDS_pept        complement(389948..390673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0326"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: fal:FRAAL6558 endonuclease III (DNA-(apurinic
FT                   or apyrimidinic site) lyase); TIGRFAM: endonuclease III;
FT                   PFAM: helix-hairpin-helix motif; HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09792"
FT                   /db_xref="GOA:A8LF47"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF47"
FT                   /protein_id="ABW09792.1"
FT                   /translation="MATTVDARAETALARTRRARRIVRALGELHPDARIALHFSSPLEL
FT                   LVATVLSAQCTDKKVNEVTPGVFARYPTAAAYAAADRDELEAILRPTGFFRAKANSLMG
FT                   IGAALVERFDGEVPGRLEALVTLPGVGRKTANVVLGHCFGIPGITVDTHVGRLSRRFGL
FT                   TTETDPVRAESDLAALIERRDWTIASDRMIFHGRRVCHARRPACGACAIARMCPSFGTG
FT                   PTEPAEAARLVRGDAEAAR"
FT   gene            390793..391029
FT                   /locus_tag="Franean1_0327"
FT   CDS_pept        390793..391029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09793"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF48"
FT                   /protein_id="ABW09793.1"
FT                   /translation="MFVFAAITFPLVLLGLLLAMERVERPLNAADTGKGLEGFLDSARP
FT                   DEVATFVQQGLPAALERYRRRLRRTPPGKHRAA"
FT   sig_peptide     390793..390852
FT                   /locus_tag="Franean1_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.644 at
FT                   residue 20"
FT   gene            391269..392009
FT                   /locus_tag="Franean1_0328"
FT   CDS_pept        391269..392009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0328"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein Crp; KEGG: fal:FRAAL6556 putative Crp/Fnr-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09794"
FT                   /db_xref="GOA:A8LF49"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF49"
FT                   /protein_id="ABW09794.1"
FT                   /translation="MGVPGRALRPVSWHAQGVDDLLARVPLFAGLSEPDRQALSDHLDR
FT                   QDVTRGDVLFREGDVGDRVFVVLSGKVKIGRQSADGRENLLYVMGPGDLFGELSLFDPG
FT                   PRTATATAVTDASLVALEHTALRPWLRSRPEAGALLLRVLARRLRRTNDTMADMVFTDV
FT                   PGRVAKALLDLADRFGEPAQPGNEAAGVRVEHGLTQEELAQLVGASRETVNKALADFAT
FT                   RGWLRLDSRAVVLLDRERLARRAR"
FT   gene            complement(392138..395995)
FT                   /locus_tag="Franean1_0329"
FT   CDS_pept        complement(392138..395995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0329"
FT                   /product="adenylate/guanylate cyclase with TPR repeats"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: fal:FRAAL6555
FT                   putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09795"
FT                   /db_xref="GOA:A8LF50"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF50"
FT                   /protein_id="ABW09795.1"
FT                   /translation="MVISSPTTGPLVCPRCGTPTVPGGRFCFNCGLRFTQTDTPRAEAA
FT                   ERRVVTVLFGDLSDFTAWAEDRDPERVGEVTDRVLAALAREVDEVGGRVDNLSGDGIMA
FT                   VFGAPTAHEDDPERAVRAAAAMQETARRLIKDEGGDSSPLGLRVGVNTGEVLAGVQAAL
FT                   SYTVIGDTVNTAARLSGAAAVGTVYAGRDTVTATRSVATWRDLPPLVLKGKREPVPAYE
FT                   LVSLRPSNIARPGLADDATFIGREQELAELSRYFAGVVDAGQPDMAVVIGEAGIGKTRL
FT                   ARELAETAEATAGATVLWGRTVRHGDVRDLAPLIDLIRGACGITDGDTLDRVADRVRRT
FT                   VAGLTHPIFETKLPSGIGDRLLGMLGVPPDRRPSAGATTPPGDPVGRASHGEAVQRAAD
FT                   DAVETVGLLLSALAVRNPVLVVVDDLEWATSRLTTALRRLTTTLSGPVMLVLLDRESPQ
FT                   FSDLVGARRIALSPLPESAARALLKDYLGEPGLSRATQAELLARVHGNPFFLTELLNLL
FT                   VDRGLLHQVPDPGGEGMRWVLEGSLAATVLPAGVQSVLAARIDDLDAAAKAALRAAAVL
FT                   GPRFPAEALQVVGERPAAEVERALSVLTERQLVRPPRQGETLWRFVHPMARDVAYSGLP
FT                   KVERARRHATAARWGVTAMIGSSREVSTFVATHALRAYDLAASMALPAGDPAWSAREAG
FT                   FHAHVRLARSALARDDHRAAADLLADARRLGRGVIDGDDDINVRILHAEALVWLRRLDE
FT                   AERTLRPALRVNVPSRRAAAYAVLGELRQKQGRGEEARQSLITALEAAHRAGDDRAVAA
FT                   ALRRLGLLEYAAGRIQAAEERYREALSLARRVDDPRGVGWALQHLAWSATTRGDYAKAE
FT                   RTLREASAVFERLEDAGGLGWCSGTEALVLLLSGQLTRTRKVSRVLINLAESMRERWGQ
FT                   AVCLTIDAVAAAELGDIETAESEAARAAELFTETGDSWGRTLTLIARGLAARGAGRPRR
FT                   GADLLTEACAEAASTGHVLIGAFAQVLLGLTRLDAGEVDAAEEAARRALADLDRLELRP
FT                   HAQLGAKVLVAQIARARGRLDEAITELRGALSASEPATLMFPRRQAYAHLAGTLLDAGE
FT                   PDEALRVARQAVGVDAEDVRAQVLAYRALGTVLAAHGDVEGSREAYEQALAAATATGAI
FT                   SEAPQTRRLLAALPGSAPDALDAPDGLDAADGLGAADGLGVADGLGTPHQDGLAAQDDL
FT                   SAQDGLGAAAALAKVSVNGTRARARTAARLPGSPVVVPVADPSGEAVPSVEMPPAEGTS
FT                   R"
FT   gene            complement(396470..397249)
FT                   /locus_tag="Franean1_0330"
FT   CDS_pept        complement(396470..397249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0330"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   fal:FRAAL6554 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09796"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF51"
FT                   /protein_id="ABW09796.1"
FT                   /translation="MTALRRVTKLASVVLAPNPGPMTLDGTNTWILRSPGDAGCVVVDP
FT                   GPDHGEHLARVAAAGLVRTILLTHGHSDHSEGAATLHALTGAQVRALDPAHRLGSEGLG
FT                   AGDVVAAAGVELRVLATPGHTSDSLSFVLAGDDEHPAVLTGDTILGRGSTVVAHPDGRL
FT                   ADYLSSLRLLRELGDTTVLPGHGPELPAAGRAAEAYLEHRARRLDQVISALADLGASAE
FT                   QVTPIDVVRIVYADVDVALWPAAELSVRAQLDYLRPR"
FT   gene            complement(397246..398352)
FT                   /locus_tag="Franean1_0331"
FT   CDS_pept        complement(397246..398352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0331"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fal:FRAAL6553
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09797"
FT                   /db_xref="GOA:A8LF52"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF52"
FT                   /protein_id="ABW09797.1"
FT                   /translation="MADHQAAIVARFGTSRRMEPEEELRLARLAANPAPARDAATVVLL
FT                   RDAPAGSGIEAYLLRRTRAMSFAGGMHVFPGGRVDPSDAAEDLPWVGPSVEEAMPGLDD
FT                   DPARARALVCAAVRETFEECGVLLAVPTGTSAASRVAPAGGATPTGRNVPAGRVDAAGG
FT                   AAGTGDPGTGDPGWAAERRAVESHRSGLAELLTRRGLALRADLLAPWTRWIAPELEPRR
FT                   YDTRFFVAALPAGQLPGELATELSTEADGMLWIRPAEAMERFVAGEIGMLPPTAFTLAE
FT                   LSAYDDVAGALAAARTRDLKPIMARIIAGDGTWQLSFPHLLPLDGAPGTPLDGAPGTPL
FT                   DGALGTEPGTPSKTAPAPAAGTRGGVPR"
FT   gene            complement(398391..398882)
FT                   /locus_tag="Franean1_0332"
FT   CDS_pept        complement(398391..398882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0332"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: fal:FRAAL6552
FT                   putative translation initiation inhibitor; putative signal
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09798"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF53"
FT                   /protein_id="ABW09798.1"
FT                   /translation="MTAPVPPAAATTPSGRLAELGLVLPAVPTPAGAYVPAVRDGDLVW
FT                   TAGQLPLVAGKLLASGLVGAEITAERAAELARVCALNALAAAAAAVGGLDTITRIVKVV
FT                   GFVASAPGFVGQPVVLNGASELLGAVFGAAGLHARSAVGVAALPLGAPVEVELVARVAG
FT                   "
FT   gene            complement(398969..399130)
FT                   /locus_tag="Franean1_0333"
FT   CDS_pept        complement(398969..399130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09799"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF54"
FT                   /protein_id="ABW09799.1"
FT                   /translation="MQTKWEYMTAPLLIHATKQILDNFGADGWELVQVVPGPNPESLVA
FT                   YFKRPKSQ"
FT   gene            399250..400269
FT                   /locus_tag="Franean1_0334"
FT   CDS_pept        399250..400269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0334"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: fal:FRAAL6550
FT                   putative ion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09800"
FT                   /db_xref="GOA:A8LF55"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF55"
FT                   /protein_id="ABW09800.1"
FT                   /translation="MTGDDNAPAATAGPWDCRLHIVTGKGGTGKTTIAGALAVALATGG
FT                   RRVLLTEVEGRQQIAQLFDTPPLPYRERKVASAPGGGEVFALAIDADEALLEYLEMFYN
FT                   LRRAGRALGRIGAVDFATTVAPGVRDVLLTGKVKEAVNRPDGTRPSGLAYDAVVLDAPP
FT                   TGRIARFLNVTAEVAGLARMGPIRAQADSVMAVLAPDRAAVHLVTLLEEMPVQETVDGI
FT                   RELREVGLPVGAVVVNMVRSPLLAPGDLDLARRGQLDREELATGIKETGIEPTEELISN
FT                   LAWEAAQHAERVALETAQRAEIAALGRPVYEVPLLADGVDLGSLYRFAEMLRAQRMVA"
FT   gene            400644..401774
FT                   /locus_tag="Franean1_0335"
FT   CDS_pept        400644..401774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0335"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: fal:FRAAL6549
FT                   putative anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09801"
FT                   /db_xref="GOA:A8LF56"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF56"
FT                   /protein_id="ABW09801.1"
FT                   /translation="MDVDAMLDTERIIVCCGSGGVGKTTTAAALALRAAERGRRVVVLT
FT                   IDPARRLAQSLGLTALDNNPREVAGVDPAAGGHLDAMMLDMKRTFDEIVLDHSTPERAE
FT                   ALLANPFYQSLSSSFAGTQEYMAMEKLGQLDASGSWDLIVVDTPPTRSALDFLDAPNRL
FT                   GDFLDGRLLRLLLAPAKAGGRAYAKVIGASLGMFTRVITKVLGAQLLADVSQFVAALET
FT                   MFGGFRARADETFRLLAAPGTSFVVVAAPEAAALREASYFVDRLDADGMPLAGLIVNKM
FT                   HFCAASALTVERGLAAAENLTDHGEHPLAAAVLRIHADRARLAEREVRLRERFTSAHPD
FT                   TALVEVEALSEDVHDLAGLREIGRALAGDERAAAAG"
FT   gene            complement(402236..402592)
FT                   /locus_tag="Franean1_0336"
FT   CDS_pept        complement(402236..402592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0336"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: fal:FRAAL6548
FT                   putative WhiB-family transcriptional regulator; putative
FT                   role in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09802"
FT                   /db_xref="GOA:A8LF57"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF57"
FT                   /protein_id="ABW09802.1"
FT                   /translation="MTRSLTPPVSLSRRTSTTGLVGSTTDGDWTAHAACRDLDPDELFV
FT                   QGAAQNRVKTRCFGCVVRTECLADALDNHVEFGVWGGMTERERRALLRRRPDVTSWRKL
FT                   LADAQADHRSASAG"
FT   gene            403117..405732
FT                   /locus_tag="Franean1_0337"
FT   CDS_pept        403117..405732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0337"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; PASTA domain
FT                   containing protein; KEGG: fal:FRAAL6546 hypothetical
FT                   protein; putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09803"
FT                   /db_xref="GOA:A8LF58"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF58"
FT                   /protein_id="ABW09803.1"
FT                   /translation="MHPAVPRVPRVPRVPRVRSVPGATVGPGVIRSRLRGAADARSTWQ
FT                   SGLSAPASGLASRHIGPDSARRRRVTPKRLLGILTTSVAAGVLVGMLALPVVGLAGVTA
FT                   KGGADHFLSLPANLTVPPLAQPSRILDAAGNQIAVLRGEQDREIVALDKVPPQMRQAMI
FT                   DIEDARFYEHTGVDYRGMIRAYLANQESGGVTQGGSTLTQQYVKNVLLASARTPEEKAA
FT                   ATEQTVDRKLREARYALYLEEHLTKDEILERYLNIAYFGDGAYGVQAAARHYFNIDVSQ
FT                   LGVTQSAMLAGLVKNPTAYNPALHPQAARERRNIVLDRMHELGHLDAAAWKAGRAEELV
FT                   LDRPARSPDACQDSSAPFFCSYVRQVLLADRTFAATPEDARRLLFEGGLTIRTTLDPVA
FT                   QGAAQTSAREVIPTGNRVAAGVAMVQPGTGNVLALAVNRDYGTPDDNQPPALTADFVHT
FT                   KEIYPVDPDSFSPGSTFKVFTLAAALENNIPLSTTFHSPLCYHSDRFPNPDPGGKNCYS
FT                   NADPSEDGFYSLTTATWNSVNTYYIQLAERLGVMKTAEMARRLGVSSCRIRPNEENDPE
FT                   CKGVEGIGPVDGSAILGSNEISTLDLATAYATLAARGNRCYPRTVLSITQRVGTADRPL
FT                   AFNTGKPCEQVLAPGIADTVASVLQGVINHGTASGNAQIGRPAAGKTGTAEAFSTASFA
FT                   GFIPQLATAVTLADPRGPTTHQLRNVLTSRVVFGGGFPAQIWARTMTRTIDGLALPVMP
FT                   LPAPDNTQPQVPKKALPDVRGQSQQAAEYALRSLGFRVRSETVPHVAPPGIVVGMAPGP
FT                   GEEISMDTEVVLQVSGGLTGAVLLPNGAGARPGQPAAPPAGDGRAGIPGLPDLRNQLRN
FT                   "
FT   gene            complement(405763..406221)
FT                   /locus_tag="Franean1_0338"
FT   CDS_pept        complement(405763..406221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09804"
FT                   /db_xref="GOA:A8LF59"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF59"
FT                   /protein_id="ABW09804.1"
FT                   /translation="MSTLKERLREDLTVAMRARDDLRLSTLRLALAAVKDAEVAGTAAR
FT                   ELDDAEVEKILAREVRKRREAAEAFAAAGRPEQSSRENAEGDVLADYLPSQLGEDELRA
FT                   IIDEVMAELGLTGMKAMGQVMKAAQARIAGRADGKRVSELVRARLSES"
FT   gene            406453..407364
FT                   /locus_tag="Franean1_0339"
FT   CDS_pept        406453..407364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0339"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: fal:FRAAL6544
FT                   conserved hypothetical protein; putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09805"
FT                   /db_xref="GOA:A8LF60"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF60"
FT                   /protein_id="ABW09805.1"
FT                   /translation="MRPSRGTVRAVSGLAAAGLGTALYAGVYERTAYTLRRREVAVLSP
FT                   GSTSLRLLHISDLHVTPNQHGKFAWLSDLARLVPDLVVLTGDVLSHPRAQAPLLAALDP
FT                   LFTFPGLFVPGNNDYHAPTLRSPHRYLGRTNTPGPKGPALDWAGFARALATASGWRELT
FT                   NIRGTIDIGGRTLDLRGVDDARLRRDRLALVSGPPEPGTALGLGLSHTPEPRVLDAFTA
FT                   DGVDLILSGHTHGGQIRLPGYGALVTNCGIDRERAWGLSRHAAGGRHSWLHVSAGLGTS
FT                   PFAPFRFNCRPEATLLTLTERR"
FT   sig_peptide     406453..406530
FT                   /locus_tag="Franean1_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.940 at
FT                   residue 26"
FT   gene            407515..407591
FT                   /locus_tag="Franean1_R0007"
FT                   /note="tRNA-Pro1"
FT   tRNA            407515..407591
FT                   /locus_tag="Franean1_R0007"
FT                   /product="tRNA-Pro"
FT   gene            408054..408719
FT                   /locus_tag="Franean1_0340"
FT   CDS_pept        408054..408719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0340"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: fal:FRAAL0823 putative two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09806"
FT                   /db_xref="GOA:A8LF61"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF61"
FT                   /protein_id="ABW09806.1"
FT                   /translation="MRVTPTRVVLADDAPLFRQAIAWLLEQHDFQVVGQVSDADGLRNA
FT                   VSALRPDIAVIDIRMPPTGRLEGLESAVELRARHPDLGVLLLSHYLESHYLPVLFGANA
FT                   RGVGYLLKERVTGIEAFVEAVTRVAAGGCVLDPEVVDLMIAARSRRDPLHTLTAREREV
FT                   LALMAEGRSNQAIGAQLVLTPKTVESHVRSIFTRLGLAPEPDDHRRVLAVLTYLRAHH"
FT   gene            409243..410526
FT                   /locus_tag="Franean1_0341"
FT   CDS_pept        409243..410526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09807"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF62"
FT                   /protein_id="ABW09807.1"
FT                   /translation="MTSQVSIDLRPGVPKEGGTRAVAAKPRRRRRKDRTGFTAVARAGR
FT                   RRAAGFLLAVVVLVGASACQAEYKPPFAPIVFAIDENGNIDVSASRDLVTPIGTFTISE
FT                   SVALPRDVPSDRTLMILRHKVAGELKDAWFTLLAAVNLHFSVDGANRLVPQAEENVALL
FT                   EVTGPATGVVAEATDDDSGDRFESEQVEVLPEVPEDTDPSATPDDGGPSGGPSGGSGEP
FT                   GIEVTPETLSCDDSGCAGTVTVESTGTGTLRVTSTEIIGPDADAFSVDAGCEAELPPGG
FT                   QCTLSVGYVPLDSGEAAAATLVIHQNLSGPANEVNLEGSAGTTPPGPEPGIAVTPETVF
FT                   CTSSACQPVTVESTGDDPLAVTSVEIVGSGAAAFSYTSDCEGASLPTGARCVVTPEYTP
FT                   QGGSDATATLVIHHNLAGPATEVTLSAS"
FT   gene            complement(410546..411694)
FT                   /locus_tag="Franean1_0342"
FT   CDS_pept        complement(410546..411694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09808"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF63"
FT                   /protein_id="ABW09808.1"
FT                   /translation="MRLLSVGALTIAAVCGLAACGGASGDASSAGGRGSGGEVRAVDGP
FT                   VDMGSLNEVCAGNVALTSAPPYTGPTPHPVALFSQQQGNDPTGSTFPVRLLQDMGQPER
FT                   DAFLAPPAQAQLVACAERDAREPTDVICHFDIGSQEQVPFFRTSYRITVRAARTGQVVA
FT                   TVPVNPAAAGCPTSVKVAWSGAEVFSAPTDRQIVTALTPFVSWDGTGTPPASTGPEDAP
FT                   AAGGAPVIAGSVQMTTGPGVDPASPAVRVHLTFWDAFARAQEGDRAALGTLLDQVDGSF
FT                   FGMLTTLLDQNRAIPGRSVRGPLRLLVTGVSAGPEGGAVAVDSCLDETGRETLEQSLPT
FT                   GQIGIASRIRVNLARDSTGEYRVTGFADAPPAPCPSPAGRIS"
FT   sig_peptide     complement(411617..411694)
FT                   /locus_tag="Franean1_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.770 at
FT                   residue 26"
FT   gene            411963..412901
FT                   /locus_tag="Franean1_0343"
FT   CDS_pept        411963..412901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0343"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_0351 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09809"
FT                   /db_xref="GOA:A8LF64"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF64"
FT                   /protein_id="ABW09809.1"
FT                   /translation="MKAVRAGNGGVSVVDLEEPPGSGEVLKIAAASICSSDLLYIRLGS
FT                   QRIIGHELAGVREDGSAAIVEAIMGCTVCDLCRQGRYNLCVQHTKQALGATADGGIAEQ
FT                   FRVPSERLVPLPAGLDVRDAPLVEPASVSWHALRLAGTGPNTRVAVVGAGALGLLAVAG
FT                   ARHQGAPEVALDARHPHQAEAGERLGATLAHDGLYDVVVEAAGSTSGLDRAIDLVAPGG
FT                   TVVCVGVQLESKVGVNWSPLFHREGRLIPSMGYCAHENGREMEDAAAMLAKDPEITRTL
FT                   ITHRFPIADAAEAFRVAADRKAGALRVVIEP"
FT   gene            412898..413734
FT                   /locus_tag="Franean1_0344"
FT   CDS_pept        412898..413734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0344"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sth:STH1875 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09810"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF65"
FT                   /protein_id="ABW09810.1"
FT                   /translation="MSTVGIVTGAGRGMGLACAHRLVDLVDVLLLVDRDPAVAGVVGEL
FT                   TKAGSATVEPFVLDITDVDGVERLAARVAELGTLRAVAHAAGISPTMADWRRIFAVDLV
FT                   ATAQLAQALRPLTTAGTASVYFASMAPILAIGEPHPTADAALDDPLAPDLLDRIHAALG
FT                   ATVEDSGWAYSWAKRGVQRFAQQEAVRVGPLGGRVCSLSPGIIDTPQGKQEAAEHSSMQ
FT                   ALVERTPVGRIGQSEDVADVVAFLLSDQARFVSGIDVLVDGGVAAAVRGPAAAAVR"
FT   gene            413781..414614
FT                   /locus_tag="Franean1_0345"
FT   CDS_pept        413781..414614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0345"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mav:MAV_3689 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09811"
FT                   /db_xref="GOA:A8LF66"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF66"
FT                   /protein_id="ABW09811.1"
FT                   /translation="MTYGSGVSVVGESEPVVVVETADRVTTVTLNRPAARNALSRALTH
FT                   ALWDAVAAAGDDPGVDAVILTGADPAFCAGVDLKEVSGEVPPSAVPRGPGEGPERYDNG
FT                   LFRFLPVIDKPVIGAVNGVAVTGGLELALQCTFLVASERALFADTHARLGIMPGGGATV
FT                   LLARSIGLRRAVEMSLTGNFLTAAEALRLGLVNHVVPHDELLGCARRLAGDIVSNDGQS
FT                   VRRLLLHYRQLANTATLDEAHLAEGLMAEMWRPGTSHVAARRTDVTQRGRQQTRA"
FT   gene            complement(414755..416194)
FT                   /locus_tag="Franean1_0346"
FT   CDS_pept        complement(414755..416194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0346"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mkm:Mkms_3749
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09812"
FT                   /db_xref="GOA:A8LF67"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF67"
FT                   /protein_id="ABW09812.1"
FT                   /translation="MKRLLIDGKLVETERTVDSINPSTGEVIGQAADATVEETTAAVKA
FT                   ARKAFDTTDWSTNVAFRVQCLNQLHDVLVKHKEELRELTIAEVGHPRMITDGPALGDPI
FT                   NLVKYYADLTAGYQFTQDLGTVESRGAQHHRWIEREPAGVVSAIVAYNYPTQLALAKLA
FT                   PALAAGCTVILKGAPDTPLLALALGELIANETDIPAGVVNVITSIDIDAAEVLTGHPDV
FT                   DLITFTGSTAVGRRIMEVASKTVKKVFLELGGKSALVILDDANHDLAAMMAAFTICSHS
FT                   GQGCAITSRLVVPRAQHDAIVEKVAAMLGQIKVGNPTEPDTYMGPLISEKQRDKVDGIV
FT                   QRAIAAGATLVTGGEKINPGFFYAPTLLAGVDPDSEIAQEEIFGPVLAVIPHDGDDDAV
FT                   NIANNSIFGLSGSVLSADTDRALAVARRIRSGTISVNGGSWYAPDAPFGGYKQSGIGRE
FT                   SGTPGLEEFLEIKTIATPAAS"
FT   gene            complement(416191..416526)
FT                   /locus_tag="Franean1_0347"
FT   CDS_pept        complement(416191..416526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09813"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF68"
FT                   /protein_id="ABW09813.1"
FT                   /translation="MEIHGDPWISGPAGPGLLHCQTVDSEFGVSRITTRNTTWRSGRDR
FT                   DVSGSTGPPARPARPGTRRRKEVEMRTGSEAAGTTRGGRRSGVHLGTLTVTTSESSKMI
FT                   DINEERL"
FT   gene            complement(416807..418222)
FT                   /locus_tag="Franean1_0348"
FT   CDS_pept        complement(416807..418222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0348"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; KEGG: fal:FRAAL6537 prolyl-tRNA synthetase
FT                   (proline--tRNA ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09814"
FT                   /db_xref="GOA:A8LF69"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF69"
FT                   /protein_id="ABW09814.1"
FT                   /translation="MDDVAVLTPRSTDFPRWYQDVLDKAELADNGPVRGTMVIRPYGYA
FT                   LWERMQADVDTRIKAAGAVNAYFPLFIPESYLRREAEHVEGFSPELAVVTHGGGKELAE
FT                   PVVVRPTSETVIGEYMAKWTQSYRDLPLLLNQWANVVRWELRPRLFLRTSEFLWQEGHT
FT                   AHADAADAAAYARRIALEVYREFMTSVLALPVFVGAKTRKERFAGAINTMTCEGMMGDG
FT                   KALQMATSHELGQNFARAFDIDFLGPDGGRHLAWTTSWGSSTRMIGGLIMAHGDDNGLR
FT                   VPPVLAPTQVVVLPVRDDDAVVTKAREITDALTALGVRARLDARPGLSFGRRVTDAELK
FT                   GIPVRVEVGPRDLAAGNVTLARRDTAEKFPVPLGEAAGRVPVLLDEVQASLYAQALALR
FT                   DERTSDVTSLTEAVEAAATGFARLPWRLVGEDGEARLAEDSLTVRCLQTPDGALPTADT
FT                   RDEDLVCLVARAY"
FT   gene            complement(418581..418832)
FT                   /locus_tag="Franean1_0349"
FT   CDS_pept        complement(418581..418832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09815"
FT                   /db_xref="InterPro:IPR023817"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF70"
FT                   /protein_id="ABW09815.1"
FT                   /translation="MPEPRPVSGGPPPSLAEVVTVRNGLLVEHELVLAPGATAADLTSA
FT                   MILVPPAAALVSHHGDVDLSLIFREVPRPDSEDAVAHH"
FT   gene            418902..419234
FT                   /locus_tag="Franean1_0350"
FT   CDS_pept        418902..419234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09816"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF71"
FT                   /protein_id="ABW09816.1"
FT                   /translation="MSRAGSETGVFSASWSRRRDLVPAVGLTGGAGGSVGQPVPAGPVR
FT                   RAERGRRHPVLAVTGDRTRHERSATRWRRLAAPSPSSREFRVVPWRARMRPEGRRRRRD
FT                   VRSGRA"
FT   gene            complement(419550..420047)
FT                   /locus_tag="Franean1_0351"
FT   CDS_pept        complement(419550..420047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0351"
FT                   /product="Rossmann fold nucleotide-binding protein-like
FT                   protein"
FT                   /note="KEGG: mka:MK1390 predicted Rossmann fold
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09817"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF72"
FT                   /protein_id="ABW09817.1"
FT                   /translation="MRQVAVIGPGEATPEQETDAERLGAGLARLGLTVVTGGLGGVMAA
FT                   ASRGARAAGGRTLGLLPGNDPATANPWIDVVVPTGLGEARNVLVVRSAAAVVAVGHGWG
FT                   TLSEVALALRTGVPVVSLRSWAPTPPAGDPRHRDQPTSVQVATGVTDALARVQAVLEAA
FT                   VP"
FT   gene            420297..421421
FT                   /locus_tag="Franean1_0352"
FT   CDS_pept        420297..421421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0352"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: fal:FRAAL6535
FT                   high-affinity phosphate transport protein (ABC
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09818"
FT                   /db_xref="GOA:A8LF73"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF73"
FT                   /protein_id="ABW09818.1"
FT                   /translation="MDEGLLVNLGKRQIVAGLAAAALLSLAACGSDDNTDTADGTAPTA
FT                   SAGAIDCAKGSITGSGSSAQKNAMDEWVSAYQDACDGATINYQGSGSSTGRQQFIDKQV
FT                   TFAGSDSALKDAQKTAADARCTGGAAVDIPMVVGPISLIYNLDGVDKLNLSPSAIAKIF
FT                   SGAITKWNDPAIAADNSGVSLPDAPIQAVHRSDGSGTTDNFTKFLKGAAASDWTFEGGS
FT                   DWTAPGGQGAKGSDGVTSTVKSTPNAIGYVELSYAENASLPTALVGNASDEFIAASTDA
FT                   ASIGISSAKVADGDDLKLTFDYTTATKGAYPIYLATYEIVCTAGTPADQAPLLKSFLTY
FT                   IASADGQAAIGDLGYAPLPDEIATKVRGVIAKIA"
FT   sig_peptide     420297..420389
FT                   /locus_tag="Franean1_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.891 at
FT                   residue 31"
FT   gene            421590..422741
FT                   /locus_tag="Franean1_0353"
FT   CDS_pept        421590..422741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0353"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: fal:FRAAL6534
FT                   high-affinity phosphate transport protein (ABC superfamily,
FT                   membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09819"
FT                   /db_xref="GOA:A8LF74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF74"
FT                   /protein_id="ABW09819.1"
FT                   /translation="MTTEPGSPADAGSRGTGSPTTPEAATAPAAEAAPTSTTSTDITAA
FT                   GATPPGATPPGTTPPELVPPDITPPADAKPKVGLADVVFKNLTRTAGVSLLVLIALIAI
FT                   FLVLRATDALSANTGNFLTTEEWRANADPPVFGVAALLFGTLVSAVGALIIAVPVAVGI
FT                   ALFITIYAPRRLASGLGFIVDLLAAVPSVVYGLWGLIVLAPHFNGTQSWLADYFGWIPL
FT                   FDTGAGTVGRSMFLASVVLAIMILPIVAAISREVFSQVPITHREAALALGATRWEMIRT
FT                   AVIPYGKPGVISASMLGLGRAMGETIAVALVLPASFDISWKILTPAGNTIAANVANGFG
FT                   EANDIGKGALIASGLVLFVVTMVVNMIARAVIARRREFSGRAA"
FT   gene            422738..423802
FT                   /locus_tag="Franean1_0354"
FT   CDS_pept        422738..423802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0354"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: fal:FRAAL6533
FT                   phosphate ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09820"
FT                   /db_xref="GOA:A8LF75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF75"
FT                   /protein_id="ABW09820.1"
FT                   /translation="MSTATTAPPAPVSGGSLNLRGQTLSRPVLGAIAVGAVVLTLLLYL
FT                   VTSIHSRIQFVLIALILFGIGQTVASVVVEGSRRARDRLVTSAVFGSFLLALIPLLAIV
FT                   VSVVSRGAKRLDGNFLTHSMRSINAREAGGGVYHAIIGTLEQVGLASVMAVPFGLLVAI
FT                   YLVEYGTGRISRVISFFVDVLTGLPSIIAGLFVLGFWILALGQSFSGFAGALALTILMI
FT                   PVVVRSAEEMLKLVPDELREASYALGVARWRTILKVVLPTALPGIVTGVMLAVARVAGE
FT                   TAPLLLTVFGANSINFNPFSGEQSALPLYIYSQAGQPQQVAIDRAWAAALTLIIIIMLL
FT                   NLLARLVARRATIK"
FT   gene            423907..424683
FT                   /locus_tag="Franean1_0355"
FT   CDS_pept        423907..424683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0355"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: fal:FRAAL6532 high-affinity phosphate
FT                   transport protein (ABC superfamily, atp_bind); TIGRFAM:
FT                   phosphate ABC transporter, ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09821"
FT                   /db_xref="GOA:A8LF76"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF76"
FT                   /protein_id="ABW09821.1"
FT                   /translation="MATRIDISGLTAYYGKFKAVADVNLTIEPKTVTAFIGPSGCGKST
FT                   VLRTLNRMHEVLPGARVEGKVLLDGEDLYGPGVDPVNVRRNVGMVFQRPNPFPTMSIYE
FT                   NVIAGLKLNGVRKKALLDERVEESLRGANLWDEVKDRLNRPGAGLSGGQQQRLCIARAI
FT                   AVEPQVLLMDEPCSALDPISTLAIEDLIQKLRSSYTIVIVTHNMQQASRVSETTAFFSL
FT                   EKTGDPGRLVECDRTSQIFSNPKEKRTEDYVSGRFG"
FT   gene            424695..425768
FT                   /locus_tag="Franean1_0356"
FT   CDS_pept        424695..425768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0356"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: fal:FRAAL6531 putative
FT                   two-component system, regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09822"
FT                   /db_xref="GOA:A8LF77"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF77"
FT                   /protein_id="ABW09822.1"
FT                   /translation="MWPTASGGGDGAVAPAAPDHGQPSPWLLIADDEANDELLPALRGR
FT                   GVEVSVVTDGAQALVEIGRLDPSAVLISARLPVVDGVTVIRTVRSVAGRDTTPILFAVG
FT                   PGDREQAAAALEAGASACVGKPYRLHEVLAMVGAVGGLAAVTAGLGAPGGLGAPGGLSG
FT                   SGTRMTPAAGRAGSFGGPEGAGGFGAGPEHVGGIGGLLAAGGPGRPGLAGALTVPAASS
FT                   VLRSGPVVLDVDAHEVTVDGRAVHMPPREFRLLHLLLGHAGRVVTRETLLTEVWGSADT
FT                   DPNTLAVHVRRLRRRLGDSISGAADGAAQRHDSADAPSVSSRPVVTSRGLIDVHPPLIE
FT                   SIRGIGYRFRAPAPRPT"
FT   gene            complement(425875..426786)
FT                   /locus_tag="Franean1_0357"
FT   CDS_pept        complement(425875..426786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0357"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09823"
FT                   /db_xref="GOA:A8LF78"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF78"
FT                   /protein_id="ABW09823.1"
FT                   /translation="MGGVPRLETIPAMTSVRMADEVLEWFAVCARDLPWRRPETTPWGV
FT                   LVSEIMLQQTPVNRVLPVWAEWLSRWPAPADLAAEPSGEAVRAWGRLGYPRRALRLHQA
FT                   ATAMLERHGGAVPDELDDLLALPGVGSYTARAVAAFAFRQRHAVIDVNVRRLVARAVEG
FT                   VAEGPTSVSRRDLALVADLLPADPETAARASAAFMELGALVCVARAPRCAACPVRDRCA
FT                   WLAVGSPPSEGPARRPQGYAGTDRQVRGRLLAVLREATGPVEQADLDAVWDEPVQRDRA
FT                   LAGLLTDGLVSRTAPGVYALPR"
FT   gene            complement(426847..427926)
FT                   /locus_tag="Franean1_0358"
FT   CDS_pept        complement(426847..427926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0358"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: fal:FRAAL6529 nucleic-acid-binding
FT                   protein protein, containing HHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09824"
FT                   /db_xref="GOA:A8LF79"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LF79"
FT                   /protein_id="ABW09824.1"
FT                   /translation="MAGPPGDDIFRATLAAVAPGTPFRDGLERILRGHTGALIVLGHDK
FT                   VVEGLCTGGFELDVEFSATRLRELAKMDGAIVLSSDLARIVRAAVHLVPDPTVPTEESG
FT                   TRHRTAERVAKQTGFPVISVSQSMHIIALYVAGRRYVLDGAAAILSRANQALATLERYK
FT                   LRLDEVAGTLSALEIEDLVTVRDAISVSQRLEMVRRIADEIESYVVELGTDGRLLSLQL
FT                   EELMAGVETERELTVRDYLPVGSRAGNAAQVLAELSAMSPTDLLDLTVIARVIGFSGGA
FT                   DILDRQISPRGYRMLAKVPRLPRMVVDRLVDHFSTLQKLLAAGVDDLQAVDGVGETRAR
FT                   AVREGLSRLAESSILERYV"
FT   gene            complement(428073..429545)
FT                   /locus_tag="Franean1_0359"
FT   CDS_pept        complement(428073..429545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0359"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: fal:FRAAL6528 putative ATP-dependent protease,
FT                   with nucleoside TriP hydrolase and multiheme cytochrome
FT                   domains, DNA repair protein; TIGRFAM: DNA repair protein
FT                   RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09825"
FT                   /db_xref="GOA:A8LF80"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF80"
FT                   /protein_id="ABW09825.1"
FT                   /translation="MSSTGPAARSGAGAGRASSRAGAGSRNPAGGFRCSACEAEAVRWA
FT                   GRCPRCQAWGTLDAQAPAPRRAGGFSGGLGGTGRIGAAAPVTAPATPVTAVDVTTARSR
FT                   PTGIGELDRVLGGGIVPGAVILLAGEPGVGKSTLLLEVAARSAATGSRSLVITGEESAA
FT                   QVRLRAGRTGALHPDLWLAAETDLGAVLTHVEQVQPALLVVDSVQTISSSGFDGSAGGV
FT                   TQVREVAGALIRTAKALGLATVLVGHVTKEGAVAGPRLLEHLVDVVVHFEGERHSTLRL
FT                   LRAGKNRYGPADEVGCFEMHDSGIREVADPSGLFLSRSGGAGPAAVPGTCVTVTVEGRR
FT                   PLVAEVQALVAEASAQVPRRAVSGLDAARVAMILAVVERRARVRFGRADVYTATVGGVR
FT                   LAEPAADLAVALATVSAARDRPLPGDLVAIGEVGLAGEVRSVGAVRARLAAAARLGFRR
FT                   ALVPTGSGEAPEGLTVQEVPDLIAAIAHMYDE"
FT   gene            complement(429889..430659)
FT                   /locus_tag="Franean1_0360"
FT   CDS_pept        complement(429889..430659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0360"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: fal:FRAAL6527 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09826"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF81"
FT                   /protein_id="ABW09826.1"
FT                   /translation="MSRRLGARSATSTIHGTPHVEATETGGPGHAPEVGGGPRTARRGR
FT                   VRARAALATSVAAAAVAAAALSGCASGTDALTNSARTTTNTVSGAVGSVTLRNVYVAGP
FT                   ANEGGSAQIISAVFNGGAEEDSLIGISSPAASSGTAPKPSIIRPGAGNIYIANGSAPTL
FT                   TGLNETLAIGDEVPVTFTFAKAGSVTLDVPVEAPAPGASGGPVAPTVPAETSASPSGTA
FT                   TPSSGAPAESGAPAVGGTTTEPGAPAGAPTAPTA"
FT   gene            complement(431162..431545)
FT                   /locus_tag="Franean1_0361"
FT   CDS_pept        complement(431162..431545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4461 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09827"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF82"
FT                   /protein_id="ABW09827.1"
FT                   /translation="MALRRKLSGCWHQERRDTTVPTPLAPHRPAEGPPEPPSAPGVSRR
FT                   LGGRLPPPPARPLALAVRPKTGRPPRGPKTLFPRALRPFSPGPVESGRPAPRVPGPSRP
FT                   PCSVRATGPSHDEADLPDIRSRR"
FT   gene            431765..432247
FT                   /locus_tag="Franean1_0362"
FT   CDS_pept        431765..432247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0362"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: fal:FRAAL6525
FT                   putative CarD-like transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09828"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF83"
FT                   /protein_id="ABW09828.1"
FT                   /translation="MAFQVGETVVYPHHGAALIDAIETRVIKGEEKLYLVLKVAQGDLT
FT                   VRVPADNVGMVGVRDVVGQDGLERVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRRDRERGLSAGEKRMLSKARQILVSELALAEGTNEDKAEAMLDEVLAG"
FT   gene            432452..433141
FT                   /locus_tag="Franean1_0363"
FT   CDS_pept        432452..433141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0363"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   fal:FRAAL6524 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09829"
FT                   /db_xref="GOA:A8LF84"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF84"
FT                   /protein_id="ABW09829.1"
FT                   /translation="MSTRVGALVPAAGRGERLGGGTPKALRPLGGRPMLLRAVETLLSS
FT                   TLVSQVVVAAPPTLVEVVGQILGPRVRVVPGGAERVDSVRAALEALDDDIGVVLVHDAA
FT                   RPLTPAKLVDAVATTVLDGHPAVIPVLPVTDTVKEVDADGRVVRTPPRDVLRAVQTPQG
FT                   FRRDILHTAYANRDLPVTDDAGLVEALGVPVTTIPGAEEAFKVTRPADLVLAEALLAQF
FT                   APGDGQR"
FT   gene            433138..433620
FT                   /locus_tag="Franean1_0364"
FT   CDS_pept        433138..433620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0364"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: fal:FRAAL6523 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09830"
FT                   /db_xref="GOA:A8LF85"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8LF85"
FT                   /protein_id="ABW09830.1"
FT                   /translation="MTEPSLPRVGTGVDVHPFEQGRECWVACLLWPGETGLAGHSDGDV
FT                   ASHAACDALLTASGIGDLGAVFGTGRPEWSGASGAALLGETARLLAEGGWLIGNVAVQV
FT                   VGNRPRMAARRVEAQEAMSAALGAPVNLSATTTDGLGLTGRGEGLAAIATALVTRV"
FT   gene            433843..434235
FT                   /locus_tag="Franean1_0365"
FT   CDS_pept        433843..434235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0365"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: fal:FRAAL6522 hypothetical protein;
FT                   putative oxidoreductase; putative FMN-binding split barrel
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09831"
FT                   /db_xref="GOA:A8LF86"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF86"
FT                   /protein_id="ABW09831.1"
FT                   /translation="MAARLPESVRALADAPTYVTLATIRPDGSPRLTVLWIARDGDELL
FT                   LSTVRGRAKERDIARDQRVGLMFLDQRDPYSYVEVRGLATLSEEGGKELIDQLATKYTG
FT                   SPYQWDGPDEVRLVIRVVAERVLTTG"
FT   gene            434305..435825
FT                   /locus_tag="Franean1_0366"
FT   CDS_pept        434305..435825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0366"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: fal:FRAAL6521 cysteinyl-tRNA synthetase
FT                   (cysteine--tRNA ligase) (CysS1); TIGRFAM: cysteinyl-tRNA
FT                   synthetase; PFAM: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   tRNA synthetase class I (M); Cysteinyl-tRNA synthetase
FT                   class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09832"
FT                   /db_xref="GOA:A8LF87"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF87"
FT                   /protein_id="ABW09832.1"
FT                   /translation="MGLHLYDTRTRRVRPFVPLRPGHVGVYVCGPTVQSPPHVGHIRTA
FT                   LAFDLLRRWLTQSGLSVTFVQNVTDIDDKIIVNADRAGTSVWELATRQTRAFEDAYRAV
FT                   GILPPTISPRATGHIPEMLEMIAVLVERGFAYPGAGSVWFRVGAFADYGALSHQRPAAM
FT                   HPSPESEPGKADPRDFALWKAVKPGEPSWSSPWGPGRPGWHLECSAMVGKYLGDVFDIH
FT                   GGGLDLVFPHHENERAQSVCAAELAAAGAAPAAASSRGAVAAGADVPGAGGAGEMARYW
FT                   MHVGLLTTGGTKMSKSLGNSFFVTDALAAVRPQVLRYHLLSAHYRSSLEYSAQTLEESA
FT                   AAHDRIETFVRNALDILGGPAEAAALAAEADRVAGTEAADADGAWSEFAAALDDDLGVG
FT                   RALAALFGVVGRGNQVLSKTHSRELAGWVDVARRMLTVLGLDPVEQWPTAGAELRPALD
FT                   GVMDVLLDLRSAARARRDYSEADSIRSRLAAAGVVIEDTPEGQRWHLT"
FT   gene            complement(435972..437561)
FT                   /locus_tag="Franean1_0367"
FT   CDS_pept        complement(435972..437561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0367"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   fal:FRAAL6520 hypothetical protein;putative SMAD/FHA
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09833"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF88"
FT                   /protein_id="ABW09833.1"
FT                   /translation="MSARCPEGHLSHDPDYCDQCGLRIVGGQERYGYRQDDAGRGAAYS
FT                   AGAPTGRPADPYGRRTPERDPSVPPGPSGPAGAPGGYDPLGIRRAPADAPGVADPPRGA
FT                   GRGGDPYGGYGREGYAEEPRSGRSYPAADPYNRDGYGRPADERGRPDERARPDGRGERP
FT                   REGLDPYGRERDDRGPGGRDDRTPPGYGRDDRGGAGGFGGGRGEPDPAGYPRARDDRGG
FT                   YGAPDGRGGYGPGEPGRPAPEADDRRGYRDDGYGPNGGGYGADPLGVSAAGATPVPAPA
FT                   GTRDRGADRYAPAPCPNCRSLNEPSARFCETCGLDFSTGQLPAPAGAVPVDDAGVTSRQ
FT                   TGSRRGAEARHSTDPRMADPRRADPRLDDPRLGDPRAADPRMGGDPRAGSRGREWDEAG
FT                   PGGTWEAVVEAEREYYDSGDDHRVPFPAFYPRRVFVLTESQMLIGRRSESRGIHPEIDL
FT                   SGAPEDPGISRAHATLERMPDGTYAVRDPGSTNGTRLNDEPDPIEPGRPIPLRDGDRVY
FT                   VGAWTRITVRAQ"
FT   gene            complement(437566..438852)
FT                   /locus_tag="Franean1_0368"
FT   CDS_pept        complement(437566..438852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0368"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   fal:FRAAL6519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09834"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041176"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF89"
FT                   /protein_id="ABW09834.1"
FT                   /translation="MSAFTAKVYQNEFLPVGGTQVHAVITVTSTGAPAAPPIAGRPTGR
FT                   PEQALVILLDCSGSMANPPAKVTQARRAVRAALDSLPDGAWFAVVRGTGSAAMAYPRSP
FT                   ELVPASAATRAAACHVVDALEPHGGTAMGRWLRLANDLLATRPDAIGHALLLTDGQNGE
FT                   MESELLGAVDACQGRFQCDCRGVGTDWRVEELRAIATGMLGTVDAVPEPAGLAAEFERI
FT                   VATALDRATDRVSLRLWTPTGASLDFLREVTPDLRDLTGSGRVVDDHCTDYQTGAWGIE
FT                   SRDYHLCVRLPAREVGTEVLAARVSLVVDHQPTSSALVRALWTDDTALATRVNTEVAHY
FT                   TGQAELARVLADGLEARQQGDDVTATLRLGRGVQIALASGNEATYRLLQKVVHIDDPTT
FT                   GTVRLKKNVEKMDEMVLDSRSTRTVRVNR"
FT   gene            complement(438959..440494)
FT                   /locus_tag="Franean1_0369"
FT   CDS_pept        complement(438959..440494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0369"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   fal:FRAAL6518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09835"
FT                   /db_xref="GOA:A8LF90"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF90"
FT                   /protein_id="ABW09835.1"
FT                   /translation="MDLNPRHGQGYPGHGYPPERPDSPHPNAGYAENSTHPDGYPGDDL
FT                   PTESYRAEDFRADDQPTESYTPDQFTGSAYPESGYADNGYAENSYPDGAYPGAGYPAGT
FT                   GDYREGDYHHEYPESAYSEPGYQGETYSDDTYSGSGFNEDGYAEDTDPATMLLGQRAVP
FT                   GEADDDAHDEVMRCPVCAAPNYQDARYCEACGFALTGVPVAGGDEDHREIDLGPLAGVC
FT                   DRGVRHTTNEDSMGVAIVHGTLIAVVCDGVSTTPGSGEASAAAAATATAILADAVRAHG
FT                   PGEAVPYDERPASRANDVLDVLEEYSEYDEPRTAPRRISGGFGPDEADIALQRAVEAAQ
FT                   ATIAQLSAAEGRMAPSCTFAAAIITPPSVDGPGMVTVGWVGDSRVYLLGPRWCERLTAD
FT                   DTWAAEAARAGLIPASEAETHRRAHTLTRWLGGDAEDVTPHTAAFPIETPATVLVCSDG
FT                   LWNYSSRPDVLAALVNQLEPSASALDVSRHLIDFAIDQGGHDNITVVAARVTS"
FT   gene            complement(440618..441952)
FT                   /locus_tag="Franean1_0370"
FT   CDS_pept        complement(440618..441952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0370"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   fal:FRAAL3895 putative serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09836"
FT                   /db_xref="GOA:A8LF91"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF91"
FT                   /protein_id="ABW09836.1"
FT                   /translation="MTRGHSVRGRDQGTTREPAARCPVCAGPIGRGRLGLPARDRGFCP
FT                   RCRTPYSFAPPLRAGDVAGGYEIVECLAEGGPGPAGWVFSAVDLRGVAVAAETTGTGDP
FT                   ARPGDPTRPSGLACPGGPGSGGGVPGRLVVLKSVRRGGMRPPARLGLRPGRRLPPDPPL
FT                   RHPAIVETLGEVRHDGVVYAVMELVSGPSLADLLRSRRAARGGAPAPLPVPEAVAGVRR
FT                   LLSALEYVHDRGYVFCDLAPGNVVWGGDRVTLIDLQAIREPGRRGGTFHVTAGFDAPEL
FT                   TVSPPSVGSDLYALGRLLATAVLDFPNRASTYRYTLPAQEVDQVLARHEPLRRFLLRAT
FT                   AANPADRFARAADMARELAGIAVDGAAAPAVEAAAEARNRAPTREKVGEVAEVTESARG
FT                   EGVLETELRPIPGARASAGTEGGTEITGVDASGGSCHYSFRRTWI"
FT   gene            complement(441949..443658)
FT                   /locus_tag="Franean1_0371"
FT   CDS_pept        complement(441949..443658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09837"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF92"
FT                   /protein_id="ABW09837.1"
FT                   /translation="MPSPGTDDLDAALRALEETVAAQAGVLLDLENSPERALLDPAPLS
FT                   GVTRAEALAVIAVLADVWRAYAALRDVTEAARSLRGRRSRVDARTLTELTALLYGPSVP
FT                   DILPQTKILPAPEIGPVPARHRPERAGQAHPEWVRPEQVRSGQVRPAELARRVDAAVAA
FT                   VRGRMRLILGVRNALLAEIAAGGRAVAETSVLAARLGLAPGDAGLVAARRLLAELSAAA
FT                   RSDPLGVSPGLRARAEAAVAAATRSTGDLARRHDGLDADLAAAGALLAEITRLDDTARR
FT                   DAGLATRRIRGLGPLYRLADNWRDDQQHGLAPWLIRLRAQAAAGRWKESSRGLARWLEV
FT                   AEATHLAAQRIAGANGAALRRREELRGLLGAWEAKAARLGLTADPRLLPLARAARRELY
FT                   SAPTDVERAAGLVNDFGAALAARGGSPAPDALPAPEVLPAPNVSPARLAPPRRPAQRDR
FT                   SGTRTHPIPPPQTAPHPHPHPRPAPAASTTRPIQATPSAPPAPPAELARLAQPTPPGQS
FT                   PSPVQSAPSARPRHPTQPTWPARRTRARRPAGSAGGGKPAGIGSSTRPEAVT"
FT   gene            444150..445310
FT                   /locus_tag="Franean1_0372"
FT   CDS_pept        444150..445310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0372"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: fal:FRAAL6517
FT                   tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09838"
FT                   /db_xref="GOA:A8LF93"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF93"
FT                   /protein_id="ABW09838.1"
FT                   /translation="MAGGQGRGGRGIARGGQGGRAAKAGSHRKGAAVGSGGQRRKALQG
FT                   KGATPPAEMRPGHPAQRRAAVSAAGTRAAAKRPGGQAADERDRPRAERGTGGSAGAVGA
FT                   GRSGGHSGHGGNGAHGGHGGAGAPGAYGSRRVETDELVVGRNAVVEALRAGVPATTLYI
FT                   AGGLDFDERIADARRLAGRAGLAVVDIGRFELDRLCGTAPHQGLALSVPPFEYAHPDDV
FT                   LAAAQAAAPGLVVALDGVTDPRNLGAVVRSAAAFGASGVVVPERRAAGVTAAAWKTSAG
FT                   AAARLPVARAVNLTRTLRSFAESGLFVVGLAADGEVSLDELQVATDPLVLVIGSEGKGL
FT                   SRLVGECCDLRVRIPMAGQVESLNAGVATGIALSEIARRRRVAAAV"
FT   gene            445407..446480
FT                   /locus_tag="Franean1_0373"
FT   CDS_pept        445407..446480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0373"
FT                   /product="polyhydroxybutyrate depolymerase"
FT                   /note="KEGG: mpa:MAP4288 polyhydroxybutyrate depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09839"
FT                   /db_xref="GOA:A8LF94"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF94"
FT                   /protein_id="ABW09839.1"
FT                   /translation="MRVRSFAVVGFGLVAVLLAGGCQRGGPVIPGSPAAPSAAGAAAAG
FT                   TVVRSLTVDGRERSYRAHAPAAGGVDLPVMIVLHGGGGNGELAERQTGFSELADEAGFL
FT                   AVYPDGTARAGGRLLTWNAGNCCGFARDNDIDDVAFIGALLDDLAKRYPVDLDRVGVTG
FT                   LSNGAMMSYRIGCELSSRVTIIASVAGAMNVDGCQPARPVAVLAVHGTADDNVPYAGGR
FT                   STGRGVGTENDRVDQSVGYAIQFWAEHNACGTTPKAEGVDGPGGPVPGGLGGAVGPGGS
FT                   WVPEPSAVPDGTVIRTTYSGCARGADVVLYSVGGGGHAWPGGTKIRPRADDAPDAPDAS
FT                   HVIWEFLAAHSPTAQPS"
FT   sig_peptide     445407..445466
FT                   /locus_tag="Franean1_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.438 at
FT                   residue 20"
FT   gene            complement(446517..447281)
FT                   /locus_tag="Franean1_0374"
FT   CDS_pept        complement(446517..447281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0374"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: stp:Strop_4382
FT                   regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09840"
FT                   /db_xref="GOA:A8LF95"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF95"
FT                   /protein_id="ABW09840.1"
FT                   /translation="MLTISQLASYAGVTVRAVRHYHAKGLLPEPERDHSGYRRYDAHAV
FT                   VELIRIRTLADAGVPLARVRELLAAGEEEFNTAVADIDQRLRAEIRERQRHRERIAQLA
FT                   AGDSLALPPEAVAYLDRMRELGLPDLMIGGERDSWILVAAQLPEHMPLYMKVKQQQLDD
FT                   PATVELYRDLAAMIGWEADDPRVAAVGDRLVALIEADAEGWENHDEVMPDELAQLLDSV
FT                   FLDSVPIARRLLERLEERGWRGWTKFERIQPK"
FT   gene            complement(447294..448088)
FT                   /locus_tag="Franean1_0375"
FT   CDS_pept        complement(447294..448088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0375"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rha:RHA1_ro02603
FT                   probable ABC drug resistance transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09841"
FT                   /db_xref="GOA:A8LF96"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF96"
FT                   /protein_id="ABW09841.1"
FT                   /translation="MSTTYTVRDSATMLRRNLLHIRRYPSLSIMLVAQPIVFLLLFVYV
FT                   FGGTLGAGLPGQEGGGDRSDYLVFITPGILIMTVASVALGTAISTATDMTTGIIARFRT
FT                   MDIARVSVLTGHVLGAVIRTGFAVVIVTAFAFLLGFRSDAGPLGWLGAIGLLILIAFSL
FT                   TWLTVGMGLAADSVETASNTPLFLVILPFISSAFVPTDAMPAGLRQFAEHQPFTPMIDT
FT                   LRALVTGAATDSDLWLAIGWCALIALLGYLWSRRLFLRVPAR"
FT   gene            complement(448085..449041)
FT                   /locus_tag="Franean1_0376"
FT   CDS_pept        complement(448085..449041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0376"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: nfa:nfa34480 putative ABC transporter
FT                   ATP-binding protein; TIGRFAM: daunorubicin resistance ABC
FT                   transporter ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09842"
FT                   /db_xref="GOA:A8LF97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF97"
FT                   /protein_id="ABW09842.1"
FT                   /translation="MTATNPAIEVSGLTKSYGDHAVLDGVDLTVPEGTVYALLGPNGAG
FT                   KTTIVNILSALLTPGDGEIRVAGFDVRREPAGVRAAIGVTGQFSAIDELLTGRENLRLM
FT                   ADLAHLDRVTATAAVTVMLERFDLVDAADRRAQTYSGGMKRRLDLAMTLIARPRLIFLD
FT                   EPTAGLDPRSRRDLWAIVREQVADGVTVLLTTQYLDEADQLADRIGVLDGGRLVAEGTA
FT                   AELKRRVPGGHVSVQFTDAAGLAAAAAAHPEATTDAEALTLRVPGDGSIAGLRRVLDGL
FT                   DDDDVAGLTVESPDLDDVFLALTGHATEAPAAEEIPA"
FT   gene            complement(449076..452870)
FT                   /locus_tag="Franean1_0377"
FT   CDS_pept        complement(449076..452870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0377"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: sma:SAV5299
FT                   putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09843"
FT                   /db_xref="GOA:A8LF98"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF98"
FT                   /protein_id="ABW09843.1"
FT                   /translation="MSRDAVTGGKAGWLRRLTRQCWRHRAALITTWVCAVTGMTISALT
FT                   PLLPRVIIDDVIIARSRPMLPWAGLMLLAGIAAYLLLMVRRRCGARMTQEVTHDLRTAM
FT                   FTSLTRLDGAGQDSLEIGQVIGRNTSDLTRVQNLLTRTPTALGGLVALAVSLGAMVVLS
FT                   PRLTAVALVTLPVLGALSLTSRVTLFPASWYAQQQEAAVAGVVAATVFGVRVVKGFGQE
FT                   ERELNRLEAVAARLFAHQLRVVRIDSRFAPSIRAVPSLGQIAMLAFGGALAVHGQLSLG
FT                   TFIAFATYLTRINQPIRNLVALVTLAQQARASAERIFEVIDTGPTVVQRPDAADLDVAE
FT                   DPADGPARVRPAQARPVPGAAAVEFDDVSFGYQDGRLVLDRFRLAVAPGETVALVGRSG
FT                   SGKTTAAALLSRFYDPSAGVVRVYGHDVRDLTLTSLRGLIGVVGDDGLLFSTSLWENIA
FT                   YGRRDAPTATVLAAARASRVDEFATDLPEGYRTRVGERGLTLSGGQRQRVAIARAIVAD
FT                   TPVLVLDDATSAIDAEVEAEIHRELRTVTSTRTTLLIAHRRATLRLADRIGVVEQGRII
FT                   DIGTHDELIARCAAYRDLITPDVPADPADQDDQDDQDDPGDFPAPRPREPTEATTLTET
FT                   SVPDIQAAAVPELEGLPAALRRRVLALPPALDTPDLDQEVVRARDPRFGLAAIGRLLWA
FT                   SLTIAWLLLVIDSLTTLALPILIRHGIDEGVTARSLPVVLGTAGVGVAVIAVSWSAHTA
FT                   QIRVVGRLGARVGYLLRVKLFAHLQRLGLDFYEREASGRVMTRLTSDVDQIADFMRSDA
FT                   ASSAVSVLTALGIAIALVVIDPGLALAVFALVPPLVIGTVFFRGRAARAHADARESLAE
FT                   LTAELQENVTAMRVVQAFRREPDALDRYRDRSATYRDQRLRAVRYLAYYFPYIQLLSTA
FT                   ASVAVLLVGSGRVHAGTLTIGALAAYLLYIELFFAPIQDLAEVFDEYQAVMVALGHARE
FT                   LMAVQPVPADAPHARPVERLRGEISLTGAGFTYPGSATAALRDVNVTIPAGQTVALVGR
FT                   TGSGKSTLTKIIARYYDLTEGTLRVDGVDVRGYALADYRRRLGPVPQEAHLFAGTVRDA
FT                   IAYGRPDAPDEQVRAAARTAGAEEMIAGLPGGYGYRVRDQGRNLSAGQRQLLALARAHL
FT                   VGPDILLLDEATAALDLASEAAVARAAAEIGRSRTTVVVAHRLTTAARADRVLVLDGGR
FT                   LVEDGTHGALMAAGGHYARLWAAYAHEHRLELPADAAPT"
FT   gene            452989..454416
FT                   /locus_tag="Franean1_0378"
FT   CDS_pept        452989..454416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0378"
FT                   /product="diguanylate phosphodiesterase with GAF sensor(s)"
FT                   /note="PFAM: EAL domain protein; GAF domain protein; KEGG:
FT                   fal:FRAAL3921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09844"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8LF99"
FT                   /protein_id="ABW09844.1"
FT                   /translation="MSVFASGAGSQDPRDGRDGRDRRRGRDRRVGGRVRERTDEVARVL
FT                   DLARRHLGTDVAWLSRFTGDEQVIDLISGEGELVERLVGRQVEQEATYCARVLDGRLPA
FT                   VIPDARADQRTAALAVTRELGIGSYVGAPVYLDSGEVYGMLCALSTEPDPGLGDREARF
FT                   LGLLADVVADAVSALHRGGADDDHIRSVIAQVIARGGPVMVFQPVFDLPTHGLVGAEAL
FT                   ARFPTFPAPSGEPAGDLGEETGDQAGGAAGEEADDRTAAGPYFGDLPPDRWFAHAASVG
FT                   MGIDLELAAIRAAVAELPRFPRGLSLAVNASPATIASGRLGELLAATATDQLIVEITER
FT                   DGIHDLPSTLARLYELREMGVRIAVDNVGVAYASLRRLVQILPDVVKMNLWLTTDIGAD
FT                   AARRALVEALVHFSRQIGACLVAEGIQRANELRVLTAAGVDQGQGEFLGPPGPLPLPVH
FT                   GRCVPASHGPLVSARAS"
FT   gene            454521..455219
FT                   /locus_tag="Franean1_0379"
FT   CDS_pept        454521..455219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09845"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA0"
FT                   /protein_id="ABW09845.1"
FT                   /translation="MGIVNKVRWLNRRTAVSAMSGIAGTLLIGMGGCAPSAGGHPPSGP
FT                   EGDWEITVYYTAVERFHDGPPLTVRGCPQLDCVFGNDFLGTFPAGFVQVVREEGTGRIT
FT                   SGPRRGSVLNWSYDSGFWIDDVPVDTAGRALVPFRSAAADSSTLPAGTTFVVEDCGHEE
FT                   DGSEIDPNACAALRRGTWEVRDEFTPGLGGQRHLDLYIGEEDVAGFTDRSPLYLTGLGA
FT                   RVAITGRASR"
FT   sig_peptide     454521..454640
FT                   /locus_tag="Franean1_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.840 at
FT                   residue 40"
FT   gene            complement(455358..457001)
FT                   /locus_tag="Franean1_0380"
FT   CDS_pept        complement(455358..457001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09846"
FT                   /db_xref="GOA:A8LFA1"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA1"
FT                   /protein_id="ABW09846.1"
FT                   /translation="MLPAEGRFASPPAPPAPPRTPPPRRAARPVPGTNQRPPAAPDGAT
FT                   GPGAASAPSGQATGTGTLILYDTTGAWGWLGEQYAMQAANLASRFGTWQARPVSSYTAG
FT                   QMSAYAAVVYVGSTYDEQVPTAFLTDVLAGNRPVVWMYNNIWQLTSQAPTFPTTYGWNW
FT                   SGFDTSAIGTVSYKGTDLTRYTANAAGIMNYASVDTTRATVLAEAVRGDGTRFPWALRS
FT                   GNLTYIGEIPFAYADMTDRYLAVADMLFDVLAPQTAARHRGLVRIEDVGPDADPAELHA
FT                   IADYLSSAQVPFSVAVYPRYVDANGTYNNGVPQDYTLASKPAVVSALKYMTQRGGTLIM
FT                   HGWTHQFSNVANPYSGASADDFEFFRAHVDAQDYVVYDGPVPGDSQAWATDRMNGSAAA
FT                   FTAAGLPVPTTFEFPHYAASAPDYAAARAKFPRRYDRGLYFRNQLAGGAVDHTKYGGQF
FT                   FPYPVTDVHGSFVIPENIGNIEPEPFNNHLARLPAELIDAARRNLVVRDGFASMFYHPY
FT                   LGVDYLRQTVEGVRALGYTFVAAGSVVAGG"
FT   gene            complement(457220..458482)
FT                   /locus_tag="Franean1_0381"
FT   CDS_pept        complement(457220..458482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0381"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   mta:Moth_2387 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09847"
FT                   /db_xref="GOA:A8LFA2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA2"
FT                   /protein_id="ABW09847.1"
FT                   /translation="MTDSSDGRTVLLVYGTRPEAIKMAPVVHELGRTGPLRPVVAVTGQ
FT                   HRSMLDQVNDLFGIVPDYDLGILRDRQSLAGVTTRSLGGLESVMAEVRPDVVVVQGDTT
FT                   TAFTGALAAFYQGLPVVHMEAGLRTEDPASPFPEEINRRLTSQLADLHLAPTPSARANL
FT                   LAEGIRPESVLVTGNTVIDALLHVTAAPPPPDRLLAEVRQRSGDGRRQVLLVTAHRRES
FT                   WGEPLARVGAALARLAEQRPELLIVLPVHRNPVVRETVLPPVEGFPNILVADPVDYAAF
FT                   AHLMKAATVVLTDSGGIQEEAPSLGKPVLVLRDNTERPEGVQAGTACLVGTEPNRIVAA
FT                   VDRLLDDPVAYAAMAEAINPYGDGQAARRTVAAIAHRFSDAPAPDSFVPRPRTITIPLQ
FT                   PAAPGQELTGSAAGRREESGT"
FT   gene            complement(458620..459447)
FT                   /locus_tag="Franean1_0382"
FT   CDS_pept        complement(458620..459447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_2628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09848"
FT                   /db_xref="GOA:A8LFA3"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA3"
FT                   /protein_id="ABW09848.1"
FT                   /translation="MSANHDHTDLHHSRHLGQERGRPGTGPPARSAVGSPRPPRRRVRR
FT                   RYRLVVLALVSAGGMAALAGLWAVISLSTEDGPTRWRDGTRHGPWLAVFDGYGRTAGQL
FT                   EAGGLVITLTPRTADAPERTHAGLVVSSEHYSDVRFTTQVRTVRQLRHGTPAPWEVGWV
FT                   LWNYTDPAHFYAFALKPNGWELSKQDPAYPGGQRFLASGPAPRARLGSWHTVEVIHDRD
FT                   SMAVSVDGVPTVRMQDTERPYVSGAVGLYCEDSVVEFRRSGARHLRPADQPPF"
FT   gene            complement(459444..460775)
FT                   /locus_tag="Franean1_0383"
FT   CDS_pept        complement(459444..460775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0383"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   lxx:Lxx14000 N-acetyl-glucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09849"
FT                   /db_xref="GOA:A8LFA4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA4"
FT                   /protein_id="ABW09849.1"
FT                   /translation="MNLLDADGRDARLLAAAMITFGMVYLFAMLVLSRVHRPRTGTPPD
FT                   GLFFVFVMPCLNEEAVIEASLRRLLLSPATNRRALVVDDGSDDRTSLIVRGVADDRVWL
FT                   LRREPPDARRGKGAALNAAVAHLATRPEIAARDPDDVIIAVVDADGRLDPHSVEAVAPY
FT                   FADPRTAGVQTGVRINNRHTSLLARLQDMEFVIYTDVFQRGRGQLDNVGLGGNGQFVRL
FT                   SALRSLGGDPWSHSLTEDLDLGVRLLLTGWRNQFCPQADVHQQGVVRLGRLLRQRSRWF
FT                   QGHLQSWALMPRVLRQARARALPDMLFHLSSPLLILLASLLTAAFVLSTVGVLTSWLAG
FT                   GPAPDPRYFLGAYLMAAGPALVCALIYRSREPLVGFGVVRLAGYAHLYMLYALVWFVAG
FT                   WWAMGRVVSGRTSWHKTARTPESAPPTPLQPVSAAPAAPEGPDR"
FT   gene            complement(460772..461050)
FT                   /locus_tag="Franean1_0384"
FT   CDS_pept        complement(460772..461050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09850"
FT                   /db_xref="GOA:A8LFA5"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA5"
FT                   /protein_id="ABW09850.1"
FT                   /translation="MHVPLTSGAAFPRAGFPPAHPAPGGAGGAAPVARDASPDHATVLL
FT                   DLLSDLLTNLVGLAFVLYMTVGLLGVLLALALRARRGASRPGPGAAT"
FT   gene            complement(461298..461573)
FT                   /locus_tag="Franean1_0385"
FT   CDS_pept        complement(461298..461573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09851"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA6"
FT                   /protein_id="ABW09851.1"
FT                   /translation="MSTFETTAGRPVDSFLRPARTPREPDSSNPFRGISWTPHWNSSVD
FT                   ISCGAGRIHRPTTREGGWRLGCRLAGRVVMPRLDPSSGLIRAGAIG"
FT   gene            462141..463397
FT                   /locus_tag="Franean1_0386"
FT   CDS_pept        462141..463397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0386"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: fal:FRAAL1974 putative two-component system sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09852"
FT                   /db_xref="GOA:A8LFA7"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA7"
FT                   /protein_id="ABW09852.1"
FT                   /translation="MAGPVDATPDQRTERPVAPPAGKEPVPDQPGAGAGVDARPEQVFA
FT                   LDNRTWRRVLFLLLNLPTGLVGFVFVVVWFSVGVGMAVTVVGLPLLTIGLVVTRALGTV
FT                   ERARARAILGLHIPTASRPRSASTGAFGRLWAAVADPVGWRHALYFVIRLPWVIVTFTV
FT                   TLVLLLVGWPVLPVVARALAAVDRAMISALLSPSDRMERRIRELEADRGVVVDTAAADL
FT                   RRIERDLHDGAQARLVALAMGLGLAREKLADDPDTAAKMVEEAHGEVKLALRELRDLAR
FT                   GIHPAILTDRGLPGAIPSLGMRCTVPVRVTVELDERPAPAIEGIVYFTAAELLTNISKH
FT                   SRASDALVDLRRVGDNLLLRITDDGRGGASLGRGSGLAGLTERLGAIDGTLIVDSPPGG
FT                   PTYIIAKVPWRDREQTQSG"
FT   gene            complement(463343..463774)
FT                   /locus_tag="Franean1_0387"
FT   CDS_pept        complement(463343..463774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09853"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA8"
FT                   /protein_id="ABW09853.1"
FT                   /translation="MFDLSCSCMVHTDDEPDTIRNIAIIKPIHTNRSPPALRAESGRRR
FT                   RLEPARPTPRARGAPLRAAARRPAPAPVHAQNRYPPVTWPDGPRSAGNRRHGLAGTHSA
FT                   RPPGDAGGRFEDDVDDGCRRNDQPDCVCSLSRHGTFAMM"
FT   gene            464012..465445
FT                   /locus_tag="Franean1_0388"
FT   CDS_pept        464012..465445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0388"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="SMART: regulatory protein LuxR; KEGG: sma:SAV86
FT                   erythropoiesis-stimulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09854"
FT                   /db_xref="GOA:A8LFA9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFA9"
FT                   /protein_id="ABW09854.1"
FT                   /translation="MRLSELGFEGLDEFSDEVWRTVARHPYCGVDLLAEWLRRPEPIVQ
FT                   AEMDRLVEAGLVRRVGHQWEPQDPVRVLQARHAMREAALVAERARMADERAQLYRSGLF
FT                   GDYVAGRRRAGTNAGVQLLARDEIFPRMAELTRRSTQSVRFLLTGPPPPGLGGDVPDLL
FT                   VPAASRGVRVVSVWTAGAVAAARRRHQGRRLPPIGQIHVLPALPMRAIVWDGSAALVPV
FT                   RDDDLDDGAFAVVAPTLVRAIADMVTRTQYAAARRGSGEVELDEPATVRRQRALLQLLD
FT                   SGLDDSRAARELGVSDRTVKRDVAEMCQRFGVLTRFQLGAAAARAGYLPRGAGAGRWDG
FT                   GPDGGLDAAFDGGLGGGLDGALGGVLGGVRGGALAAGRGGRAAALPAVPAPASPESDPA
FT                   AATASASSASSSAASAQAAGSSSSVPAAASSGPGAARPVARLGQTGAAGARRGDRAGDR
FT                   TGDRASGGRGNGMNRTWRP"
FT   gene            465683..468763
FT                   /locus_tag="Franean1_0389"
FT   CDS_pept        465683..468763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0389"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; Nitrate and
FT                   nitrite sensing domain protein; KEGG: fal:FRAAL4397
FT                   hypothetical protein; putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09855"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB0"
FT                   /protein_id="ABW09855.1"
FT                   /translation="MRNWPIRYKITLVLLLPLLALVGFGSWVVTGQLAAQRASDQTRTA
FT                   ARFLIHVNDLVYALQAERYAVSSLVGSGYREREFAARSTSARSPVDEALATVAETADEL
FT                   PAGPRNQVRDAVGAAQNQMAGLATVRAGVDAQTLQPGPGTVTFNQMISSWLDVGAAMVG
FT                   IGSEDTEVVRGATALSAVSRASEAISQQYGYVSAAAVLGGAVPDSATRVQSAIGAEAAW
FT                   MTQFRSSATPEQLALYDSVVGPTLNPVTDLRDRVLRGERIDFTAWATASGAKSEQLRKV
FT                   QRQVVDDLEHRSASLADAALRSALLSGLLAAGVVALSIAVSVGVATRLVGALRALRSGA
FT                   LEVAQRRLPAVTSKLRQGHPIDPAAEPPAFATATGDEIGDVARAFNVTYSSAVSAAYEV
FT                   AESRSVGAILQTLARRTQGLIQRQLRLIDELERDQQDGEILTRLFGVDHQATRMRRLAE
FT                   SLIVLAGGQPGRTFRGPVRLVQVLRAAASEVEDYTRVHVHLPTSDVEIVGSAVGDLTHM
FT                   LAELIENATAFSPPDTPVTVQASRVGQGWTVEIEDRGVGLDPASYAATNHRMANPPPFE
FT                   ASTQGSQIGLFVVARLAARHKIAVRFKPSVYGGVHVVTIIPAGLIHTEIPHQAASLPAA
FT                   GSNGGRQPAALAAGGSAGGAVYGGGAGGGSGTGPGAPGDRGGRRAGPTPTEELALAGAV
FT                   AAVPHRASARLRPDAADDVRPGGGDARPGEARPGEARSGGGDDRFGGQHGDPRRAGYGE
FT                   DPRPAGYEEDPRAAAYGSDPRDPRDGRDGRDGRDGRDGGYGAEARQAGYGGDARDGGYR
FT                   GDPSDSGYQDDPRTGGFGSDTGAGRYGDDPRATGYGPDSRAGRYGDTRAAGGHGGDLAD
FT                   RQLEDPRGLRLDRGFDGGLDDGLDGGLGRGLVDGGLDAAPRRRSEGRPGGMVARSAADL
FT                   ADGGLFDPLFGPLRGHDGAEALAGPPGPGGHPRLEDLPRRQRGAHLAKTLREDPAAERL
FT                   PQKAASAPDPEAARALAQRFTTAFDRGMRDADDLDGR"
FT   sig_peptide     465683..465787
FT                   /locus_tag="Franean1_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.356 at
FT                   residue 35"
FT   gene            468767..469177
FT                   /locus_tag="Franean1_0390"
FT   CDS_pept        468767..469177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0390"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   fal:FRAAL4396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09856"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB1"
FT                   /protein_id="ABW09856.1"
FT                   /translation="MPRQPDLSFLLDRLRETVPDILCAVVLSSDGLLLATSTGIDRAAA
FT                   DQLAAVASGFDALARGAARQHGWGQVNKTMVDMENGYLFITAVGHSACLAVSSTADADV
FT                   GQIAYEMAHLVSRAGRFLTPELRNQMRAALPS"
FT   gene            469212..469604
FT                   /locus_tag="Franean1_0391"
FT   CDS_pept        469212..469604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0391"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742; KEGG:
FT                   fal:FRAAL4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09857"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB2"
FT                   /protein_id="ABW09857.1"
FT                   /translation="MAGDWSGSTGLGDSWDESEPLVRPYAVTRGRTAPAVPLELVALVA
FT                   TTDSGMAAIRRRGRLAPEEHDIAILCMRIHSIAEISARLKLPLMVVRVLIDDMARDGMV
FT                   SVHRPENPDRPSPELLRRVLHGLTRL"
FT   gene            469585..470178
FT                   /locus_tag="Franean1_0392"
FT   CDS_pept        469585..470178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0392"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   fal:FRAAL4394 conserved hypothetical protein; putative
FT                   ATP/GTP-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09858"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB3"
FT                   /protein_id="ABW09858.1"
FT                   /translation="MVSPVSKRAPTAVKVLVAGGFGVGKTTFVGSVSEIEPLTTEAALT
FT                   SASLGVDDTSAVHGKTTTTVAMDFGRLTLSNNIILYLFGTPGQDRFWFMWDELVRGAIG
FT                   AVVLVDTRRMADSFPAIDFFENRRVPFLVAVNRFDANTYEYPLPMVRNAADLAPHRPLM
FT                   YCDARRPDSAQTTLVHLVRHALELALSGDLPDEP"
FT   gene            470232..470609
FT                   /locus_tag="Franean1_0393"
FT   CDS_pept        470232..470609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09859"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB4"
FT                   /protein_id="ABW09859.1"
FT                   /translation="MDMPSHDLDAPRPRKSRVPGVEMEIYVDWEHPIEVEDPPNSQRPA
FT                   VMVRMPAYVAGGLSHELHSLETIRGAVGGDSSEWAQVARALLAAARMAAGSDRHPELAD
FT                   LPPADLPPPAGCREIAPGGIV"
FT   gene            470606..471238
FT                   /locus_tag="Franean1_0394"
FT   CDS_pept        470606..471238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09860"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB5"
FT                   /protein_id="ABW09860.1"
FT                   /translation="MTLLLLTTEAAVVFGVSTYLLLRTWTRYRAVTMADVFFYDHADGA
FT                   RLPCSRSAGPRVLGEHVVAGFERSPLGAVIAAINLAHRATSTVGAAGVGGVGGVGGFGG
FT                   AAGAVGGKPVPGGGNGPSGTSWYQVQIIGWEVERYSSRKAAIRYLLTRSVDGGDAVTTT
FT                   MRVEVSWVGADWRVVDPPSGDWTHAFFLGDDVSGFSCFPSEFRFPVP"
FT   gene            471460..471942
FT                   /locus_tag="Franean1_0395"
FT   CDS_pept        471460..471942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09861"
FT                   /db_xref="UniProtKB/TrEMBL:A8LFB6"
FT                   /protein_id="ABW09861.1"
FT                   /translation="MLRPRVRLASTRAALLLAALAGTLALAVGVAPVAGAASTTSYGGG
FT                   GGGYSPVGYWTGTATTALGATESVQMLFLPKSRFAVATPSGTFWGSWHSTGSKTFTYAF
FT                   VRTLPGPNGTVVGSIDIQHSATFSSQDAFSSTGTATGYDLNGNVLFSGPVTSTATR"
FT   sig_peptide     471460..471570
FT                   /locus_tag="Franean1_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.866 at
FT                   residue 37"
FT   gene            472073..472792
FT                   /locus_tag="Franean1_0396"
FT   CDS_pept        472073..472792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1508 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09862"
FT                   /db_xref="GOA:A8LGC3"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC3"
FT                   /protein_id="ABW09862.1"
FT                   /translation="MWRVSESMDSLTRHSFVIGVFPGHAGAGLLPYPWRMFRNFEGAHP
FT                   ARCRCSPGRGWDARAAGCPGHQPGASQIAASGPKSRSSAVVCPTVISAGGGTSMTDAMV
FT                   FCAAFIALFTGHHLGDHVAQTDRQATEKDGRGWPAARAMTGHLFAYHLCVAAALASLLI
FT                   IDVPLRLPGVIAALGWSIVTHGFIDRRWPVRWLLRRSGAARFAELKSSGLNGMYLADQS
FT                   LHIGCLFIGALLAAGLS"
FT   gene            complement(472926..473999)
FT                   /locus_tag="Franean1_0397"
FT   CDS_pept        complement(472926..473999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0397"
FT                   /product="putative adenylate/guanylate cyclase"
FT                   /note="KEGG: bja:blr6986 putative adenylate cyclase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09863"
FT                   /db_xref="GOA:A8LGC4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC4"
FT                   /protein_id="ABW09863.1"
FT                   /translation="MQMETTTVMVVDLVGSTRAIASVPQMRMDELMAEAVLPIRRVVEE
FT                   TGGEIIKFTGDGYMTAFRSATRALHAAAQIADLFIAGPRLPIGEWLEGCRVAIHTCDTT
FT                   RFEDDLLGEGVVVPARMEKYVPTNAVYVTSTVRDAAKSAEFDFEPVSELVLGGIPRPVQ
FT                   VHRLVTERYRGIERGTFLTVTDLVGLNALAARVSLTALNERLRDWVSIHREALGATRGR
FT                   LRSVAGDNVLSTHGSADEAVGFLLMLDHLARARRIAGDDGQPPFTFSAVIAHGDLFVPD
FT                   FGLAGPLVSSTCRTLQVLEPGTKIITDGVFQGLTSERDVFGPELAPVPGGLKDGYRLLI
FT                   HPGSSLADGDSEPLAAG"
FT   gene            474317..474392
FT                   /locus_tag="Franean1_R0008"
FT                   /note="tRNA-Thr1"
FT   tRNA            474317..474392
FT                   /locus_tag="Franean1_R0008"
FT                   /product="tRNA-Thr"
FT   gene            complement(474884..475465)
FT                   /locus_tag="Franean1_0398"
FT   CDS_pept        complement(474884..475465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC5"
FT                   /protein_id="ABW09864.1"
FT                   /translation="MATGRPVLAVVSGPPGTGKTTLARALADTLGCPAIIRDEIKQGMV
FT                   LANPGYQAGGDDPLNIPTLHAFFGVLETLTKAGVTMVAEAAFQDRLWTPHLEPLTSGAD
FT                   VRIIRATVDTAIAHQRITSRAGADPHRAAHGDHDLLDALAAGRHSLDSFVDIRLNLPRL
FT                   TVDTRDGYRPALETIAAFVAQPADRPHQGP"
FT   gene            complement(475659..478193)
FT                   /locus_tag="Franean1_0399"
FT   CDS_pept        complement(475659..478193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0399"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09865"
FT                   /db_xref="GOA:A8LGC6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC6"
FT                   /protein_id="ABW09865.1"
FT                   /translation="MPHLASPNGDLTPGMREALSRMREIRRRFGPAYAAMEKRSGVSHS
FT                   NWHRWLHGKGVMPLERVSEAKGMLMGCLEREMKKHSGDEDVLRTLRELKESLEEVTALW
FT                   IRDQGSTTAQMVANEMVTNEQPEPDVQIENILPEHGQMFSSDWMTDMAEELAAAVERQW
FT                   IWEADRRGLIRPPAIPVRWRWAQGMTSKLDVVLNNSHRRTLFPPLPGVASATSASLQSG
FT                   GLQQLFDAYAGVDSGRLVIMGKYGSGKSATAILMLLDALSHRDSLDDVQRAKVPVPIFL
FT                   TTHDWDPRHQNLPEWLITRLAKEYQFLRSTQDGRSAAARLVEDGRVALFLDGFDEIPSE
FT                   LHRDALEEIRRLATFRLVTLTRDGEFAAAVRTGHHVDAAAVVELLPIPADEIASYLETR
FT                   QTDPMPPQWEKLVTFLRENPDHILAQALDSPLVLTQLRDAIQDPADIDDLLVADRFESR
FT                   EAVAEYLMDRSIDVAYRRFSRDTSTVGPDKARAALGYIAAKMNEENTRDLAWWQIHHWA
FT                   SPIPRILATTVLGVLIGAPVGALMFGPLGQYAVRGHTGTLFGAQYLSMMCLVFGLMAGL
FT                   VSEARGGRSRRTGRFRWVDWYRGQTNSAVGLLFTVAVTMAVGNQSNYAFGALAGVLAGI
FT                   VAGYAARGDHQDHRWIQRSWWITLRSRLDPVAGAVAGLPIGLTYGLTKEHTQGLVAGIM
FT                   SAIAFGLMVGFARPTAGIQAVTDPRTSWLRNHEHAATFSLAAGLALGLPLGLKNGLEHG
FT                   VIAGAVAGVCVGLIVGLGCLIGASDRLRTTLLFLQLRGHGIPLDGMRFLEDARRKNLLR
FT                   TVGPLYQFRHPSIQDRLARTYGQQQTRVDPEI"
FT   gene            479870..480388
FT                   /locus_tag="Franean1_0400"
FT   CDS_pept        479870..480388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bam:Bamb_3973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09866"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC7"
FT                   /protein_id="ABW09866.1"
FT                   /translation="MGGDGARQQGLFDVAGEVTAAEPVLMALHAEYYELIWQGLKTHEF
FT                   RRRFLEGRPVRWFVYLNAPVSRLAAVIDLGPAVVDVPERVAAIAERARVGNGASVLEYV
FT                   RDLERAFAIPILGVSEYSGRSVEELRAELGGFHPPQGYVRLRQHPQLLTVCEKITTESP
FT                   LREMSVHHH"
FT   gene            480440..480871
FT                   /locus_tag="Franean1_0401"
FT   CDS_pept        480440..480871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0401"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09867"
FT                   /db_xref="GOA:A8LGC8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC8"
FT                   /protein_id="ABW09867.1"
FT                   /translation="MSPRSSRSPRPVSPLRQVRLARNWTLERVVEEIDLRTAGGHSGVT
FT                   PSMVSGWELGRHTTSIGHRATLCAIYDRPPEALFAFQDQELASQAELTLLAGFADLHQA
FT                   MLSTVEGARECLVVMGSRSRDSVWGSRIRVSACDLVFCG"
FT   gene            complement(480893..481999)
FT                   /locus_tag="Franean1_0402"
FT   CDS_pept        complement(480893..481999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0402"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09868"
FT                   /db_xref="GOA:A8LGC9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGC9"
FT                   /protein_id="ABW09868.1"
FT                   /translation="MSAGRDPCRAGWMVMVWSLLYALTRNTLGLMLLRVRGDAAKDVEL
FT                   LVLRHQVAVLRRRVHRPALEPADRVILAALSRLLPRASWDIFFVTPATVLRWHRELLAR
FT                   KWTYPRKTHGRPPIRREIRELVLRLARENPTWGHRRIQGELVGLGYSVGVATVWRILHR
FT                   AGVDPAPRRADTSWRTFLRAQASGILACDFFTVDTVFLQRIYVFFVVEHATRRVHVLGV
FT                   TKHPTTAWVTQQARNLLIDLEERSHRFRFLLRDRDTKFTSSFDAVFTGAGIDVVRTPPQ
FT                   APQANAIAERWVGTARRECTDRLLIVSERHLTSVLDSYAEHFNTHRPHRSLGQHPPDSP
FT                   PVVAPTSESTVRRTRILGGLINEYRNAA"
FT   gene            complement(482037..482705)
FT                   /locus_tag="Franean1_0403"
FT   CDS_pept        complement(482037..482705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0403"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lac:LBA1470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09869"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032260"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD0"
FT                   /protein_id="ABW09869.1"
FT                   /translation="MSFGRHSRLSDVMESPQARALLERALPRLAAAQALERFPNLTIGV
FT                   IVYNYPSLTEAEAADLWAGLAAVDTPATSPAEIPVATPRDDYEGGEVAAGSAPATYPGA
FT                   VSRWSTFELELAGPSHGNPFTDVELTARFSRDGVEIVSGGFYDGDGRWLIRLLPAETGR
FT                   WRFVTSSNARSLDGVTGQFDVTPAAEGAHGPVRADGFHFAHADGTRHLPLGTTAYAWIL
FT                   "
FT   gene            complement(482764..483234)
FT                   /locus_tag="Franean1_0404"
FT   CDS_pept        complement(482764..483234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0404"
FT                   /product="67-dimethyl-8-ribityllumazine synthase"
FT                   /note="PFAM: 67-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   nfa:nfa16640 putative riboflavin synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09870"
FT                   /db_xref="GOA:A8LGD1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD1"
FT                   /protein_id="ABW09870.1"
FT                   /translation="MPSTPTGARPDTVRVAIVAARWHADIVGQAVASFRSALAERGVGE
FT                   VDEYQVPGAFEIPLHTRRLALTGRYDAIATCAFVVDGGIYRHDFVAGTVVDALMRVQLD
FT                   TDVPVFSAVLTPQAFHEHAEHQEFFARHFQVKGRELADAVVTTIAGLAALPA"
FT   gene            483525..484421
FT                   /locus_tag="Franean1_0405"
FT   CDS_pept        483525..484421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0405"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: eca:ECA1953 putative xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09871"
FT                   /db_xref="GOA:A8LGD2"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD2"
FT                   /protein_id="ABW09871.1"
FT                   /translation="MAGRVGSLSAVDLNWPFSPNDLTTTEIRTALEAARLRAVAVTPEI
FT                   YTRTFARGGFTNPDASVRARAIDLVARAAEVARDLGCDYVKLWPGQDGVDYPFQADHRE
FT                   LWKYSVDAVRELATAFPDMRFAIEYKPREPRNRMLFSSAAVTLLAIEEIGRDNVGILLD
FT                   FGHSLYGGESPAEAARLIISRGRLFAIDVNDNLRGWDDDMVVGSVHPLETFEFFHALVD
FT                   AGWEGIWQLDQFPFREDPVEAARVGVETMRGFHRALERLDWGALRAAQSAQDALAAQRI
FT                   AKRALYGALAETQEGSP"
FT   gene            484418..485326
FT                   /locus_tag="Franean1_0406"
FT   CDS_pept        484418..485326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0406"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG: rle:RL2719
FT                   putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09872"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD3"
FT                   /protein_id="ABW09872.1"
FT                   /translation="MTTTLPAAGRLTTDEPAARRYAATVAVHRELPPAKLAPALAEIAR
FT                   GVRRDIVTTIGQAGMGHLGGDLSVTDILVAAYWRALTVDPFAPDAADRDRFVLSKGHCA
FT                   VALYSVLASCGFFPRSALETFGGPLSPLNGHPNRVKVPGVETNTGPLGHGLPVAVGCAL
FT                   GARLRGIANRTIVVLGDGEIQEGSNWEAAMTAAYHRLATLVAVVDRNRLQQGARTEETK
FT                   ALEPLDAKWAAFGWEVRRIDGHDHQALVEALAPSSTGRPVAVLADTVKGKGVSFVEDRV
FT                   EWHHKVPSAEQLRAALEELSG"
FT   gene            485352..486323
FT                   /locus_tag="Franean1_0407"
FT   CDS_pept        485352..486323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0407"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: rle:RL2718 putative transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09873"
FT                   /db_xref="GOA:A8LGD4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD4"
FT                   /protein_id="ABW09873.1"
FT                   /translation="MSTVAPPGVDAPTFDCRVDFAAELAALARVDERIVAVCNDSVGSS
FT                   NLGAFRDEFPDRLINVGIAEQDLVGVGAGLANAGMVPFVCAAAPFLTGRATEQIKADVA
FT                   YSERHVVLCGHSPGMAYGELGPTHHSIEDLAWMRAVAGLTIAVPADPAQTRAAVLWAAG
FT                   YGRPVYLRIPRFKVPEVSRQGDPFLPGRAVLLREGSDVTLAAVGSMVSRAIWAAQILAD
FT                   DGISARVLNMTFVEPIDRDALISAAEQTAGIVTVEEATTSGGLGAAVAAVVGQTRPCPL
FT                   RILGVPRQFAPTGSTQFLLDHFGLNADGIVGAAREVVGGTRA"
FT   gene            486307..487827
FT                   /locus_tag="Franean1_0408"
FT   CDS_pept        486307..487827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0408"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: fal:FRAAL4566
FT                   glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09874"
FT                   /db_xref="GOA:A8LGD5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042016"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD5"
FT                   /protein_id="ABW09874.1"
FT                   /translation="MAPAREGLLLAIDQGTSSTKAVLVDRDATVVASSSCPVGQRHPGP
FT                   GQVEQSAEEIWASVQRAVRTCVDRELAARVVGVAISVQRESVVLWDTVSGAAVGPILSW
FT                   QDRRLATATAADALERGGHAPYIRSSTGLPLDPMFSALKAGWLLDTYDPSRARAGTGAW
FT                   KVGTLDAWLLSRFGGPAVTEIGNASRTQLLDIGGRQWDPTLLDLFDVPRAALPDVVASL
FT                   GPFPPARGLPPLPDGLPVLAVLGDSHAALFAQARGAPGVVKATYGTGSSVMTLGRADAG
FT                   DTSLCSTIAWQLPGTAGTAADGVAHATEANIRSTGRTISWLADLFQVDPTALLAEAATA
FT                   SSDEIILVPAFGGLAAPWWDRDATPVIIGVSLGTGRPQLARAALESVAFQIDDVITVLQ
FT                   RAAGPLALLACDGGLTRSEVLMQLQADVSGLPVRISATPNLSALGAALLAGVGAGWWTL
FT                   DGLPEPPGRATGAEVLPRIDADTRARLRNRWADAVARARSHQRTKAAS"
FT   gene            487891..488895
FT                   /locus_tag="Franean1_0409"
FT   CDS_pept        487891..488895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0409"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   atc:AGR_C_3494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09875"
FT                   /db_xref="GOA:A8LGD6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD6"
FT                   /protein_id="ABW09875.1"
FT                   /translation="MRASPDRDRLRLLTKVARLYHEQGVRQPEIAERLNLSQARVSRLL
FT                   KEASELGIVRTIIVPPPGVHADIEDELIRRYGLRDVMVVDVEGSAGDITAALGASGATY
FT                   LDMTLQNDDVIGVSSWSATLLAAVDAMRPRHTLNARQVIQLMGGVGSPDAQMQATRLTG
FT                   RLATLTGAAPLFVPSPGLVGSATLQQALLTDPAVQTVREVWSELTVALVGIGTTTPSPL
FT                   LRQSGNGLSDADQRTLRDAGAVGDVCLRYFDEAGQPVVADLDQRIIGIDRETLLGTARR
FT                   IAIAGGQEKATAIRAAVLGRWVNILITDLGVAGHLLGAPPSGPSADRESVDHR"
FT   gene            complement(488900..489325)
FT                   /locus_tag="Franean1_0410"
FT   CDS_pept        complement(488900..489325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0410"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mjl:Mjls_2863 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09876"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD7"
FT                   /protein_id="ABW09876.1"
FT                   /translation="MTDKYELIAAEKDDYPTSKMCQWLVVSTSGFYDWHRRPASTRTRR
FT                   HATLDTQVRAVFAASRQTYGARRIAAAPTASGVRISVRLARRITRRAGLKACQPRAYRR
FT                   TTIPGQAPAPADHVRRDFTATRPGEKLVGDIGTGRRP"
FT   gene            complement(489322..489750)
FT                   /locus_tag="Franean1_0411"
FT   CDS_pept        complement(489322..489750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09877"
FT                   /db_xref="GOA:A8LGD8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD8"
FT                   /protein_id="ABW09877.1"
FT                   /translation="MDARPQRQGAPGLAQPGPDRAEPRRHLHLRSRPRGPRRRQLARHH
FT                   RPRRGAGTHPVAGGTTRRVDRPGVLVRDFRVVSRTDVDSLELPPGRLRAARGPARCPSH
FT                   SRTSERARLRELEKENRELRMEREFLSKATAFFAQRHQ"
FT   gene            complement(489800..489934)
FT                   /locus_tag="Franean1_0412"
FT   CDS_pept        complement(489800..489934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09878"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGD9"
FT                   /protein_id="ABW09878.1"
FT                   /translation="MRFPNVWFGDLRGNQVSPGHTLTGSMAGFTVALSWDLQPDRRSS"
FT   gene            complement(489966..490472)
FT                   /locus_tag="Franean1_0413"
FT   CDS_pept        complement(489966..490472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09879"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE0"
FT                   /protein_id="ABW09879.1"
FT                   /translation="MAEIANFLPLPSQLWVTDDTPGLARLHPARRRCLRRQPGRGLPRR
FT                   LRQRDRRYEVLGRFDPTRRPAQLNIELHRGTKVTPPNMVNNTDLTPLASITDLDLQIAA
FT                   DGSFRITIGLERSPVHLLSTPGLLSLGSRDMLTSWDQRPSWMELRPLDDTEPAPFDLTK
FT                   IVEAV"
FT   gene            491155..491787
FT                   /pseudo
FT                   /locus_tag="Franean1_0414"
FT   gene            491787..492062
FT                   /locus_tag="Franean1_0415"
FT   CDS_pept        491787..492062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0415"
FT                   /product="luciferase family protein"
FT                   /note="KEGG: mkm:Mkms_5022 luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09880"
FT                   /db_xref="GOA:A8LGE1"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE1"
FT                   /protein_id="ABW09880.1"
FT                   /translation="MHDDLAEARAATAATATVYESLPNYQRILEIGGAESATDAAVLGD
FT                   EEGVTRQLRGLLDAGATDIQAFVVPVGPDRRGSRRRTTGLLASLTA"
FT   gene            492137..492259
FT                   /locus_tag="Franean1_0416"
FT   CDS_pept        492137..492259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09881"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE2"
FT                   /protein_id="ABW09881.1"
FT                   /translation="MKRIGRPEATAGVCVFPASEAASYINGAQVLADGGLFRTL"
FT   gene            492279..493022
FT                   /locus_tag="Franean1_0417"
FT   CDS_pept        492279..493022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0417"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: acr:Acry_2115 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09882"
FT                   /db_xref="GOA:A8LGE3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE3"
FT                   /protein_id="ABW09882.1"
FT                   /translation="MKVFENRVAVVTGAASGIGLAVARRLAAMGVRLVMTDLDGGAVVA
FT                   AGAAVRSDGCDVEAVQLDVRDPGAVERVADLAIDRFGALHVAVNNAGIVNRGLAWELSL
FT                   EDWRRVLDVNLLGAIHGVRSFVPRILATGEEGHVVNVASMAAVLPQERLGPYTVAKHGV
FT                   LGLSDVLRADLAAVGAPVGVSVVFPGRIRTGMNPIGTVEPSTVADHVVDAIERQRPYVF
FT                   TDDHSVGGVEARLQAILAARADVIT"
FT   sig_peptide     492279..492350
FT                   /locus_tag="Franean1_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.397 at
FT                   residue 24"
FT   gene            493528..494115
FT                   /locus_tag="Franean1_0418"
FT   CDS_pept        493528..494115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP2181c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09883"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE4"
FT                   /protein_id="ABW09883.1"
FT                   /translation="MVGPLRTTPPPRDPSRRLRRRLCRDQRRSAATEVDADAFRVGAGP
FT                   RFITTQHWRLTQRFPQDMARAIQPITDLIAGELRAGQAAGLLHSTDPDRDAALINKMLM
FT                   AVYHHQTFAAGDETIESVAAHLWAFCLKGIGGPIPVDAAETTARAWPSSSTAVRGRTPG
FT                   ARAGQLKRGPLTSSTRMSPESTSRAQPGHADR"
FT   gene            494136..494357
FT                   /locus_tag="Franean1_0419"
FT   CDS_pept        494136..494357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0419"
FT                   /product="RNA-directed DNA polymerase"
FT                   /note="KEGG: sen:SACE_2315 RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09884"
FT                   /db_xref="GOA:A8LGE5"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE5"
FT                   /protein_id="ABW09884.1"
FT                   /translation="MRGWMNYYGRFYRSALYPLLQRINTYLMRWARRKYRRLRSVSRFK
FT                   AWWKGLVARAPALFAQWRWTDGILPTGW"
FT   gene            494865..495920
FT                   /locus_tag="Franean1_0420"
FT   CDS_pept        494865..495920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0420"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); KEGG: bth:BT_2602 putative maturase/reverse
FT                   transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09885"
FT                   /db_xref="GOA:A8LGE6"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE6"
FT                   /protein_id="ABW09885.1"
FT                   /translation="MSTGRRGTGGRILNGRKACVMQSAEMVLGVLRERGRRGLPLERVY
FT                   RQLFNAALYLVAYGRLYSNKGAMTPGETVDGMSLATIDRIIDAMRHERYRWKPVKRVHI
FT                   PKKNGKKRPLGLPTWSDKLVAEVVRLLLEAYYEPTFSDHSHGFRPGRACHTALGEVVDV
FT                   WKGTHWFIEGDIARCFEELDHQVMLDTVGERIHDNRFLGLLKAMLRAGYLEDWKWGATL
FT                   SGTVQGGPASPILSNIYLDRLDSFVVTHLLPDYNRGERRASNPAYQKIEYAIARARRHG
FT                   DRPALRRLRQQRRQLPSQDPHDPSYRRLRYVRYADLCRRRHKSAYAEGRVMPTGLLEGL
FT                   RVRQVLVVGAA"
FT   gene            complement(495942..496931)
FT                   /locus_tag="Franean1_0421"
FT   CDS_pept        complement(495942..496931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0421"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: mva:Mvan_5937 phage
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09886"
FT                   /db_xref="GOA:A8LGE7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE7"
FT                   /protein_id="ABW09886.1"
FT                   /translation="MTDLAPVLQGFFTDRLARQKKASPNTVAAYRDTCRLLLAFAQSKT
FT                   GKPPSSLSLADLNATLIGEFLHHLEEQRGNGTATRNARLAAIHSLFTYAAPRAPEHAAV
FT                   ISQVLAIPPRRRERAIVSYLTAEEIDALVAAPDRSTWHGRRDRSLLLLDVQTGLRVSEL
FT                   TGLNRQDIHLGAGPHVRCHGKGRKDRATPLTTQTVKVIRTWLAELSPDPTGPLFPTQPG
FT                   GRLSRDAVERLVAKHTATAADTCPSIKEKHVTPHTLRHSAAMTLLKAGVDTSVIALWLG
FT                   HEGTETTQIYLHADMTIKEQALARVQQPGTSPGRYRPPDSLLTFLDNL"
FT   gene            complement(496928..497878)
FT                   /locus_tag="Franean1_0422"
FT   CDS_pept        complement(496928..497878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0422"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mva:Mvan_5938
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09887"
FT                   /db_xref="GOA:A8LGE8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE8"
FT                   /protein_id="ABW09887.1"
FT                   /translation="MAGSRPVSGLRARAEEYLAMRRALGFKLESHGPRLMSFVRFCDER
FT                   DATTVTTDLAVEWATSTGSDHEAYQARRLDVVRIFARHLQPLDPATEVPPADVLDRRQW
FT                   RIPPYLYSPQEVTALMSAAGRLRPAIRAATWRTLIGLLAVTGMRQGEACRLGRDDVDLN
FT                   AETIVIEDSKFGKSRVVFLHPTAAAALRVYTRARDAAFLQAEAGTFFVNSLGRPLDSRN
FT                   TPTTFAGLVTAAGIKAPPGQRAPRLHDLRHVFTVATLLDWYRDGGDVQARLPALSTWLG
FT                   HIDPKSTYWYLSAVPELLALAAVRLEPAGQEQTAS"
FT   gene            complement(497857..498771)
FT                   /locus_tag="Franean1_0423"
FT   CDS_pept        complement(497857..498771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0423"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mva:Mvan_5939
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09888"
FT                   /db_xref="GOA:A8LGE9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGE9"
FT                   /protein_id="ABW09888.1"
FT                   /translation="MEMGVDPGCVQPDVALLVEFRGWLDRERGLSPVSVRCYAKQSKVF
FT                   LAGIGGAGAVSGLDAGKVTAFMVAWTAGRNTWSAKAMVTSLRAFLRFAHATGRTAVSLA
FT                   GAVPAVASWRMSALPRGLKASEIERLLTGCDRDTAVGLRDYAVLSLLARLGLRSAEAAG
FT                   LRLDDIDWRAGEIAVTGKGSRTERLPLPAPAGEAIAAWLTGGRPRCESRSVFVTVRRPY
FT                   RPLTPESVRAVMGRACERAGLERRGTHRFRHALATEMLRAGASLPEVGQVLRHRSQLST
FT                   SLYAKVDQNTLRPLARPWPGAGQ"
FT   gene            498987..499841
FT                   /locus_tag="Franean1_0424"
FT   CDS_pept        498987..499841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_2660 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09889"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF0"
FT                   /protein_id="ABW09889.1"
FT                   /translation="MRQFLRDDLRLELSAEKTLITHAQTGRARFLGYDIVAQHSDTKIT
FT                   RGRRAVNGAIGLRVPPEVIRNNRGFYSWAAWDTASATGAGLLWRAPTGLDLPVVRVLPD
FT                   GTFLTALITPTIRGARRERLLGAARTGLDLDDINTVPDAFNERGLPVIHLARVIEYDVP
FT                   DRVGNGTGELIVLLSTITDPAGARADELAAAYNERWEKETANDQLKTHLRGPGRVLRSR
FT                   LPDLAYQEIWSYLIVHHAISALTAKASAAADLDPDSISFAKALRLIRRTATGTADIPPS
FT                   GLD"
FT   gene            complement(500080..501174)
FT                   /locus_tag="Franean1_0425"
FT   CDS_pept        complement(500080..501174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0425"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sen:SACE_3275
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09890"
FT                   /db_xref="GOA:A8LGF1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF1"
FT                   /protein_id="ABW09890.1"
FT                   /translation="MHNARIVSTLRDVTDPEGTERTTIQDVAAAAGVSVSAVSKVLRGA
FT                   YGVSPQMRTRVTAAIDRLGYRPHTGARAMRGRTYTVGVVLVELTSPFQTEVAKGISDAL
FT                   EDTSYQDILVTAGATPERQKSRIEALLDRHVDGLVLIAPWIEVAWIEKIAQALPVVAVA
FT                   LHGTPRNFDTVVDDERLGAQLMVDHLVAAGHRQIAHTSAPRAAFEDTFVLSHTARRQGY
FT                   EQAMRGHGLRPDVIETWLSEEGGHQAAQQAFDRARPPTAIFAGADIAAFGVLRAAEERG
FT                   LRVPEDVSVAGYDNIYTSTINRVSLTTVDQSGHGTGAESIRLLLERIEGRAQPRQFVVS
FT                   PHLVTRRTTTAPSGTGISNRGRTV"
FT   gene            501353..502888
FT                   /locus_tag="Franean1_0426"
FT   CDS_pept        501353..502888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0426"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bja:blr3234 ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09891"
FT                   /db_xref="GOA:A8LGF2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF2"
FT                   /protein_id="ABW09891.1"
FT                   /translation="MRRSKLALVASAVALAAPLAALLAGCTGEAAPGAESSAGATKNTL
FT                   TLAMSADITGWDPSNQPGYQGWGPEAIWDTLIKCDAFGKPEADIADKWTVSADGKSFTA
FT                   HIREGQKFSDGTPVDSAAIAASFQYLTSHGGSQGDYKGLKTDAPDAQNITLTWPEPQPM
FT                   IIQRVCNPKITTKALLDSGKVNDKPVGSGPYVLDETATTRGSVYTFTKNESHWNTAAYP
FT                   YKKLVLKVIESETARVSALKTGQVDGSLITAASYNEVEASGLNVVTMQGQTTRLLLTDH
FT                   LGKEVPALGSLKVRQAINMVFDRDAMVKNLYQGHGKPAYQIFRPGSDAYIDGMADPYPF
FT                   DVTKAKALMAEAGYASGFDLSLPTMAGQNHETLMPYVTQQLGLLGIKVKQVPLSGANAI
FT                   GDLLSGTYPVVLWQLGNFGQSLLDIDVVVRSTGYWNLEHQPDATVDGLWEKILTGDEAT
FT                   RKTAQQDINRYVIEQAWFAPMVNPDGFYAHSPDVKIDHVSDHEALTPKLRDFK"
FT   sig_peptide     501353..501445
FT                   /locus_tag="Franean1_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.447 at
FT                   residue 31"
FT   gene            502903..503844
FT                   /locus_tag="Franean1_0427"
FT   CDS_pept        502903..503844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A0980
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09892"
FT                   /db_xref="GOA:A8LGF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF3"
FT                   /protein_id="ABW09892.1"
FT                   /translation="MMLTLLKNLARSLAVLLVVTFATFTLMFGNGDGIARAVLGLNARP
FT                   EDVQREVVTLGLDQPLLVQYWHWLRDAVTGDLGESFYTGQSVTEALSSRVPVTLALVII
FT                   TLLLAVVLSVLLGVTAAVKGGWVDRLLQFVTVLGTAIPSFIIAIVLVFTFAIAWRVLPA
FT                   TGYVTPEISVSGWAKSVTLPVLALLVGAVASAAAQFRTAVLDTLGRDYIRTLRARGISE
FT                   RHVIFRHVLRNSAGPGLTVLSLTTLGLLGGAVFVEQVFALPGMGQLANQSAQVNDVPMV
FT                   MGTVLVTIVIVLVVNFLGDLATTVLNPKARIR"
FT   sig_peptide     502903..502998
FT                   /locus_tag="Franean1_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.644 at
FT                   residue 32"
FT   gene            503841..505589
FT                   /locus_tag="Franean1_0428"
FT   CDS_pept        503841..505589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0428"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related; SMART:
FT                   AAA ATPase; KEGG: sit:TM1040_2684 oligopeptide/dipeptide
FT                   ABC transporter, ATP-binding protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09893"
FT                   /db_xref="GOA:A8LGF4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF4"
FT                   /protein_id="ABW09893.1"
FT                   /translation="MTAERVVGDTRRRVFRQLLRNPQGAVCLAFLAPVVLVAVTSQWLA
FT                   PYSPTETDLDATNAAPFSDGHLLGGDSAGRDILSRLMWGSRQTVLACAIILVISLAVGV
FT                   TSGLVAGFYRGRFEVAAGFVSDVVMSLPGIVLLIALYALTGPNIPAAMAVFGLLIAPTY
FT                   YRLVRNVVLGVRNELYVDAARVAGLSDLRIVGRHVLWAVRAPVIIQSSFVLAAGIGIEA
FT                   GVSFLGLGDPAGASWGIVLQNSFNGIYNNRWAVVWPALLISLTILALVLLGNALSDVLQ
FT                   SSARSKTLSLRARRAAVTAAQQVEPTEDSILVGSSNDVVLSVRGLRVAYPMAGGEIREV
FT                   VHGADLDVRRGEIHGLVGESGSGKSQIAFATLGLLPREALVLGGSVLLDGEDLLADVAK
FT                   MRAARGRRIAYVPQEPMSNLDPSFTIGKQLTYGLRAVTTLDAKQARERIIKLLVRVGIT
FT                   DPEWVMGLYPHEISGGMAQRVLICGAVAADPDVIVADEPTTALDVTVQAEVLELLRELS
FT                   QERGLAMILVTHNLGVVADLCDTVSVMKEGNIVERADVDAIFESPQQAYTRELLSSSRS
FT                   VELMEI"
FT   gene            505591..506400
FT                   /locus_tag="Franean1_0429"
FT   CDS_pept        505591..506400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0429"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bam:Bamb_3570 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09894"
FT                   /db_xref="GOA:A8LGF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF5"
FT                   /protein_id="ABW09894.1"
FT                   /translation="MTDQPLLRVRDLVVRFAGRRRTSTTVIHGVSFDLAAGETLSLVGE
FT                   SGSGKTTIGRAILGLAPVSEGTVEFRSEIISNVPRARRRELARDVQVVFQDPYSSLNPS
FT                   MTVGDILVEPLTTAGVEGGRTRVKELLDAVGLPADAANRYPREFSGGQRQRVAIARALA
FT                   LDPAVIVCDEPSSALDVTTQARVLRLFRDIQEATGVAYLFISHDLGVVNEISDRIAVLY
FT                   RGEIVELGAANQVATAPRHEYTRRLQMAAPVADPRKQRERRRLRLAL"
FT   gene            506431..508965
FT                   /locus_tag="Franean1_0430"
FT   CDS_pept        506431..508965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0430"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: ani:AN0711.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09895"
FT                   /db_xref="GOA:A8LGF6"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF6"
FT                   /protein_id="ABW09895.1"
FT                   /translation="MVQPCAPRFEHRTEPGPVLGLGAPAPRLSWTVTRAEEGWRQTAYE
FT                   VQVAGKVFTVRSAEQVLVPWPARPLRSRERAEVKVRVAYGDHWSPWSEAATVEAGLLDA
FT                   ADWTARFISPVDPGERAPVVVGHVEVPGPVRSARLYATAHGIYVPSINGRRVDDTVLAP
FT                   GWTSYEHRLRYHVYDVTTLIRPGENVLEFVLGNGWYRGRLGWTNQRAIYGDRLALLAQL
FT                   EITTFDGAVRVLATDGTWHARPSEVLADDLYDGQTTDLRPHDAPATGVDIVEGDLTRLV
FT                   APDGPPIRPTSVLPARKVWTSPAGKTLVDFGQNAVGWIRLRVRDLPAGTTVVVRHAEVL
FT                   EDKELGTRPLRSARATDTWVLSGHDEVLEPSLTLHGFRYAEVTGVPDLREQDIALVVVG
FT                   SDLRRTGWFSSSHEQLNQLHENVVWSTRGNFVDLPTDCPQRDERLGWTGDIQIFGPTAT
FT                   FLYDTAGLLRSWLADLAAEQRPDGSVPHVVPEIDRAPEFRTPAAAWGDAATVVPWTLYQ
FT                   RTGDLQMLERQLPSMSAWVDKVAALAGPDRLWRGGFQFGDWLDPTAPPENPGRAKADPD
FT                   VVATAHFARSSWIVAESARLLGRAADAEKYRTLTDEVRAAFVRAFVTPQGRIHSDAQTL
FT                   YALAIEWDLLPEAEQRVAAGHRLAELVRDGGFHIATGFVGTPLVCDALTSTGHLDVAYR
FT                   LLLQTQCPSWLYPVTMGATTVWERWDSMRPDGTINPGEMTSFNHYALGAVADWLHRTVA
FT                   GLAPAAPGYRRLLVHPRLTPELTGAAATHLTPYGKASVSWLRSAGHLRLDVHVPVGASA
FT                   EVHVPGAEQPVTVGHGDHRWLVADPVSRSEGR"
FT   gene            508969..510324
FT                   /locus_tag="Franean1_0431"
FT   CDS_pept        508969..510324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0431"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   sco:SCO0118 xylosidase/arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09896"
FT                   /db_xref="GOA:A8LGF7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF7"
FT                   /protein_id="ABW09896.1"
FT                   /translation="MPEPIIAGFYPDPTVCRVGDDYYLAHSSFEYFPGAPIWHSRDLIR
FT                   WTQIGHILTRRSQFARGDCRPSSGLYAGTLRHHDGRFVYVTTNVSDFDGGQLIVTADDP
FT                   AGPWSEPVRVPEAIGIDPDLAWDDDGTCYLSWKAMSLADGEIGIRQAPLDISSGKFLAP
FT                   AYPIWQGSGLAAAEGPHLYAIDGLWYLLLAEGGTERGHAVTVARGPHPSGPFEGCAANP
FT                   ILSHRSTIHPVQNTGHADLVRAPGGGWAAVYLGTRPRGWTPGFHVLGRETFLAGIDWVD
FT                   GWPVFDEDRYQVPPLDTGFTEVFGDSPPHLRWVADGSGLRCTRVRDLRWSAEATLDGPG
FT                   RFEVRIDDRHAYGLTRHHDRVEATARVGDLGAVLATLPVADGHTVLRIEAVPPPSRDAG
FT                   PDEIVLSAGSHELARLDGRYLSTEVASGFTGRMLATAGPHVRSVTYRPQEQP"
FT   gene            510321..512048
FT                   /locus_tag="Franean1_0432"
FT   CDS_pept        510321..512048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ani:AN0478.2 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09897"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF8"
FT                   /protein_id="ABW09897.1"
FT                   /translation="MKAVLSSLLLTAGLILVPAGAASAAPPDCAAATPGGPVQVTPGCV
FT                   DPLYADPVVDSEQDLSTPVTHRRVSGHFDGTGVKFTIYLPPARQWQGRFFQYTYPISTE
FT                   NALDRSVAFGAASGAYTLQTSGTGGYRHAAAAAKFAETAAAAYYRSGSRRIYGYLYGPS
FT                   GGSFQTVGAIENTTGVWEGAVPVVLGVPTSIPINFFVRAQARMVLRDVADQIADAVRPG
FT                   GSGNPYTGLTPVQAAMLHETTSLGVPLKAWADPDYVLGLSAPDGLLGFGAVIKQLDPTY
FT                   ADDFWSKPGYLGTEQSALGDIVRAELARTGDRWAVALPSYYRHQVPPAGEGYDVFDSLR
FT                   GRYPQRPLLVGPAIATSVAGGGTYTGRINGKVIVVDNLVDSDAYPWHADWYARRVQSPG
FT                   DFRLYYNDNADHLEGPVTGAKASRIVSYDPIVEQALRDLAAWAERGVRPPQSTRYTVTG
FT                   GQVRVPSTAAQRRGIQPVVDLTVRGRDRVDVNAGEKVDFRAQVATPPGAGRIVSAGWDV
FT                   TGSGTFTPATTGFTASHRFTEPGTYYVSLKVAASRSGHAESFAMVENLDRVRVVVHPR"
FT   sig_peptide     510321..510395
FT                   /locus_tag="Franean1_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 25"
FT   gene            512058..513767
FT                   /locus_tag="Franean1_0433"
FT   CDS_pept        512058..513767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_6525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09898"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032260"
FT                   /db_xref="InterPro:IPR041239"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGF9"
FT                   /protein_id="ABW09898.1"
FT                   /translation="MLTHFITVGQVLDAPGGRDVLERFLPQAVDRADVRELLVLFFLRV
FT                   TPGLRDDEQARAAFWAEIDALMEPVILRPHAAAIAPSAVGVSAPHASAPWTVAGSPTRW
FT                   GLLEIQLSGPSDGNPFIDVELTAEFRCGERSWTVGGFYDGDGTYRLRALAEQEGTWQFV
FT                   TSSTTPALDGIEGEVTVGPAAPGAHGPVRVDGFHFAYADGTRYRPWGTTAYAWNHQDDK
FT                   TQEQTLETLAASPFTKLRMCLFPKHFVFNNAEPVQFPFPRVNGSFDHTRFDVEFFARLD
FT                   EQVRRLGELGIEADVILFHPYDKWGFSDLGRAVDERVVRYLVRRLAGYAHVWFSLANEY
FT                   DAVPGKTIADWDRIGETLTAEDPHGHPVSIHNFIEHFDHTRPWITHASVQHGRVEEVTG
FT                   WRERWGKPVVIDETGYEGDLEFDWGNLTGEEMLRRFWEGAVRGGYVGHGETYWNAEERI
FT                   WWAKGGQLTGTSPRRIGFLAEIVAASPTGVLEPLPSDYDLPWAGVQDEYLVNYYGLGRP
FT                   RERHILLPPGRWHVDVLDTWECTVERLPGTYETLAVVPLPAKPYQAVRLVKA"
FT   gene            513767..514804
FT                   /locus_tag="Franean1_0434"
FT   CDS_pept        513767..514804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bth:BT_2112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09899"
FT                   /db_xref="GOA:A8LGG0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG0"
FT                   /protein_id="ABW09899.1"
FT                   /translation="MRTSFTPGQVWLDTDGKRIQAHGGSLLHVDGTFYWYGENKERSTP
FT                   GSGIWHWGVRCYSSPDLYNWTDRGLIIPPEVDDPSAPLHPAMSMDRPHILRHSGSWRYV
FT                   CWVKVMSPAGQRSTVLVADDILGPYQMVGKDLKPLGMNAGDFDLVVDPTDGKGYYYFER
FT                   VHSELICADLTDDYIGVTGYYSTHFPLVQPPYVREAPAYFARNGRHYLVTSGTTGYYPN
FT                   PSEVAVAPSYHGPWTVLNDPHPGDPSRSSYQSQISSVFRHPHKQDLYIALADRWLPRYT
FT                   ASSEAAIAMHAERFAPFGGHHDGPWSELTEIDTSIADYVWLPFRFDGERALLDWHDEWR
FT                   VEDYP"
FT   gene            514801..517170
FT                   /locus_tag="Franean1_0435"
FT   CDS_pept        514801..517170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0435"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tpt:Tpet_0848 glycoside hydrolase, family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09900"
FT                   /db_xref="GOA:A8LGG1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG1"
FT                   /protein_id="ABW09900.1"
FT                   /translation="MSPTWRDEHLEAGHRAELLLAEMTTAEKCHQLTARMAWSLVKADG
FT                   TDADGAEDVLRHPPGHVAQLILDDPAQLAAMVGTIQKQVLSRSRLGIPVLFHAEALSGF
FT                   LNGGHMVFPSGTGLAAGWSPDLVEEMTDLIRRQMRRTGLMHALSPVLDVALDPRWGRVH
FT                   ETFGEDPYLCAALGVAYVRGLQGTDVSQGVMATGKHFLGYAAPPGGLNLSAFESGARRT
FT                   RDLFAYPFEAAIRLAGLRSVMNSYADVDGVPAGASPEVLQDLLRDTLGFDGFVSSDYTT
FT                   LEQLVDRQRIAKDAAEAGRLAIRAGLDVEMPNPYGYGDVLAAEVERGVVDVRHVDNCVR
FT                   RVLRAKFEVGLFEHPYPVESIDVAAAAREGADLSLELARRSIVLGQNNGILPLTPGGLD
FT                   IAVIGPHADAPTFQFPTYTYVSWREANEAVMRGELGTMNGAEETVSAWYSALFGAWDGD
FT                   SVAPSLAAEIGDHARTVRVERGCTLTEDLGSLDPAVEAARAADVVVLALGGASLWFTGE
FT                   RTEGEASDTADITLPAAQVRLAEAVAATGTPLAVVLVQGRAYALPKVIQDAAAIVVAPY
FT                   AGPFGTQAIADVLFGVVNPCGKMPYSLPRHSGQIPVYHHQKAGSGYRNPLPPSVSRHYL
FT                   DLEATPLWPFAHGLSYTTFALSDLDCGADIDAYGTAHVSATVANTGPRDGATVMQLYLR
FT                   VNTSPVTRPAQQLAGFTRVELAAGESRRVTFEIDASQLAYTSLARQVAVEPALVDVFVG
FT                   LDSDDRSLAGSFAVVGSARVVEGAERSFLSRARPHP"
FT   gene            517180..518205
FT                   /locus_tag="Franean1_0436"
FT   CDS_pept        517180..518205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0436"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ret:RHE_PC00041 probable transcriptional regulator protein,
FT                   LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09901"
FT                   /db_xref="GOA:A8LGG2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG2"
FT                   /protein_id="ABW09901.1"
FT                   /translation="MVSTPDSQEARRVTIQDVAREAGVSVSAVSKVVRDAYGVSEGMRE
FT                   KVTAAIDALGYRPHTGARAMRGRSYSVGVMLTELTSPFQPQIINGITAQFEPTPYQEIL
FT                   IAAGTSPDRQKRSIEALIDRQVDGLIVIAPWMEQAWLEKLGASLPTVVLARHGGSGTFD
FT                   TIVGDDFEGARLMVDRLVALGHRRIVHTSQPSGGLERPYVLSHTPRLDGYEETMRRHGL
FT                   EPDVIVTSYSEEGGYEAARQALARPIPPTAIFAGADIAALGVLRAAEELGLRVPEDLSV
FT                   AGYDNIYMSTIGRISLTTIDQSAQLTGSRSARLLLERIDGRTQPVHYLIAPRLVARDTT
FT                   A"
FT   gene            518334..519530
FT                   /locus_tag="Franean1_0437"
FT   CDS_pept        518334..519530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0437"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cmi:CMM_0889 putative MFS-type efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09902"
FT                   /db_xref="GOA:A8LGG3"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG3"
FT                   /protein_id="ABW09902.1"
FT                   /translation="MNSARRTLLVLGFLVALGPFTVDFYIPAFPLVQADFGTSAAAVQL
FT                   TLTATTIGFALGQLAIGPWSDSIGRRRPLLVATALHVAGSLGVAAAPTVEVMLVFRLLQ
FT                   GAGAAGSGVVALAMVRDLFDGALFVRMAARLAVVTGLAPVVAPFAGSLMLSHMSWRGLF
FT                   VCIALYGLAVLAVAAFLVRETAPLVRRAGAPLGRYRVLVTDRGFVGAALAGGLLVSSVF
FT                   TYMSSSSFLFQETYGLSAQRYSLVFAANAVGFVIGAQTSARLVTRIGPRRLLRYVLPSL
FT                   GFLGFTLLLAAFAGENVVVVTFVTALYFLLAGAVGPCLQVIGMAPHGERAGTAAALMGA
FT                   ANFGLAGATAPVAGLLGVGSIGPIGLVMGLTMTVAVVVFRVLARDRREARAGAPSPVP"
FT   sig_peptide     518334..518399
FT                   /locus_tag="Franean1_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.595 at
FT                   residue 22"
FT   gene            complement(519779..519985)
FT                   /locus_tag="Franean1_0438"
FT   CDS_pept        complement(519779..519985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09903"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG4"
FT                   /protein_id="ABW09903.1"
FT                   /translation="MWTVLSADTDLKPQIATTYNSYPGTVANRSTSPCSAQCGGSPATV
FT                   LTGLLHPAMAADLDRKSSREQAC"
FT   gene            520355..520738
FT                   /locus_tag="Franean1_0439"
FT   CDS_pept        520355..520738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0439"
FT                   /product="protein of unknown function DUF433"
FT                   /note="PFAM: protein of unknown function DUF433; KEGG:
FT                   nca:Noca_1160 protein of unknown function DUF433"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09904"
FT                   /db_xref="GOA:A8LGG5"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG5"
FT                   /protein_id="ABW09904.1"
FT                   /translation="MPRPLACPAFAGRNRALSDNGRCRCNSAVTTDQDPRCRTPPMQQA
FT                   SDGRLVAMAVVSRITADPAIMAGAPAIRGTRVTVSAVLGQLAAGSTVEELLADYPSLTR
FT                   DDVLAALAFAAETMPQERPFIAA"
FT   gene            520735..521103
FT                   /locus_tag="Franean1_0440"
FT   CDS_pept        520735..521103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09905"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG6"
FT                   /protein_id="ABW09905.1"
FT                   /translation="MRFLVDENLSPRVAELLRDKGIDTTHVLEHGLGGSPDTEVSAFAV
FT                   AERRSIISADSDFTTLLALSRGTAPSLVLLRSGDQLKPDAQAALLLANLPALEADLEQG
FT                   VVISLSTTHVRVRRLPLR"
FT   gene            521370..521436
FT                   /locus_tag="Franean1_R0009"
FT                   /note="tRNA-Ser2"
FT   tRNA            521370..521436
FT                   /locus_tag="Franean1_R0009"
FT                   /product="tRNA-Ser"
FT   gene            522170..523276
FT                   /locus_tag="Franean1_0441"
FT   CDS_pept        522170..523276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0441"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09906"
FT                   /db_xref="GOA:A8LGG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG7"
FT                   /protein_id="ABW09906.1"
FT                   /translation="MPAGQGPHRAGWMVMVWSLLYALTRNALGLMLLRVRGDTAKDVEL
FT                   LVLRHQVAVLRRQVNRPALEPADRVILAALSRLLPRAGWGSFFVTPATVLRWHRELLAR
FT                   KWTYPRKTPGRPPVRREIRELVLRLARENPTWGHRRIQGELIGLGYPVGVATVWRILHR
FT                   AGVDPAPRRADASWRTFLSAQASGLLACDFFMVDTVFLQRIYVFFVVEHATRRVHVLGV
FT                   TKHPTSAWVTQRARNLLMDLDERCHRFRFLIRDRDMKFTASFDAVFIGAGIDVVRTPPQ
FT                   APKANAIAERWVGTARRECTDRLLIVSERHLTSVLTTYAEHFNTHRPHRSLGQHPPDSP
FT                   PVVAPTLESTVRRTRILGGMINEYRNAA"
FT   gene            complement(523525..523671)
FT                   /locus_tag="Franean1_0442"
FT   CDS_pept        complement(523525..523671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO6399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09907"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG8"
FT                   /protein_id="ABW09907.1"
FT                   /translation="MAAGLVEGDLALLNEDLLFWDEVQDLFDPDLMGALPDLFVPDASV
FT                   ADW"
FT   gene            complement(523772..524015)
FT                   /pseudo
FT                   /locus_tag="Franean1_0443"
FT   gene            complement(524046..524447)
FT                   /locus_tag="Franean1_0444"
FT   CDS_pept        complement(524046..524447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0444"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   mes:Meso_2826 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09908"
FT                   /db_xref="GOA:A8LGG9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGG9"
FT                   /protein_id="ABW09908.1"
FT                   /translation="MGRRLILDTNVLIAYERGTIDRSALDDDELAVAAITIAEYRVGIE
FT                   LADTVERAASRARALAAIESVVDVLAYTHATAVHHARLIAHVRRTGARRGAHDLIIAAH
FT                   AAETGRTVVTRDLKAGFAELPGILAVDTP"
FT   gene            524591..525511
FT                   /locus_tag="Franean1_0445"
FT   CDS_pept        524591..525511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0303 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09909"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH0"
FT                   /protein_id="ABW09909.1"
FT                   /translation="MVAPGDRHGFAALDGVEQVGEAPGCLGGGHRPHVPILSDNQIRLL
FT                   WCRPESTMPSSKAGKTSRPGSRCPAPTTATSSRPPSVTARTPSSPRTSSTSPRRRSARS
FT                   ACGRPATDYSSLFSRDPDGDLVAVGTSAGNWATLTDTHGDLVAAFTTTGTLTDSRSYDP
FT                   FGEPVVAGNPAVHVGFQGSWTDPDTDRVSAQARWYTPGTGTFASRDTANLPISGTAAAN
FT                   RYTYADANPLTYNDPTGFFADPIAGALRLDRFPSPIVYRAAPATHGPEAGGAAPDHGQV
FT                   LGRRQRRPRPMQRARIKPAPRVPRP"
FT   gene            525541..526257
FT                   /locus_tag="Franean1_0446"
FT   CDS_pept        525541..526257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0446"
FT                   /product="Hedgehog/intein hint domain protein"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   stp:Strop_0303 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09910"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH1"
FT                   /protein_id="ABW09910.1"
FT                   /translation="MGADKFWAGVRASLAGVKPPAPARGYTFDPSRASQDDLNRTLARG
FT                   SAANPTVCSAQCPGSTVSGGLSRDRCGDACMYIGVGAGIAAIAGVTVLTDGLIAAPEGA
FT                   AAGGLGRAVRGCTGRNSFDGATGVLMADGTHKPIRDVHVGDQVLATDPTTGRTEPHTVT
FT                   NLIIGTGDKHLVDITLDTPGPDATLTATDHHPFWDETDHTWVDADDLTTTNRLRTPTGT
FT                   LLAVVACGVPEVGLSL"
FT   mat_peptide     join(525541..525915,526000..526254)
FT                   /locus_tag="Franean1_0446"
FT                   /product="hedgehog protein"
FT   mat_peptide     525916..525999
FT                   /locus_tag="Franean1_0446"
FT                   /product="Susp-NBC371 DnaB intein"
FT   gene            526304..527542
FT                   /locus_tag="Franean1_0447"
FT   CDS_pept        526304..527542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0447"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: aau:AAur_0340
FT                   oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09911"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH2"
FT                   /protein_id="ABW09911.1"
FT                   /translation="MSVRLLYLIFVRVCGWLVLLGRSSAAKDLELLVLRHEVTVLRRTQ
FT                   PRPRWDWADRAVLNQTRSRNGGVWPPATTRHPKATPQDSTCADPSSGYAACQPHDPNLE
FT                   QTLGTDGPEVPVVCVGTSPLGGLPTIYGYDVEAGQAVATIRRVLESPIDFIDTSNEYAN
FT                   GESERRIGEALRSAAGGPGNVVLATKADPALWATEFPGSRVRESFRESTERLGVDRFEV
FT                   FYLHDPERFDFGYMTAPGGAVEAMVQLRTDGLATAIGVAGSDISEMRRYVDLGVFDVIL
FT                   NHNRYTLLDRSADALIDHAVNAGLSFINAAPYASGMLAKQVSARPRYQYRAPSPEIVRT
FT                   TAWLHQECARFHVPLAALALQFSTRDPRISSTVVGVSAPERVDELVENEQREIPSELWD
FT                   SVRERLVLPPTVT"
FT   sig_peptide     526304..526384
FT                   /locus_tag="Franean1_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.671 at
FT                   residue 27"
FT   gene            complement(527674..528660)
FT                   /locus_tag="Franean1_0448"
FT   CDS_pept        complement(527674..528660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0448"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; KEGG: nfa:nfa34060
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09912"
FT                   /db_xref="GOA:A8LGH3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH3"
FT                   /protein_id="ABW09912.1"
FT                   /translation="MGTRPRGVTASDVARALGVSRVTVSYVLNQTPGQSISEATRKKVL
FT                   AEAERLGYRPHAAARSLAGGSSRVILFLLPDWPVGDHTTGEYLKGAANVLNAAGYTLTA
FT                   GTHQTGSQARPLWEALDADLVVPVAPLTDEELAALRPASAPRALAGGALAPEQSPISRI
FT                   GTALQVQHLHELGHTRLVFAGSSDPRLAGLVAARAAEVRERGRELGIEVIDEQLIADTD
FT                   DGVAAVVQGWLAAAVTGVVAFNDNVAAHVVRAAVRGGVPVPERLAVVGHDDSPLARLYL
FT                   PTLTSVRVDAAGMGRRTARAVLHTLGVEKEPPGPADINATLIRRETT"
FT   gene            529072..530640
FT                   /locus_tag="Franean1_0449"
FT   CDS_pept        529072..530640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0449"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rle:RL0228 putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09913"
FT                   /db_xref="GOA:A8LGH4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH4"
FT                   /protein_id="ABW09913.1"
FT                   /translation="MIDGALSRRQVLGAALATVALAGASSCAGEEQSSGDGGSGRPSAS
FT                   REQTLSLAIQATPNSFDPAELTSGQSSFVWSALYDTLIWKDNKGKLQPNAAESWNYSDG
FT                   GRTLTLKLRKGMSFSSGAPVNAVAVKTTLERSKNTPGFTDQVLGALESVDAPDDRTVVL
FT                   RLSHPDGALLDSLAVSGAGVIGDPATLNDKRTALNPVGSGPYVLNTGQTVNGSTYVLDR
FT                   REDYWNVQAYPFKTVKISVIRDRTAALNALQAGEVNAGTVEVTNVDRLRAAGFDAAVVE
FT                   AHSLASLVLADRTGESLKPLGDPRVRQAINMAFDREKIVEQLLRGSGKPTEQVFNPKDP
FT                   AYDPALNTTYAYDPQRAKRLLAEAGYPNGFSVTMPEFFLAKSFAPTITQSLAAIGITTT
FT                   WEPVPPQQTDAAISSKKYPAFFLIAGLETTAGDASRYFSKDGAFNPFHAEDPDLTPQVE
FT                   QATQTIDPRQAADAYRHVNATAVRDAWNAPLFYVAVHWVTKKGITYLGDGSLTFNTVRA
FT                   FGLSG"
FT   sig_peptide     529072..529158
FT                   /locus_tag="Franean1_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.612 at
FT                   residue 29"
FT   gene            530652..531593
FT                   /locus_tag="Franean1_0450"
FT   CDS_pept        530652..531593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0450"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_1312
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09914"
FT                   /db_xref="GOA:A8LGH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH5"
FT                   /protein_id="ABW09914.1"
FT                   /translation="MLAYVLRRLGAGVVLALLVTLITFFLLSLSFDSVVRSLLGPSATP
FT                   ETLHARKAQMGLDRPVLVQYLDWLAHAARGDLGVSYFTSEPVVQAVPTRLGVTLSVIVV
FT                   ALILTALISVMLGVLAASRGGVVDRVAQGASLVGQLVPHMLIAIILVTVLAINLKLLPP
FT                   TGFTHLTDDPGRWAATITIPVITLTVASIANATAQVRGAMVDELSKDYIRTLRTRGISS
FT                   RSILLRHALRNAAGPALTVLSLEFITMFGGVLILENIFALPGFGTYAFNASLQGDVPII
FT                   MGVTLFAVLLIVTVNLVVDLVNGWLNPKARIH"
FT   sig_peptide     530652..530744
FT                   /locus_tag="Franean1_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.739 at
FT                   residue 31"
FT   gene            531590..533383
FT                   /locus_tag="Franean1_0451"
FT   CDS_pept        531590..533383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0451"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: sil:SPO2552 peptide/opine/nickel
FT                   uptake family ABC transporter, permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09915"
FT                   /db_xref="GOA:A8LGH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH6"
FT                   /protein_id="ABW09915.1"
FT                   /translation="MTTPASGTDTTKRRSTLRRLCKDPQAVVTSSVLLIIALLGALAPL
FT                   LTSHGPNEASLDAIDADVSTPGYPLGGDQSGRDIFARLLGSINTSMVSALIGTTVALTI
FT                   GVTGGLIGGYFGHRIRGFTEWVFNLVMTFPGLLLLIILMPVTKGDYRITMMIFGVLLSP
FT                   GVYRIVRNQVLSVRNELFVDAARVSGLSSPRILRRHILAAVRGPVIIATAFLLGASIGV
FT                   QAGLAFLGVGRSSVPSFGSMIAAGFESLYVEPLQIVWPSVMLGLITASLVLFGNAVRDT
FT                   LGASRRRPRKIHPSAPARPEKPDPSDDAPPGLLEVRNLTIAYPSPSGEPREVVRGVTLS
FT                   LQPGETLGVVGESSAGKTQIAFAALGVLPPGATITCGSITFDGRELLGRTERELRGIRG
FT                   RSIAYVPQEPMSNLDPCTTVGAQLVEGVQASTPMARRAARERVLALLGRVGIPDPKRTF
FT                   NSYPHQISGGMAQRVLIAGAVASRPRILIADEPTTALDVTIQADILDLLRDLQQELNMA
FT                   VLLVTHNFGVVADLCDRVAVMRRGEIVEMGTALDILGEPQHEYTRMLLASILDGSTTRT
FT                   DAPSGEISARDSVAVQVGEAR"
FT   gene            533380..534219
FT                   /locus_tag="Franean1_0452"
FT   CDS_pept        533380..534219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0452"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:bll0989 peptide ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09916"
FT                   /db_xref="GOA:A8LGH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH7"
FT                   /protein_id="ABW09916.1"
FT                   /translation="MTSLLEVSELRVAYPRRGFRARPREVLHGVSLTIGAGETLGVVGE
FT                   SGSGKTTVGRAVLGLVRPDGGRILFQGRDVTYASAKERRALARTRQVVFQDPYSSLSPS
FT                   LTIGDILCEPLLVQGLPAREARAHVRALLDMVRLPKDALERLPREFSGGERQRVAIARA
FT                   LAPEPKLIVCDEPVSALDVSTQARVLDLFIDIQRRTGVAYLFISHDLAVIRHVSHRVSV
FT                   VYGGDIVETGPADVVTSTPEDPYTRRLLLAAPVADPIEQRRRRELRRHLAEQVSTPS"
FT   gene            534469..536640
FT                   /locus_tag="Franean1_0453"
FT   CDS_pept        534469..536640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09917"
FT                   /db_xref="GOA:A8LGH8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH8"
FT                   /protein_id="ABW09917.1"
FT                   /translation="MPMPNLRMTGTGRGRRAAPARTAGQADPPLPLPRRRRRAAPTALA
FT                   FAAVLAVGVTSLVGVSAAGAADAPDCQPRTSGGPLFVTATCVDPALNQPYTDIDEQRTT
FT                   TDPKTNVTVTYRYIHGGFTGTNAKFSLYFPAAAQYQGRFFESTYPTVTQEDATPDVIAF
FT                   AISNGAYVVSTNNGGGVAAAGGLGGYRINAASAKYSRVVAARVYHGMARPRGYIYGASG
FT                   GAYQTLGAMENTDGVWDGGVPMVPGVPNGIPSFQASQSLALRVLADKLPQIADAVAPGG
FT                   SGDPYKGLNPTQRQVLQEVTRLGFPLRGWWQYATLNGGSFSVVARTVRAVDPSYVNDFW
FT                   AAPGYEGSSDAAVKAARVQYDTTVTGLVGSPTSALTLSGVPGGDVSGADLVVTSGAAAG
FT                   KSVPIGTVTGTTVGFGFGADPAVTGAIKPGDEVRIDNSWLLALQYYQRHQVPSSDQYGW
FT                   NQYRGPNGDPLYPQRPILVGPLLAAGAGGAAPTGHFNGKMIMLASTMDTQAYPWSADWY
FT                   HKQASTALGGKLADSYRLWYMDNAEHGPDLADYTSAIPGAAAHIVGYTSALNQALLDLD
FT                   AWVVRGTRPPASTTYTVDGNTQINLPAAAAQRNGVQPVVTLSANNANSGHPIDVRVGQQ
FT                   VTFSVQAQVPPGAGKIVRTEWDFLGAGDYPITATNQPIEAAEKLRATYSYSKPGTYFPV
FT                   VRVTSQRDGNSHTPYGLIQNLAAVRIVVH"
FT   gene            536845..537933
FT                   /locus_tag="Franean1_0454"
FT   CDS_pept        536845..537933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0454"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: rrs:RoseRS_3898 oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09918"
FT                   /db_xref="GOA:A8LGH9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGH9"
FT                   /protein_id="ABW09918.1"
FT                   /translation="MSFRWAIAGTGAIAHQFAAALGRLPDAELVAVGSRRQQTADAFGE
FT                   RFGIPRRRRYSSYERLAADDGVDVVYVASPHSHHHRHTLLFLSAGRGVLCEKPFALDAE
FT                   QAAEMVVAAQTHGQFLMEAMWSRFLPAYVKIRELVAAGAIGTVLAVEGDFGFPRPVDPA
FT                   NRVFDLAQGGGALLDLGVYPVSLASMLLGEPDRVVALGQLGETSVDEQVAVLMGYHTGA
FT                   VAVAKASLRASLACTGRVSGTEGSIELATFMHCPDNLTVRRKSGTQRLYLPADSDVTAT
FT                   DATATAGDIDGADRRNHRDRAAGGGLHHQIRHVHFRLQAGHLDSDIMSQAESVSVMRTL
FT                   DAARAQIGLRYLATLMDGSRQS"
FT   sig_peptide     536845..536907
FT                   /locus_tag="Franean1_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.763) with cleavage site probability 0.448 at
FT                   residue 21"
FT   gene            complement(537937..538203)
FT                   /pseudo
FT                   /locus_tag="Franean1_0455"
FT   gene            538299..540581
FT                   /locus_tag="Franean1_0456"
FT   CDS_pept        538299..540581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0456"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: rha:RHA1_ro02947 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09919"
FT                   /db_xref="GOA:A8LGI0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI0"
FT                   /protein_id="ABW09919.1"
FT                   /translation="MIEAQHLVSTLALEEKAELVSGGGLWVTAEIPHAGVRPAVLTDGP
FT                   HGVRMTRDGVDTGHIANSFPATAFPTAAALGSSWNEDLLREIGAALGAESRALGVDVLL
FT                   GPGINIKRSPLCGRNFEYFAEDPLLAGALGAAWVEGVQSHGVGASVKHFAANNQETDRM
FT                   RVSADVDERTLREIYLPAFEHVVRQAHVATVMCSYNRINGVRASQNRWLLTTVLREEWG
FT                   FEGYVLSDWGAVHDPVAALQAGLDLEMPSSRGRSAAEIVGAVRAGALDERCLDLAVERQ
FT                   LATHQRLWLARGDGMETPDLPAYHVLARRAAAEGAVLLKNDGDLLPLDPATGGRIAVVG
FT                   EFARSPRYQGAGSSQVNPTRLDDALTAILAATSREVTFAPGFRLDGTADPVLLAEAVQA
FT                   ARDAESVVMFLGLPEQTESEGFDRTDLDLPAIQVELLEAVASVNSRVAVILSNGGVVLT
FT                   DPVISRAATLLEMWLSGQAGGSAAADLIFGHAAPAGRLAETIPHRLQDIPTYVNWPGAE
FT                   GHVNYGERLYVGYRWYDRTDEDVAFPFGFGLTYTTFAYSDLAVHLPDPARPEARVEVVV
FT                   TNTGRREAAEVVQLYISDPVADVDRPVRELRGFRKVRVAPGHSERVVIELDARAFSYWS
FT                   TRRGQWVVEPGEYGIHVGSSSRDLPMTQTINLDMAMPTPPLTEESTLAEWYDHPSGRHI
FT                   VRELLGKTMGAQDGLLENLGTWQFVAQMPLTALLKMSPSAGTEAKPLKDLLHAANNGNA
FT                   AQPTANV"
FT   gene            540826..541494
FT                   /locus_tag="Franean1_0457"
FT   CDS_pept        540826..541494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0457"
FT                   /product="insertion element transposase"
FT                   /note="KEGG: sco:SCO6910 insertion element transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09920"
FT                   /db_xref="GOA:A8LGI1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI1"
FT                   /protein_id="ABW09920.1"
FT                   /translation="MSPRKTYPSDLSDARWELIAPTLRTWQKARLDRRPTGQPAQVDLR
FT                   EVFNAILYLNRTGIPWRYLPHDFPSHNTVYFYYAAWRDEGILARLGYTLTSLARAAEGR
FT                   EPEPTACILDTQTVKTSTDVPLASQGTDAGKKIVGRKRGVVTDPLGLLLAVNVTAAHLS
FT                   DNALGIRLLDQAKNTWQSLSKTWVDKGFKNTVVEHGAALGIDVEVVPRKTGTRGFHVVK
FT                   "
FT   gene            541777..543945
FT                   /locus_tag="Franean1_0458"
FT   CDS_pept        541777..543945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0458"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   fal:FRAAL4621 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09921"
FT                   /db_xref="GOA:A8LGI2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI2"
FT                   /protein_id="ABW09921.1"
FT                   /translation="MSMAGSVLGSRSESRIRPEHTDRAAVVYVRQSSRQQVVEHAESTR
FT                   VQYALVERAVTLGWARSRVTVIDDDLGVSAAVAASRPGFARLVTEVTMGRVGLVLGVEM
FT                   SRLARTGRDWHQLIELCSLAGTLLADLDGVYDPGVYNDRLLLGLKGTMSEAELWLIRQR
FT                   MWGGKLAKAERGELAFALPIGYWRDRGGQVVFDPDEQARTVVGLVFDLFDRLGTLNGVL
FT                   RWLVDHQVQLPVRSHSGVDKGELTWRRPNRETLQVMLHNPIYAGYHAYGRRRVDARRRK
FT                   AGRPSTGRVVRSMDDWHVLLPDRMPAYIGTDRYAANLARLEANRQTAASPGAPRPGSAL
FT                   LAGLVRCGRCGHRMTVSYHTPASRFPSHNYHCGYLLATYGTGRTCQHLAGPALDRYVTA
FT                   QLLDAVAPAALEVSLAAAAHAESDRAELDTLWRQRLERARYAAGRARRQYQLAEPENRL
FT                   VTRQLETDWETALADLDRLETDYQRFVEARPQTLTAAERAAITALAHDLPALWTAPTTS
FT                   QTDRKQLLRTLIDEITVTVVGTSELVDVTITWAGGHQTHGRTTRPVARLDQLSYYHHLV
FT                   ERVSELASAGHSSRQIADQLNTEGLRPPKRTTRFGPDQILTLTRRLGIGVHHPRDTRTA
FT                   LANPGPGRWSVAGLAVALNMPTATLYTWIYRGWITAERHPDGRSWIILADDVEIRQLRE
FT                   RRDRPPGYYTRARWTRPHLDHSTNGTRT"
FT   gene            543976..544146
FT                   /locus_tag="Franean1_0459"
FT   CDS_pept        543976..544146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0459"
FT                   /product="insertion element transposase"
FT                   /note="KEGG: sco:SCO6910 insertion element transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09922"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI3"
FT                   /protein_id="ABW09922.1"
FT                   /translation="MAHFERSLGWLMLHRRLVRDYETLPASSEAMIHIVMIDNTAKRIT
FT                   GETTPTWRDPR"
FT   gene            complement(544161..544409)
FT                   /locus_tag="Franean1_0460"
FT   CDS_pept        complement(544161..544409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09923"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI4"
FT                   /protein_id="ABW09923.1"
FT                   /translation="MTSIEAPWKKDSRPGENVRSDFMCLFSCIGSIQGVSAVCSPALIY
FT                   RRPDVPPGFRRTRWLGRHRHAGARRAQGHPKWVFDLS"
FT   gene            complement(544538..546100)
FT                   /locus_tag="Franean1_0461"
FT   CDS_pept        complement(544538..546100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0461"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rle:RL4463 putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09924"
FT                   /db_xref="GOA:A8LGI5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI5"
FT                   /protein_id="ABW09924.1"
FT                   /translation="MRKRRFLTPAVAGLVTLVLAACGGGSGSSPSTPATGEPIPGGKAT
FT                   VLMLSDPTTLDPARLGNAYAITPVLGNALYGTLLTDDKKTGEIQYSLIESFETTDQGAT
FT                   FTLKLRPDLVFSDSTPFDAEAVKFNWDRMRDPATGSTSIAEASMIKAIKVVDDVVLEVT
FT                   MATPVPSYAYSILTSSMNWVASPTALRKGAEAFNENPIGAGPFTLQRWNRQATIELIKN
FT                   PRYWDAPKPYLDGLTLRAATDSGQRLNTVVSGGADVAVDSNWLNIAKAREQGLTVDLQE
FT                   LNGGILIALNMRRAPFDDIRARRAVSAALDLDALNLAVYSGEGKMVDTLFTKGSLFYSD
FT                   TPLRKHDKETAQRLFDELAADGKPVSFTFSAYPTTENRTTAENIQAQLGAFRNVKVEIA
FT                   TVDFSQLAKVRSQHDFDMIVSGGFFRDPEPGLWTAFHSSSVANQTGVDDPTLNEALLAG
FT                   RTEITQEAREKAYATVQQQLTDLVPVIYLARVAPSAIANTNVGGVIQYGNGSLRPEELW
FT                   IKK"
FT   sig_peptide     complement(545990..546100)
FT                   /locus_tag="Franean1_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 37"
FT   gene            complement(546324..547541)
FT                   /locus_tag="Franean1_0462"
FT   CDS_pept        complement(546324..547541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09925"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI6"
FT                   /protein_id="ABW09925.1"
FT                   /translation="MPLDELTRWLGAAAVAALTVAVTGCSVVGGGGDAPVAACESPGVT
FT                   ADKVHVGFVFSDSGSGSSALSSARAGVDARIGLANDAGGVNGRHIVYDWRDDAGSPSQN
FT                   ARVTEELVHDESVFGLISATAAGSGSLDSLSAMGIPVTGLANPTWAKYPNLFAYMYDVS
FT                   PVVTARYIQANGGTKAAFVMTGSPAFTVQTIERYKTAFAAIGVGTTETISYASGVDSPT
FT                   QAVERMVNSGANAIVAFTTPKDLVEILQTASAANLRFSSTVSVTGYDRGVLKTYGPQLA
FT                   GVSFTVNFHPFEMRNASMDRYRDAMTRFAPESSVPEQQFALYGYLYTDLFIRGLELAGE
FT                   CPTREGFIKSLRKVTDYDAGGLIEPVDLSTNRTQPLQCNAFVRINPDGTAFDIAGARLC
FT                   ADGTGA"
FT   sig_peptide     complement(547452..547541)
FT                   /locus_tag="Franean1_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.290 at
FT                   residue 30"
FT   gene            complement(548161..549108)
FT                   /locus_tag="Franean1_0463"
FT   CDS_pept        complement(548161..549108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0463"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   acr:Acry_1590 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09926"
FT                   /db_xref="GOA:A8LGI7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI7"
FT                   /protein_id="ABW09926.1"
FT                   /translation="MRAVRGHEGRPVVVDVDDVPGWDDGELLNMAVAGICASDLNWLRL
FT                   GTRFILGHELAGRKADGKPVLVEGLFGCGTCEFCWEGRNNLCDQSPRNALGIMQNGGMV
FT                   EQFRVPTRKVLEMPAGLDVSNASLAEPGAVAWHGVRLGGIAPGRTVTVVGGGSIGQLAA
FT                   AAAQTQGADEVVLEARYPHQHEIRERMGVGEPTAGTLYDVVIEAAGSPSSLQRSVELVK
FT                   PGGTVSLLGVHHGGIDVPYSALLTKEVTLVASMGYCGHAGKREMLQAAEMLAARPEIPD
FT                   SLITHRFPLEDAAEAFRVAGNRESGAVKVVIEIG"
FT   gene            complement(549167..550003)
FT                   /locus_tag="Franean1_0464"
FT   CDS_pept        complement(549167..550003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0464"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: mgi:Mflv_2472 taurine catabolism dioxygenase
FT                   TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09927"
FT                   /db_xref="GOA:A8LGI8"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI8"
FT                   /protein_id="ABW09927.1"
FT                   /translation="MSTTATPLSAHVGLEITGVCGRDLPTPSAAADCLKALEQYGVVVY
FT                   REAHIGDQELVAFSRLLGEVAPNPTGEHQFPEIATITLDPAKTDAVRAWYRQGNFLWHI
FT                   DGATEELPQKATLLTAREVDPKGGDTEFASTYAAYDALPEEEKERLAGLRVVHSFAAAQ
FT                   QRAHPEATEDQRAAWARVPVREHPLVWTRRTGRRSLLLGATAGEVIGIPADEGQALLKR
FT                   LLDWSTQPRFVLRHRWRLGDLVIWDNTGMLHRATPFAATSRRLMHRTTLVGEVAVA"
FT   gene            complement(550491..551198)
FT                   /locus_tag="Franean1_0465"
FT   CDS_pept        complement(550491..551198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0465"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: sma:SAV1367
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09928"
FT                   /db_xref="GOA:A8LGI9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGI9"
FT                   /protein_id="ABW09928.1"
FT                   /translation="MNEIAIVTGAAGGIGASVARQLTGSGTHCVLVDRDPTVERVASSL
FT                   GADAVVGDLTDPDLSLRMVAAAGNRVDLLVLNAGVNSIDKDPATLDLGRYHAVVGVNQH
FT                   SVVYGLRAALPSMRRQGSGSIVVTASHAALRGVEQDPIYTMTKHAVIGLVRALAGPLSR
FT                   EGIRLGAVCPGLVDTPLTAGARERFHASGIPMLTADEVATAIVDTLRTGEPGTELVLSP
FT                   GHPPARYSPAPII"
FT   sig_peptide     complement(551139..551198)
FT                   /locus_tag="Franean1_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.704 at
FT                   residue 20"
FT   gene            551311..551880
FT                   /locus_tag="Franean1_0466"
FT   CDS_pept        551311..551880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0466"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aau:AAur_3028
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09929"
FT                   /db_xref="GOA:A8LGJ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ0"
FT                   /protein_id="ABW09929.1"
FT                   /translation="MARNRREEILDIALEMFAEHGYRGTSLDAIAQRVGLTRQGVLHYF
FT                   SSKEKLLTEILRRREELGREHLLAGHAHEDLPHQMAAIVAHDHQRPGLTQVYGVLLGES
FT                   LTHGHPAQEYFRGHYAMVRERMAADFTARWGERLPNGLTPRAAATALLALLDGMQQQWL
FT                   LDRSQTDHSEIIRDVLAVLLGLPPTE"
FT   gene            complement(552016..552267)
FT                   /locus_tag="Franean1_0467"
FT   CDS_pept        complement(552016..552267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro08022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09930"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ1"
FT                   /protein_id="ABW09930.1"
FT                   /translation="MSYDLRRLRLHGLIERVPGTHRYQITPAGQRHALFLTRVHNRVLR
FT                   TGIAELADRHSDPPPLRRAADAYDTAINELIHHAGLAA"
FT   gene            complement(552329..553630)
FT                   /locus_tag="Franean1_0468"
FT   CDS_pept        complement(552329..553630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro07227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09931"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ2"
FT                   /protein_id="ABW09931.1"
FT                   /translation="MTLPRTVADVLAHHVSFEVECIDRMYLNVYVPQLQFPLGLVGFLH
FT                   RRLGMRVASTAPLASITEGFVTAVRRFAADHYIPIVDFVKGQRKDDVMHERLKDFTGTQ
FT                   GVVFIGRAQEKTPLFRTEKRRDAEGKTYPWIVKTTGVVNHFYFYCVDDDFGPFFLKFCS
FT                   YFPYNAKLCLNGNHWAQRQATKSGIAFTPMDNAFAAVEDPAGLQTICDRPGPAEIDGLL
FT                   RKWLDILPHPFTPDDRDAGYHYDLSILQAEFSLTQTLDRPLSGRIFFEQVIRDNLDIGR
FT                   PDQVSLVFDRSLRRTGPRATPSRFRTRIITNGVTPSLHVDYKRHDQAVPQRRKSATHRD
FT                   HHQRHPRLRDREKADQPAGVTAGRLPRQPTSARRPDHQPRSHRRRHRVRGHHRSGHHRD
FT                   RTAGRRYAVHRPPRPSPLVCNPRLPSAATRFHQP"
FT   gene            complement(553850..554917)
FT                   /locus_tag="Franean1_0469"
FT   CDS_pept        complement(553850..554917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0469"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09932"
FT                   /db_xref="GOA:A8LGJ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ3"
FT                   /protein_id="ABW09932.1"
FT                   /translation="MFVRLLYLIFVRVCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQ
FT                   PKPRWDWADRAVLAALIRLLPKALRAHRLVTPGTVLRWHRRLIVRKWTHPQRMGRPPVG
FT                   TEIVPLIERLATENTTWGYQRIRGELLKLGHRVSASTIRRVLTSLGLPPAPQRQTDTTW
FT                   RQFLRTQASTMLAVDFFHVDCAVTLRRLYCFFVIEVGSRTVHILGVTAHPDGPWTTQQI
FT                   RNLLMNLGDRAADFQVLIRDRAGQFTASFDAVLIDAGITTIKIPPRTPRANAYAERFVR
FT                   TVRTEVTDRMLIFGERHLRVVLAEYARHYNGRRPHRALRLQPPRPDHPIADVTTARIKR
FT                   RPVLGGLINEYERAA"
FT   gene            555009..555775
FT                   /pseudo
FT                   /locus_tag="Franean1_0470"
FT   gene            complement(556027..556842)
FT                   /locus_tag="Franean1_0471"
FT   CDS_pept        complement(556027..556842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09933"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ4"
FT                   /protein_id="ABW09933.1"
FT                   /translation="MVVSLGRRLEVTTTPLLPFTNWRFTPASSEQLRTAASKKAWGDSR
FT                   SIIGEFNGDQPSPWTAWIPEQPPPHSGPDTVTVAHALSAGFEPGRTFGVYPVSERNRIA
FT                   TRPGATLRKDARLPGGRLIEPATEPAWLTRLLTPDPHAFAPWEHPVDRVEASHDGAQLL
FT                   LSIRSARGETPATVQIQELSDRLDVLVSVGIEPGHGPLPVPGEFVPSSPIGSRPGRRAG
FT                   LIRLSPERLRLIRVTLTHPLGDRAVYDLAHQDQTARDTARRAWKDQWNS"
FT   gene            557021..557503
FT                   /locus_tag="Franean1_0472"
FT   CDS_pept        557021..557503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09934"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ5"
FT                   /protein_id="ABW09934.1"
FT                   /translation="MPNRATDDPVDPELVVILNPSVDAGTAVPSLCPPLRGYVGLERGG
FT                   DVIGDMIIKDLVAHRIIARTPFLVRGFPIEAYAGIGNEIVGVVRDVAQEAIGGDDLIGG
FT                   ETGGSYPDRLVVAVGVEARTSVHHDADDRVRRITSENVRIGHRDKGSLGEAVSGGQ"
FT   gene            557745..558773
FT                   /locus_tag="Franean1_0473"
FT   CDS_pept        557745..558773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0473"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: rle:pRL120370
FT                   putative transposase for insertion sequence element"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09935"
FT                   /db_xref="GOA:A8LD19"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A8LD19"
FT                   /protein_id="ABW09935.1"
FT                   /translation="MSPSYEGRQIVGIDLHRRRSVIVRMTPDGYPLGTVRISNDAATLA
FT                   AEISRAGEHPDVVLEATYGWYWAADVLAAAGAQVHLAHPLGVKGFAYRRVKNDVRDAAD
FT                   LADLLRMGRLPEAWVAPPPVRELRETVRHRAALVAIRSACKAQIHAVLAKNGVAVPMTD
FT                   LFGQAGTDLLGQVELPSPFHARVTSLRRLIDLLDFEIDAAACQLAGRLARDPGYQALLV
FT                   LPGVGKTLAAVFLAEIGDITRFPTPGHLASWAGLTPRHRESDTTVHRGHITKQGSSLIR
FT                   WAAIEAVSILPPTTPVLGPTKTRVAARRGTNIGKVAAARKLLTFVFYALRDGEVRALHT
FT                   AA"
FT   gene            complement(559194..560261)
FT                   /locus_tag="Franean1_0474"
FT   CDS_pept        complement(559194..560261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0474"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09936"
FT                   /db_xref="GOA:A8LGJ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ7"
FT                   /protein_id="ABW09936.1"
FT                   /translation="MSIRLLYLIFVRVCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQ
FT                   PKPRWDWADRAVLAALIRLLPKTLRAHRLVTPGTVLRWHRRLITRKWTYPQRTGRPPVS
FT                   PEIAALIERLATENTTWGYQRIQGELLKLGHRVSASTIRRVLKSLGLPPAPKRQTDTTW
FT                   RQFLRTQASTMLAVDLFHVDCAVTLQRLYCFFVLEVGTRTVHILGVTAHPDGPWTTQQA
FT                   RNLLIDLGDRAADFQVLIRDRAGQLTASFDAALADAGITAVKIPPRTPRANAYAERFVH
FT                   TVRTEVTDRMLIVGERHLRTVLAEYARHYNGRRPHRGCGLQPPRPDHPVADLARERIKR
FT                   QPVLGGLINEYERAA"
FT   gene            complement(560486..562102)
FT                   /locus_tag="Franean1_0475"
FT   CDS_pept        complement(560486..562102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0475"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: gvi:gll2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09937"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ8"
FT                   /protein_id="ABW09937.1"
FT                   /translation="MTVAMDYGPPSVEKPLGALPVVRDYLARLDVAGTIDRLAPMRDKV
FT                   NRATHGDVIAALVANRLTSPTPLLHVERWARDWAVEEMFGIAPDVLNDDRVGRALDALA
FT                   PVCEAVVGSVGAAAIAAFDLDLSRVHWDMTSISLHGAYPEIDGDYATPKYGHPKDRRPD
FT                   LKQVQTGLAVTGDGGIPLLHRAYDGGAGEVCQVTGAMRALAGLAGPRQFLLVGDSKLVS
FT                   YANLTALTSTPGVTFLAPAPKTVVPGQVLAAQDWATATLVGYVAARDQDKPFHQRAAYR
FT                   VREGVTTLRGPRKKDPPVTVRTVFVWSSANDQAAKAARALKLGRARTDLDTLTRAAGSH
FT                   HLYRTEAAVQARLTLLATKHRVTRYLHATTSVDPDTGKPALAWNFDSAALDAETATDGW
FT                   YALLTNLPDDVGPAEVLARYKGQEVVERRYGAFKGPLAVAPMFLHSNQRIHALIHVICL
FT                   ALLVFCLVERQARLGTGPDGKIPGIYAGRPARPTGALVLGALSRLRLVPARGDQPAYIP
FT                   RPSALHQHLLDILGVDPTRPP"
FT   gene            562637..563221
FT                   /locus_tag="Franean1_0476"
FT   CDS_pept        562637..563221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09938"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGJ9"
FT                   /protein_id="ABW09938.1"
FT                   /translation="MPAEESATGMPRRAFLAAGLGIATVGATVALAKPAAAAGDGIHYW
FT                   RFCNKCFGLLRELRADNNHCPQGGSHVIQGWTFAVAYSNGNFLHAGETPSLQSAWMECY
FT                   YCALIYYGDANGVCVARGGAGHFGTSQQNLLPHDLNPIPGGYQSEWRFCFKCGTLYFDG
FT                   YRPNRGACPGNPGWGHAAAGYMFQLQVAAYT"
FT   sig_peptide     562637..562735
FT                   /locus_tag="Franean1_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.948 at
FT                   residue 33"
FT   gene            complement(563376..563564)
FT                   /locus_tag="Franean1_0477"
FT   CDS_pept        complement(563376..563564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0477"
FT                   /product="putative transposase"
FT                   /note="KEGG: fal:FRAAL2496 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09939"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK0"
FT                   /protein_id="ABW09939.1"
FT                   /translation="MAEFWHPTRLRPMRGLKRLCSAQLIGVGHAFQNLRRGHYELGLDA
FT                   EPHRRLASAFTELALAI"
FT   gene            complement(563583..564650)
FT                   /locus_tag="Franean1_0478"
FT   CDS_pept        complement(563583..564650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0478"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09940"
FT                   /db_xref="GOA:A8LGK1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK1"
FT                   /protein_id="ABW09940.1"
FT                   /translation="MSVRLLYLIFVRVCGWLVLLGRSSASKDIELLVLRHEVAVLRRTQ
FT                   PKPRWDWADRAVLAALIRLLPRALRAHRLVTPGTVLRWHRRLITRKWTHPQRTGRPPIG
FT                   TEIATLIERLATENTTWGYQRIQGELLTLGHRVSASTIRRVLKTLGLPPAPKRQTDTTW
FT                   RQFLRTQASTMLAVDFFHVDCAVTLRRLHCFFVIEVDSRTVHILGVTAHPDGPWTTQQA
FT                   RNLLMDLGDQAADFQFLIRDRAGQFTASFDTVLADAGITAVTIPPRAPRANAYAERFVR
FT                   TVRTEVTDRMLIVGERHLRMVLAEYARHYNGRRPHRGRDLQPPRPDHPVADLTQERIKR
FT                   QPVLGGLINEYERAA"
FT   gene            complement(565191..565814)
FT                   /locus_tag="Franean1_0479"
FT   CDS_pept        complement(565191..565814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0479"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL1635
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09941"
FT                   /db_xref="GOA:A8LGK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK2"
FT                   /protein_id="ABW09941.1"
FT                   /translation="MTNQPTTGRGRRSRQKIVDAASALIDDRGVAGAGLDQILTAAGAS
FT                   KSQLYHYFGDKGGLVRAVVADRFDCLVEAQLPRLSQLDTWTAIRAWMDEFATQTAASDF
FT                   PGCPLGNLAGELAGRDEAIRADLSACFERWQAYLTQGLERMRIRGELVSDAEPELLALA
FT                   VFTSLQGGVLLARTHRDVLPLRVALDAAYAHLRSFAAPQPDVGR"
FT   gene            565947..566702
FT                   /locus_tag="Franean1_0480"
FT   CDS_pept        565947..566702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0480"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: psb:Psyr_4922 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09942"
FT                   /db_xref="GOA:A8LGK3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK3"
FT                   /protein_id="ABW09942.1"
FT                   /translation="MSSLTGKPAALVTGGTTGIGLATAQMLHADGFDVLITGQNPETLA
FT                   AAAEQLPADVVVLRSDARTLSEPDRVAAAVRDRFGRLDVVFLNAGIGRLVPIEAVDEAT
FT                   YDEMFDVNVRSQLFTLQRVLPLLRDGGSVVFSTALGATLGLADWSVYSATKGALTALVH
FT                   ALAVELAPRGIRVNAVSAGPADTPALSKLGLPDAALATMRKDLAAAIPLGRLGVAQDVA
FT                   RAVAFLGSPAAGFVTGTTIAVDGGLGVAV"
FT   sig_peptide     565947..566036
FT                   /locus_tag="Franean1_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.772 at
FT                   residue 30"
FT   gene            566755..567525
FT                   /locus_tag="Franean1_0481"
FT   CDS_pept        566755..567525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0481"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bvi:Bcep1808_3622 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09943"
FT                   /db_xref="GOA:A8LGK4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK4"
FT                   /protein_id="ABW09943.1"
FT                   /translation="MTTTNAIAQAQPRVALVTGGTTGIGLATARLLHADGFAVAITGQN
FT                   PETLAAARHVLPDDVLVQRADARVLADADALAAELRDRFGHLDAVFLNAAVAQPSSFSS
FT                   VTEESYKEHFGVNVKGQFFTLQRVLPLLRDGGTVVFNSSRLVARSFPGMSLYVATKGAV
FT                   ASMARALAVELAPRRIRVNVVSPGPVDTPALAKQGLSAAELTSLRTTLTAKVPLGRIAS
FT                   DEEVAHTVAFLVSDAASYLTGADIVVDGGMMASV"
FT   gene            567588..568082
FT                   /locus_tag="Franean1_0482"
FT   CDS_pept        567588..568082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stp:Strop_4211 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09944"
FT                   /db_xref="GOA:A8LGK5"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK5"
FT                   /protein_id="ABW09944.1"
FT                   /translation="MDKAELDEQNRRVTAEFLTRGGVVSGDYQGMPLLLLHHVGARTGH
FT                   ARVNPMTYLAVNHSFAVFASNGGAAVHPDWYHNLLAHPTVSVVVGTETFPMVARVATGA
FT                   ERESIWARQKAVNPLFAELERATTRQIPVVILDRTPAPLPAPEPEPTPVPASSKDGDDR
FT                   R"
FT   gene            568079..568966
FT                   /locus_tag="Franean1_0483"
FT   CDS_pept        568079..568966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0483"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; KEGG: gvi:gll2891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09945"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK6"
FT                   /protein_id="ABW09945.1"
FT                   /translation="MTVLVVGATGRTASYLVMCLLRDGVPVRALVRDRDKAETVFRATR
FT                   RPATGHLEIVSGPFDDPALLLSATKGVDAAFLALSTSPQQIALERNVVDAAVRAELPHL
FT                   VRLSVFDADLDAGYEIGRRHGELDAYLAASGVPHTLLRPTYFSSNLLVAAPSIAATSQW
FT                   AGLAPDGRVALIDTRDVAEAAAVVLRDPAGRGAAYQLTGPEALTFTEIAECFSRVLGRR
FT                   ISYDAADEAHVRAAMAARGVPGWLADIAVGIDLAMQAGRHSQVTNEIRALTGAAPRPLE
FT                   AFIESNRAAYTPAG"
FT   gene            569012..569251
FT                   /locus_tag="Franean1_0484"
FT   CDS_pept        569012..569251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09946"
FT                   /db_xref="GOA:A8LGK7"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK7"
FT                   /protein_id="ABW09946.1"
FT                   /translation="MSAGRGLRRAGWMVMVWSLLYALTRNALGLMLLRVRGDTAKEVKL
FT                   FALRHQMAVLRWLWGARTWPLALTWSFRWLVRIR"
FT   gene            complement(569226..570305)
FT                   /locus_tag="Franean1_0485"
FT   CDS_pept        complement(569226..570305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0485"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09947"
FT                   /db_xref="GOA:A8LGK8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK8"
FT                   /protein_id="ABW09947.1"
FT                   /translation="MMVHCVRTPAVSDLRAGLRLAGPPRSFVGVQGHRAAGVAARGHHA
FT                   APYPAQAPVGLGGPGGTRRTDPAFAEDTASAPTGHPRHRPTVAPPSNHTEMDLPAPDRT
FT                   TAGQHGDRDPHRAARDREHDVGIPADPGRAPHTRPPHWRVHDRRVLTSLGLPPAPKHQT
FT                   DTTWRQFLRTQASTMLAVDFFHVDCAVTLRRLYCFFVLEAGSRSVHILGVTAHPDGLWT
FT                   TQQIRNLLMDLGARTADFQFLIRDRAGQFTASFDAVLADAGITTVKIPPRTPRANAYAE
FT                   RFVHTVRTEVTDHMLIVGERHLRSVLAEYAAHYNGRRPHRSRDLQPPRPDHPIADLTKE
FT                   RIKRRPVLDGLINEYERAT"
FT   gene            complement(570421..570762)
FT                   /locus_tag="Franean1_0486"
FT   CDS_pept        complement(570421..570762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0486"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: sen:SACE_0965
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09948"
FT                   /db_xref="GOA:A8LGK9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGK9"
FT                   /protein_id="ABW09948.1"
FT                   /translation="MRIGELSARTGASVRSLRHYEKHGLLVADRGANGYRHFPESAVET
FT                   VARIQMLLGAGLSVATIRQVLPCTLDATPRIVPCAELSATLRGELARLEKQASQLDRAR
FT                   GLISTMLAG"
FT   gene            570804..571682
FT                   /locus_tag="Franean1_0487"
FT   CDS_pept        570804..571682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0487"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: sma:SAV7484
FT                   N5,N10-methylenetetrahydromethanopterin reductase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09949"
FT                   /db_xref="GOA:A8LGL0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGL0"
FT                   /protein_id="ABW09949.1"
FT                   /translation="MSDSMVRGMDIGIFTGITDEQIRPALLARAVEERGFESLFVAEHT
FT                   HIPVRRETPYPEGGDLPRDYYRTLDPFISLTTAAAVTTRLRLGTAIALVVQRDPILLAK
FT                   ETATLDLVSDGRFELGIGAGWLREEMRNHGTDPETRVPLMRERLAATKALWTSEQAEFH
FT                   GRFVDFDPIFQWPKPVQRPHPPVWIGGWGPTTFHRIVTDGDGWLAPPIPVDALARGVEE
FT                   LAEVANRAGTAAPPVTAILLNPDEAATEKAALLGVRRILFGLFPVTDADTTLRTLDHLG
FT                   TLAQRTVLARG"
FT   gene            complement(571679..571819)
FT                   /locus_tag="Franean1_0488"
FT   CDS_pept        complement(571679..571819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0558 conserved hypothetical protein;
FT                   putative DNA-glycosylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09950"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGL1"
FT                   /protein_id="ABW09950.1"
FT                   /translation="MGLHLSQIAEADELLTNDPLALLIGMVLDLRVSERTSALPGTART
FT                   S"
FT   gene            complement(571902..572147)
FT                   /locus_tag="Franean1_0489"
FT   CDS_pept        complement(571902..572147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0489"
FT                   /product="putative transposase"
FT                   /note="KEGG: fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09951"
FT                   /db_xref="UniProtKB/TrEMBL:A8LGL2"
FT                   /protein_id="ABW09951.1"
FT                   /translation="MRRRGSRTVRTEVTDRMLIFGERHLRTVLAEYAAHYNGRQPHRSR
FT                   DLQPPRPDHPVADLTKERIKRQPVLGGLINEYERAT"
FT   gene            complement(572363..573112)
FT                   /locus_tag="Franean1_0490"
FT   CDS_pept        complement(572363..573112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0490"
FT                   /product="protein of unknown function DUF1232"
FT                   /note="PFAM: protein of unknown function DUF1232; KEGG:
FT                   rha:RHA1_ro01555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09952"
FT                   /db_xref="GOA:A8KX49"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX49"
FT                   /protein_id="ABW09952.1"
FT                   /translation="MRDWLVGLGIAAGCLVASWGVLFLLARRLPPGVLRDLAAFIPDCL
FT                   TTVRRLRKNPQVPRKAKIAVLIAGLWVASPIDLIPEFLPVIGPLDDIVVVALALRYAGR
FT                   QVPRDVLLAAWPGQPRLLERLLGPAHTSPPDSADAAAGNGPTEVELLVTPDCPHQGPAA
FT                   VLLRQALNDIGLTSTRITTTAVTDQRHAEELGFAGSPTIRIAGRDLFAQPSHAPTLACR
FT                   IYHTPTGLAATPDLSELRQALRRASGR"
FT   sig_peptide     complement(573032..573112)
FT                   /locus_tag="Franean1_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.639) with cleavage site probability 0.397 at
FT                   residue 27"
FT   gene            complement(573105..573734)
FT                   /locus_tag="Franean1_0491"
FT   CDS_pept        complement(573105..573734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_5569 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09953"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX50"
FT                   /protein_id="ABW09953.1"
FT                   /translation="MGQQPLRQQVHVTRVTLIVVSNDPTSRWLVVSVRLPGDPSRHRVA
FT                   VWRELRRLGAMPVGSGVWAMPATPLFLDGLDRVRALVDRGNGRVVALDGRARDGNSEAT
FT                   LVAEFNAARAAEWAEFVAECDKFDAEIAKERRIGKFTLAELDEEEQSLERLRRWWRELK
FT                   TRDVFAAVANTPAGERLEHCVKVLDAYSEDVYRAVHAPLDEETDHA"
FT   gene            complement(574009..574332)
FT                   /pseudo
FT                   /locus_tag="Franean1_0492"
FT   gene            574364..574759
FT                   /locus_tag="Franean1_0493"
FT   CDS_pept        574364..574759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09954"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX51"
FT                   /protein_id="ABW09954.1"
FT                   /translation="MHRPRSQDQADFWHATGPGHHPSNIKNLKSAVLAGGGARQCRPGV
FT                   GQPGRVHPVIDQEKCGSRSIRRPGNFPGYVLASLAPASQRTFRRSLVQISSAIKLETRT
FT                   GVRVPIRFPSGLLMFTVRFLVHRFLLV"
FT   gene            574870..576030
FT                   /locus_tag="Franean1_0494"
FT   CDS_pept        574870..576030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0494"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   stp:Strop_3570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09955"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX52"
FT                   /protein_id="ABW09955.1"
FT                   /translation="MERRTFLRSAIAGTGVVAFSGAIWDTALAAPAQNGSSPYGSLLAA
FT                   DANGVMLPSGFTSRIVARSGQVVSGTSYTWHNAPDGGAVFLNGTGWMYVSNSEVGSSAG
FT                   GASVLRFDSSGTVTSAQRILSNTSSNCAGGATPWGTWLSCEETSNGRVWETYPATGASA
FT                   VSRPAMGRFKHEAAACDPVRQVIYLTEDQTDGCFYRFRPTTWGNLSSGTLEVLVAGSGT
FT                   SGTATWQVVPDPDGSPTATRSQVSGAKHFNGGEGCHYANNTVWFTTKGDNRVWEVHVDT
FT                   NTFELAYDDSLVSPGPAPLTGVDNITGSTYGDLYVAEDGGNLEICIITPDDIVAPILRL
FT                   VGHNSSEITGPAFSPNGQRLYFSSQRGTSGSSSGGITFEVTGPFRT"
FT   sig_peptide     574870..574959
FT                   /locus_tag="Franean1_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.622 at
FT                   residue 30"
FT   gene            complement(576413..576805)
FT                   /locus_tag="Franean1_0495"
FT   CDS_pept        complement(576413..576805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0495"
FT                   /product="putative transposase"
FT                   /note="KEGG: fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09956"
FT                   /db_xref="GOA:A8KX53"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX53"
FT                   /protein_id="ABW09956.1"
FT                   /translation="MALGERAARFRFLIRDRDTKFTAAFDTVFTTDNIDIVRTPARAPV
FT                   ANAFAERWVGTIRRECLDHLLILGERHLTAVLTAYVDHYNQHRPHQSLQQQAPLSAGAD
FT                   PPPEPGTPVVRHGRLGGLIYEYQQAA"
FT   gene            complement(576808..577452)
FT                   /locus_tag="Franean1_0496"
FT   CDS_pept        complement(576808..577452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09957"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX54"
FT                   /protein_id="ABW09957.1"
FT                   /translation="MDDPGHGGSADLPRLLSAVGWLGLVARSSAAKDAEILVLRHELAV
FT                   LHRQVARPRFCWADRAILAGLARLLPQASRSILLVRPETILRWHRQLVRRRWTQPHRPP
FT                   GRPSTPTEIRHLILHLAKENPHWGYRRIHGELIRLGYSVGASTVWTILRSAQVNPAPRH
FT                   TSPTWRQFLHIQAHGILACDFFTINRPAEQAVRPVLPRAGLPPQSPSRPAI"
FT   gene            complement(578590..579471)
FT                   /locus_tag="Franean1_0497"
FT   CDS_pept        complement(578590..579471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09958"
FT                   /db_xref="GOA:A8KX55"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX55"
FT                   /protein_id="ABW09958.1"
FT                   /translation="MSTHRPRRIGRGEAERMLRGGPVNDGVGADPLADLLAAVAAPARD
FT                   GELDGEEAAVAAFREARLTHVTQPRRKPMIKMMFAKLLTVKVAALAAGATAIGGVAVAA
FT                   STGVLPIAGGGDSAAVSPTASPSAEVSVPAIHVPSAGASVSVSLLGLCHTYTAAAATDA
FT                   RTTLDSPNMRALVTAAGSPDKVDAFCAKALQAEIDAAATPGTTPGASASAGPDGNGVGA
FT                   QVPGAGAGVGASAGPDGAGLGVHVGPSAGVGASARPGGAGVGAQVPSAGVGANVGQGGA
FT                   GLGASAAPSVHR"
FT   gene            complement(579529..580140)
FT                   /locus_tag="Franean1_0498"
FT   CDS_pept        complement(579529..580140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0498"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: fal:FRAAL0432 putative RNA
FT                   polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09959"
FT                   /db_xref="GOA:A8KX56"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX56"
FT                   /protein_id="ABW09959.1"
FT                   /translation="MIEELDLSSAVIEAQCGDEVAFRLIYRMIQPGLLRYLRVLVGDDA
FT                   EDVASEAWLQIARDLASFRGDFDGFRGWAATIARHRALDHLRRRTRRQRDDIPVEMVTT
FT                   ELAAPDDTAGGALEAMSTEAAMRLIAGLPLDQAEAVLLRVVMGLDAKTAGRVLGKRAGA
FT                   VRTAAHRGLRRLAAQLAEQGITEAGRPEAGEHDRGDSTRR"
FT   gene            complement(580591..580881)
FT                   /locus_tag="Franean1_0499"
FT   CDS_pept        complement(580591..580881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0499"
FT                   /product="putative transposase"
FT                   /note="KEGG: fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09960"
FT                   /db_xref="GOA:A8KX57"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX57"
FT                   /protein_id="ABW09960.1"
FT                   /translation="MDVVRTPPQVPQANAIAERWVGTVRRECTDRLLIVSERHLTSVLD
FT                   SYAEHFNTHRPHRSLGQHPPDSPLVVAPTSNSTVRRTCILGGLINEYRNAA"
FT   gene            581191..581571
FT                   /locus_tag="Franean1_0500"
FT   CDS_pept        581191..581571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09961"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX58"
FT                   /protein_id="ABW09961.1"
FT                   /translation="MTTITVRNLDRSDERRDFPHGHIDVLAVGGHRLDRAVFEPGWRWS
FT                   ESVKPIAGTDLCEFDHFGYVASGRMHLEMADGTGADIGPGDVVACPPGHDAWVLGDEPC
FT                   VFVEMAEPVASDYARAPGTGQP"
FT   gene            582101..582856
FT                   /locus_tag="Franean1_0501"
FT   CDS_pept        582101..582856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09962"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX59"
FT                   /protein_id="ABW09962.1"
FT                   /translation="MGASAPPASPTEFRRPTARNRLVGLLAWLAATIAVAAVTARLAAP
FT                   DIASTGAAGLTSDIAETTLADRATVVLAQRRIEPVLSLDGRVVPSDPASDGGFDIVAPV
FT                   RPEDVAYRLIDPPRRIRAAVVGGPSGFDCEYQSLAADSGATEAGATAAAGTSVRCRIPA
FT                   SIRVVPGLSATIGIAWSEPRVTSVLPLTAVLGAAQQGQVVVVDAAGSHTSVRTVALGAS
FT                   DATWIEVSSGLAAGERVLARPVQSDLADD"
FT   sig_peptide     582101..582211
FT                   /locus_tag="Franean1_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.694 at
FT                   residue 37"
FT   gene            582849..583541
FT                   /locus_tag="Franean1_0502"
FT   CDS_pept        582849..583541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0502"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cch:Cag_0337 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09963"
FT                   /db_xref="GOA:A8KX60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX60"
FT                   /protein_id="ABW09963.1"
FT                   /translation="MTDAGTVLHMENVTRIVDLPHGAPLPVLRGVSLAVQTGQIVAVVG
FT                   SSGAGKSSLLSILGLLDTPTSGRYLCGGQDVSSLSDGQRSRLRGEFFGFVFQQFHLLDR
FT                   RTAVDNVAEPLLYGPTRGLRNRRERARQLLERVGLAERLWAMPHQLSGGEQQRVALARA
FT                   LVRSPQVILADEPTGSLDEANARVVLNLLVGIVREERRTLVLVTHDPQIAARADRVLTL
FT                   HAGRVISP"
FT   gene            583538..585370
FT                   /locus_tag="Franean1_0503"
FT   CDS_pept        583538..585370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0503"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cmi:CMM_2031 putative ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09964"
FT                   /db_xref="GOA:A8KX61"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX61"
FT                   /protein_id="ABW09964.1"
FT                   /translation="MRRRHTTAGARNGMLPIFGLGIAAWYDVRTRPLRTLAAVAGMIAA
FT                   VGALMVVDAAGVLSRHGADDYLRRQYGQPATFLISGTGSSDARRQTEADTLLTQGLDQA
FT                   GFRTISPYQLVRGITLDGDHSAAVDTAVVDGSYPDVRVIDLVAGDFPTRAADRGVPRAV
FT                   LEEGIARQLGWEPHQIVGRQLQYAVTGTAATIDTRNPRTMTVVVDAVMASTARGDSVPR
FT                   LLLVGRLPPQLHSAAEDTPGRWLARVAPADTAYFQEVVASTGRRLGSGSGFEATRLDQD
FT                   EALAPVIDQQTRTAGIVAWVAMAVGGLGMLGVGVASVRERARELGVRRALGASRATIFL
FT                   GVLVETMFNVLVAAALAVPLAALIVHLLPLPVQHGHRHIALRRRPARIGHRSAPGPLER
FT                   HHPAGRQHRRRRPSHPCLHARSRRDGGRSPRHRAGSCRPPGPDRGPERTRAGRVVAEPE
FT                   PLGHRRGGLAAHGDGAAPSVHQRACRLADHPGARRCGRCRYLYRTTVVLPAGWDTGVGA
FT                   VLLELGQVAGTMRVSVNGRSAGDDCVATRALDVRPLLRDGANHVEMEIATTLGNRLIGL
FT                   GKAGEEAYARFAKRSPRPAGLIGPVSLSGIAATT"
FT   gene            complement(585420..585989)
FT                   /locus_tag="Franean1_0504"
FT   CDS_pept        complement(585420..585989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0504"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   sen:SACE_3089 SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09965"
FT                   /db_xref="GOA:A8KX62"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX62"
FT                   /protein_id="ABW09965.1"
FT                   /translation="MMPPEFGATPWGRAWVRTVESTSTAGPNAQLPKARTLARNSTTVV
FT                   AAGAGHVEADVTVSGEVCRVRLDLPVWSDETQAEAGRLVAKAMAEHRGMVAGDLPDTLE
FT                   EDLRDHAINIAVPLEEQPGSCSCRARKRPCVHILAVIYALAQLVDERPALAVELRSATA
FT                   NAAGAGAGAVDWIALSELEPAGFYGD"
FT   gene            complement(585986..587839)
FT                   /locus_tag="Franean1_0505"
FT   CDS_pept        complement(585986..587839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0505"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: sen:SACE_3090 SNF2/RAD54 family helicase;
FT                   PFAM: SNF2-related protein; helicase domain protein; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09966"
FT                   /db_xref="GOA:A8KX63"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX63"
FT                   /protein_id="ABW09966.1"
FT                   /translation="MTELPGRLQATFVPAEDAIAWWGVVGLDDAVREHGLPEGRAGVCR
FT                   LAVAGRGGVRSASVPVRFADLDAARQGLLMLDPRAEVGASVRAWRDAVRLLDGDDEEFG
FT                   RLGARMPPAAHAVLNAEGTAITTASTLLAQFRQTLATRAALRGAVVTAELRPYQVHGVA
FT                   WLSARPGLGYGGVLADEMGLGKTLQAICMLATCRSDMPHLVVCPTSLIGNWRRELARFA
FT                   PTTPVISYHGAARKLPETFQPGTVVVTSYPVLRKDEPLAATAWGVVILDEAQQIKNPEA
FT                   LASRAAAQLSATVRIAMTGTPVENRLEELWSILNVSNPGLLGTRGRFRQRFVVPIEQRR
FT                   SATAAAALNRMVRPHLLRRTKAEVAADLPPKQYSTIVCTMADEQARLYREAVDRAFTEG
FT                   LGAGIERSGRVLALLTALKQICNHPAQYLREDTATPGRSGKFDRATEMLSEVVEQDDRV
FT                   LVFTQYRAMGKLLSRYLGTALGVGLVPFLHGGLSMQRRDELVHAFQEDDDAPPVLLLSL
FT                   RAAGFGLNLTRASHVMHYDRWWNPAVEEQATDRAHRIGQSRTLNVYTLVTGGTIEDHIA
FT                   QMHENKRGVAEIVSGDTQAALAKLSDDDLHAVLALDEGTFA"
FT   gene            complement(588041..588454)
FT                   /locus_tag="Franean1_0506"
FT   CDS_pept        complement(588041..588454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09967"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX64"
FT                   /protein_id="ABW09967.1"
FT                   /translation="MSCSVLAGVRRAADEAHANEAFGLRRPMRRPDCQASGIRPAPDVL
FT                   LALGCRPGVPSLPEPCALLGLTHAARYTTLGGAPANRKRALETKRRRLSSSWAMCISAA
FT                   APRWLFDMGGRSQTRLESGLVNGSRAAQALVMS"
FT   gene            588524..589462
FT                   /locus_tag="Franean1_0507"
FT   CDS_pept        588524..589462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0507"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: nfa:nfa14490 putative
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09968"
FT                   /db_xref="GOA:A8KX65"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX65"
FT                   /protein_id="ABW09968.1"
FT                   /translation="MTTTEEVKSSESMRSSTRQLDSLTGLRWVAALMVLVTHAAFQPGL
FT                   LPYSGTTEDIKAVVKMGGYIGVGFFFVLSGFVLTWSMRPDDTPRKFWRRRFFKIYPNHF
FT                   VTFVLAVVMMVIHDRELVGIVPNLLLVQAWSTDLDVAFGINDVSWSLSAEMLFYRTAGP
FT                   RCSSAPPARPPARPTNRPTDTDGAEMLADSSHAARMSRSDLGESMHRRAMRDRAPSEGR
FT                   VCPESTGWKGETEGVPGLGHERDRALRRPCALVRTGGARTGGLGACWVPEVGLGSVRVS
FT                   DGFGLGSIGLAVWGAGRRSCGGCRRWCGRGR"
FT   gene            complement(589386..591407)
FT                   /locus_tag="Franean1_0508"
FT   CDS_pept        complement(589386..591407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0508"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: fal:FRAAL2289 putative two-component sensor
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: GAF domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09969"
FT                   /db_xref="GOA:A8KX66"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX66"
FT                   /protein_id="ABW09969.1"
FT                   /translation="MTSVSGDARHVGAGSWAGEHVGDVEAAVLLDTLSEVVFRTDAEGR
FT                   WTYLNRAWTRLTGFEIGPSLGARFLDYVHPDELEYTVALFMGVVAGGADHCHHETRYRT
FT                   RDGSYRRVQIRANVIRDGDGEVIGNTGTIVDVTDSRRGSETIGEHVALLELVSADAPGG
FT                   ELPVGVVVYDADLRLRRGSPVIDRLAGAPQRIGDPLARLVERLAPADPRQRALGGEWGL
FT                   IAVARRTNHAQVSDLDLADPSRSLRVSVIPYLRDGEEMLALVLADITDLRRAEHRQAAL
FT                   ARLGHRAISSSDTAALVSEAAGMVTSTLDVAGCKLIHLDPRGGDAAGTSPLLDRVLTDD
FT                   QPVMIDSPVSDLARCLAGSPPGSDVATVLATRVGGAGLLFGVLAAHSTTPRHFTDDEIQ
FT                   FVQAVADILTAALERDRTDHELRRLYRRAEHSKAWLAASAHTITRVIAATEPRDALDLI
FT                   AATARTMAGTDIGVVAVPDEHGNLVITTADVAPGLPAAPDSLLGLSLTQGVTPVAEQLT
FT                   AGGTVVLDSLDLRGSRISPAPNMPIATALILPLRITRRSSAVLILGNHTDTARLPLHDI
FT                   ELIEAFAHDAALAVELIQTQHDRARLAVFQDRDRIARDLHDQVIQRLFAIGLHLQSLTR
FT                   AVGDIAAARLTSAINALDHTIDDIRHTIFDLHPIQPGQ"
FT   gene            complement(591587..592528)
FT                   /locus_tag="Franean1_0509"
FT   CDS_pept        complement(591587..592528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH2472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09970"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX67"
FT                   /protein_id="ABW09970.1"
FT                   /translation="MILLFARVSLVSRTVVTMVAGILAAALAVVSATPAGAVEPLFLGW
FT                   TSLLPPLPTAYAPADAAECAAGEPACVDATIAQMQTRYDDLVASCDHNAVFALTYLRTT
FT                   EEYRRVAAEPGFFDDVSYVNTEDAVFAAYYFQAYDTWQAGQTTAVPRAWGITFDAAQQR
FT                   RLAGAGNLLLGMNAHVNRDLPLVLASLGLITADGESRKPDHDQINVMLNRVVDPLLREA
FT                   ADRLDPSIDNIATPLGLSYTALMQILVVWREAAWRNAERLVNAPTVEARGRIVNEIEAA
FT                   AATTAVTLRTLYTRPGLLPFGQDRDEYCASHG"
FT   sig_peptide     complement(592415..592528)
FT                   /locus_tag="Franean1_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 38"
FT   gene            593665..597030
FT                   /locus_tag="Franean1_0510"
FT   CDS_pept        593665..597030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0510"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; GAF domain protein;
FT                   KEGG: fal:FRAAL4612 hypothetical protein; putative membrane
FT                   protein; putative GGDEF and EAL domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09971"
FT                   /db_xref="GOA:A8KX68"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX68"
FT                   /protein_id="ABW09971.1"
FT                   /translation="MLLVGGFWCRWAGSLFWRVTSGDDWRWIGRRPRVRGWVPAQGGPV
FT                   VEPGCRGVLSAASTFSWSVCAVRSEVVQGPKPGSRDGTDCSAERRRLRSADGGAEVKGR
FT                   GASTGGREFFCVLSLLSTGFLLLLAMVPGSPGYLRPTVVVAVGLGVVTVAAVLAVPASR
FT                   RREMALVSSAMMTTAVTIALVGAERDALALSLLFWFPWAGSYAGLVWRRFGAVMGQAAL
FT                   VAAVGLGAFSAHGRLAAFPFVGVGCALSVLACAYVTYGSLQRGRGPCFSDSVTDLTNRA
FT                   GLLQAGDPVLSEIMLAGRQALLMIVNIDHFREINTALGYEAGDEVLRMFARRLRSVRPA
FT                   PSCVGRLGGDEFALVMPGASQVADGVPAPERTDSAPADVGRAVLDQLDGRLRISGVDVE
FT                   VEATAGLAVAPWCGDRIATLLPCADAALSDARRGGERVGVWRAEMVGVQPWELALHAQL
FT                   RSAITRGELVLHYQPMQEAATGRIVDVEALLRWRHPDRGLLPPGSFLPMAERSSLIVDL
FT                   TWWELDEALRQCARWRTEGLRMPVSANLSARMLVVDELPRVVAERLAAHDLPADMLTLE
FT                   ITESALISQPARAAAMLSELRITGVKLSMDDFGTGYNSMEILKALPFDEVKIDRGFVSD
FT                   ARRSLPDAAIVRSVIDLGHRLGMRVVGEGVEDEHSERMLTELGCDLLQGEALSPPLPAR
FT                   KLPPLLASKPRVTSRSRAPAPTSTPTRAAGLPQKTPPGALQGQESAIVGEHSGEQAAAQ
FT                   VGETGIEQPAFAEATTQAKAHWTRSGLSAAVPADEEARLAALRGHHVLDTPPEPEFDAL
FT                   ATLAAQIADCTYAHVVFVDAGREWFKSCHGLRITELGARVGVASHTVASGTYLEVPDAT
FT                   RDLRFARVVRSDPNLPVRFFAGVPLRTPEGHVLGALCVSDRLPRRLAPGQRHALHQLAT
FT                   QTMRLLDARRERQTTEEITTALHTLDQLWYPDDLPTAATLTADIIRSLAGADAVAVMLA
FT                   EMPGSTVFHAAGSSVAPGTEPLLRVGIRATPDDEAALRALSHLKDAIFIPDPERTPLIP
FT                   TEMVRKLNIRSALVIPLPGEGGLLGLITVRWTHPLTCVEPSLLQAITLFATSARYTLHR
FT                   LQAACRRRGEWPPA"
FT   gene            complement(597383..597967)
FT                   /locus_tag="Franean1_0511"
FT   CDS_pept        complement(597383..597967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0511"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mkm:Mkms_5540
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09972"
FT                   /db_xref="GOA:A8KX69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX69"
FT                   /protein_id="ABW09972.1"
FT                   /translation="MARDTRERLLDAGLALFAGNGLAGTTVSGLEARAGLRAGSGSFYR
FT                   HFASKEALFEAVIRRELDRFRASISDAAPGESAIADVKVTLALEFHQALTTLDQLGGLE
FT                   AIISRDARAMGDLFDEVEGLFNAALDASTARLDQLMESGQIPRRDPQALAATIRSALVG
FT                   YHLNTQSFRRSARRVPPADLIATLIDLISSK"
FT   gene            complement(598036..598254)
FT                   /locus_tag="Franean1_0512"
FT   CDS_pept        complement(598036..598254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09973"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX70"
FT                   /protein_id="ABW09973.1"
FT                   /translation="MRDTGPLATTRPRSEGPVAVLPTERLAELYPTRDDYLRRYAEAVD
FT                   AAIAAGLALPADHESLLGFTRPVRVPQ"
FT   gene            598589..599428
FT                   /locus_tag="Franean1_0513"
FT   CDS_pept        598589..599428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0513"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: msm:MSMEG_0291 dioxygenase, TauD/TfdA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09974"
FT                   /db_xref="GOA:A8KX71"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX71"
FT                   /protein_id="ABW09974.1"
FT                   /translation="MAIEVTRLAPEIGAEISGYTGRDLVNEAAAAACKAALDRYGVLVY
FT                   REVHIEDGDLVRFSRLLGEVVVPKVNDPGEHPEIARITLDPEKSVLAGYRQGNFLWHID
FT                   GATDELPQKATLLTAREVDPAGGDTEFANTYAAYEALSDEEKAEIADLQVVHSFAIAQR
FT                   IAYPDAADKQRASWEKVPTRVHPLVWTRANGRKSLLIGATAGMVVGRSEDRGRTLLDRL
FT                   LQWSTSPRFTLRHQWRRGDLVIWDNTGVLHRALPFEPTSRRLMHRTTLVGQELVTAR"
FT   gene            599466..600350
FT                   /locus_tag="Franean1_0514"
FT   CDS_pept        599466..600350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0514"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: psb:Psyr_2186 senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09975"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX72"
FT                   /protein_id="ABW09975.1"
FT                   /translation="MVDVRLVTDARMTMGEGPVWDVDRDRLHWIDIFQAMVHQCALDGG
FT                   DPRSTKFPGRVVASLCLRKGGGAVVTSGNEIHLFDLDSGETEMIFDAGRGPGFGFNDGT
FT                   VDRQGRFVTGMADMALVKAIESGQGDLTPSGSLYRVDTDLSVHTIGDPIGVTNGPCFDK
FT                   EGTTFYCNDSVLRRMYAWDYDTATGEATDRWVVAQFEDGIVVPDGTTVDEQGCLWVAAY
FT                   DGGEIRRYAPDGTLDRRVPVPVASPTSVAFAGPELDVLVVTSRGGTTADGDNGRVLALH
FT                   GLGVRGLPESKFG"
FT   gene            600407..601156
FT                   /locus_tag="Franean1_0515"
FT   CDS_pept        600407..601156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0515"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mpa:MAP2184c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09976"
FT                   /db_xref="GOA:A8KX73"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX73"
FT                   /protein_id="ABW09976.1"
FT                   /translation="MAAKLDGKVAIITGAGSGIGRASAHLFAAEGAKVVCADFSGKEKR
FT                   TADEIGAAAVAVHVDVAVAADVERMVATAEDRFGKLDILFNNAGVAGPKMLITEQKEED
FT                   FDRVVAVNLKGVFLGMKYGIPAILRNGGGSLINTASAAGLVGWRKNAVYGASKGGVIQM
FT                   TKAVALDFADRGVRVNAICPGMTWTGMVPGSDDLLEPPASVPAPPQPMSRWGLPSELAT
FT                   AALFLASDDSSFVTGVALPVDGGYVVG"
FT   gene            601149..602132
FT                   /locus_tag="Franean1_0516"
FT   CDS_pept        601149..602132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0516"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: fal:FRAAL2800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09977"
FT                   /db_xref="GOA:A8KX74"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX74"
FT                   /protein_id="ABW09977.1"
FT                   /translation="MADARPFRFAVQTTTATSATEWRDLARRVEDLGYSTLFLADHYLG
FT                   PGPVSTQTLLRPQHLAPIAAMAAAAAWTSTLRIGCRVFCVDYHMPAALAKEAATIDLLS
FT                   DGRLEFGIGAGTNQGEYEAMGLTFHEAPQRVSKLEEVITLVKAHWSGEPISIDGDHIRV
FT                   SGYAGLPRPVQRPCPRILIGGSRKRVLSLAAREADIVSMANVPWQPRNDAGLTPAEEAQ
FT                   RRHDIVRDAAGDRFPQLELESSPYLVSVPEDVDSALAQWSARLRKAIPEAQPDLLRNHP
FT                   NVLVGSPDEITDHLQERRDRTGVNYITIPRGQIDEFAPVVSALTGR"
FT   gene            602210..603124
FT                   /locus_tag="Franean1_0517"
FT   CDS_pept        602210..603124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0517"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mpa:MAP2524c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09978"
FT                   /db_xref="GOA:A8KX75"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX75"
FT                   /protein_id="ABW09978.1"
FT                   /translation="MRIGLTGGASTPEKIIDQARKAEADGFHHLWYASVVQGDPLASMA
FT                   LAGRQTSTIELGTAVLQTYPCHPLLQAQRAASVTAAMGRPGFTLGLGPSHAGHIHAEYG
FT                   LSYDRPGKNTEDYLRIVTTLLRDGGADITGEEWSTHVRSGTVQPAHPVPVLLAALSPRL
FT                   LRVAGEHADGVILWMAPATAIEKHIEPKLSAAAKAAGRGALRIVAGLPVAVHDDESEAR
FT                   AAVAKNSTMYASSPAYQRIMAIGGADSPAQAAIAGDEASVERQLHALLDAGATDIWAQP
FT                   IPVGDDPRASLRRTRNLLAALAR"
FT   gene            603227..603784
FT                   /locus_tag="Franean1_0518"
FT   CDS_pept        603227..603784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_5301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09979"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX76"
FT                   /protein_id="ABW09979.1"
FT                   /translation="MTTPSELEELRREVRYLRDRQDILDCVNKQSRGHDRHDANLMTSV
FT                   LHEDAIDEHGPAAHIGADYGPWANKQHSEVFANHLHNITTHTCEIEGDIAHAESYVIGT
FT                   MVGRDGKTLAFMGGRYLDRLERRDGAWKIALRRCTIEWAFTANASFLHSGAFKGFLKGT
FT                   WDTTDLSYARPLQLDTGPAVRW"
FT   gene            complement(604272..605528)
FT                   /locus_tag="Franean1_0519"
FT   CDS_pept        complement(604272..605528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3800 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09980"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX77"
FT                   /protein_id="ABW09980.1"
FT                   /translation="MIFGRLSIRWIVSVAIVVVVAGCTLPGSGKERPVAVGCDSPGVTS
FT                   DQVKLGLVFSDSGIGSTALSSARSGVDARINLANAQGGIHGRRIFYQWRDDASSSSQNA
FT                   LATQDLVQQESVFGLVAATASLEGSLARLDAQGIPVVGIALPSWNRYRNLFSHLYMPSP
FT                   GTVARYIQAHGGTRIAVVTTGTVALTMETITQYKNAFSALGLAATDPIPYTSSSDSPQR
FT                   IVHQLAAIHADALIGFTAPEDLADIAQAARAANLRLNVDVSLTGYDKALLPAFGQALAG
FT                   VSIPVYFRPFEAGGPAIDRYRDAMTLYAPESIEPDQQFAMLAYIYTDLFLHGLDLAGTC
FT                   PTREGFIKALRGVTDYDAGGLISPVDLSANSTRPLDCFAFVRVNSTGTAFDVVHQRLCS
FT                   DGSESLPPGNESTPTGRSR"
FT   sig_peptide     complement(605439..605528)
FT                   /locus_tag="Franean1_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.605 at
FT                   residue 30"
FT   gene            complement(605917..606735)
FT                   /locus_tag="Franean1_0520"
FT   CDS_pept        complement(605917..606735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0520"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; Helix-turn-helix
FT                   type 11 domain protein; KEGG: fal:FRAAL2991 putative
FT                   two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09981"
FT                   /db_xref="GOA:A8KX78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX78"
FT                   /protein_id="ABW09981.1"
FT                   /translation="MPTSYVCRPHPTGARYAPKSQIDTLVVSGDSSYAESIRMNIEKTS
FT                   GFAVGAVALTGGQSIRLLTHNSYDLVILDLDLSDMAGLEVCRSIRSRSAGPDIIAVTAD
FT                   RELATVRVAVSYRVIHYLVKPFDFADFRARLHRYALFRQQVADNVTGQIGQREIDSALA
FT                   MLSPDPTAQPKAPKGLTTVTLDAIVTCLRAASTPVSSDDVARTLGISRVTARRYLERLT
FT                   QERLAIRRQRYGRPGRPEHLYCWRAGNQGPETVHMGQGARRDPENLPYRS"
FT   gene            complement(606994..608250)
FT                   /locus_tag="Franean1_0521"
FT   CDS_pept        complement(606994..608250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0521"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   mba:Mbar_A3090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09982"
FT                   /db_xref="GOA:A8KX79"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX79"
FT                   /protein_id="ABW09982.1"
FT                   /translation="MHFSAKRDFLITERRVEYPVAGRRLRIATGAAASGAALATVGIFY
FT                   LRASMHPSGLGGEAETRAMVECVLLIASVALATLAGYRVAADGMRQAYAQAWKAGIREK
FT                   DSNAHFCAREFFGRAVDRLGSENNTTRLGGIYALERIAMDSPSDQRAVVEVLSAFIRTR
FT                   STDPTLRPAVSGPVVPLRPAVDIHAAVAVLGRLSVLDGVPRADLSGAKLTGPAALHCIQ
FT                   ASYGNLSNTDLTGADLSRAHLGRADLTASRLGGTDLTGASLNEANLSYTWLGGANLTRA
FT                   RLSGADLTGASLSGADLTRAWLDGADLTGASLGGANLTRAWLTEADLTRAWLGGANLIT
FT                   AVGLVQDQIDAAYGDGWTRLPPELTRPALWTSAEADEYRPADPHQVVGQWHPEVLAGQD
FT                   NALSSRDYHHTILPKVVIV"
FT   gene            complement(608380..609036)
FT                   /locus_tag="Franean1_0522"
FT   CDS_pept        complement(608380..609036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09983"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX80"
FT                   /protein_id="ABW09983.1"
FT                   /translation="MTLGLTILLPESESLRLGPGGSLSKRLILRVDRNGARELRNAIFN
FT                   DNQTRLEGGLVKEWPRLPPSCLRQVWKQFAIVVGGILLALLAAANLPGPSARPAGIGAS
FT                   GVMPGASANATDRIPQLLRRYAQTAVPSLPSDAAPTRATRATVVVPNVVGLDLRTAEGL
FT                   LFPSLLPSAIDDPAWRGRRTVGPRWVVVTQKPVAGSQVPALTTIDLYAVEPRESD"
FT   gene            609387..610772
FT                   /locus_tag="Franean1_0523"
FT   CDS_pept        609387..610772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0523"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; KEGG: fal:FRAAL3306
FT                   putative serine/threonine-protein kinase PkwA; WD40
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09984"
FT                   /db_xref="GOA:A8KX81"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX81"
FT                   /protein_id="ABW09984.1"
FT                   /translation="MQRYCTGQSVPVEFGTIERVARVCGADGDEIARLFRLWETAASIS
FT                   TSAGIELPTAGGDHEHTNPVEGVEYSTSPVSLVPPALAAADDSAPRPATQNEHSRLRGA
FT                   RRAGWRWNRRSISATAIIVVLFSSAVGTVLVLAMILAREPGVRPLGRPLADQAGWALST
FT                   AFSPDGKVMASSSRKGGVWLWNMADPATPVRIDPALTGPRDGVTSLAFSPDGSLLAGGS
FT                   WDGSIWLWDITDSGASKPAGRALTDDSGPIWSVAFSADGRTLASGSDDTTVRLWDMTNR
FT                   ARPWQFVRLSSDMEFVTSVAFSADNRLLVAAGFSRTIAIWDMADRGAPKRLAQSLSTPA
FT                   TTYVAAFSPNGRLLATGSTDGLVRLWDLAVPEDPHPIGRPLTGHTNRVWSLAFSPDGGT
FT                   LASSGFDNSVRLWDVTDLSNPEPIGAPLTGYQGWVLSVRFSPNGRVLASTSSDSTIRLW
FT                   SLP"
FT   gene            611023..611974
FT                   /pseudo
FT                   /locus_tag="Franean1_0524"
FT   gene            complement(612581..612922)
FT                   /locus_tag="Franean1_0525"
FT   CDS_pept        complement(612581..612922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0525"
FT                   /product="putative lysyl tRNA synthetase-like protein"
FT                   /note="KEGG: fal:FRAAL5690 putative lysyl tRNA
FT                   synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09985"
FT                   /db_xref="GOA:A8KX82"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX82"
FT                   /protein_id="ABW09985.1"
FT                   /translation="MAQKTVVSLIDDLSGETADETVRFGLDGAQYEIDLSETNATKLRE
FT                   ALASFVTAGRRSGGRAGSGRRGVRASSPRSASADRTADIREWARSNGYTVSDRGRIAST
FT                   IVEAFDKAH"
FT   gene            complement(613260..613889)
FT                   /locus_tag="Franean1_0526"
FT   CDS_pept        complement(613260..613889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_1518
FT                   endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09986"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX83"
FT                   /protein_id="ABW09986.1"
FT                   /translation="MWCPGGAGVLPRGDAPQRHPRNRPGQLPDPHRANMGGVREPLAVP
FT                   VRGQYESAGYRAIAGETLAYFHQRVREEHGQDTAALAMGDFNDEPFDTSLVAHALSTRQ
FT                   ATRVINADTPRFWNLMWPAAGAPGGTFYFQNEPNLLDQFLVNATMARPTSPLHANPDSV
FT                   QILRFPELVHTGDYPRPRPFGGMGAAVDETGYSDHFPIAMTVTETD"
FT   gene            614022..614954
FT                   /locus_tag="Franean1_0527"
FT   CDS_pept        614022..614954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0527"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: sma:SAV4144 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09987"
FT                   /db_xref="GOA:A8KX84"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX84"
FT                   /protein_id="ABW09987.1"
FT                   /translation="MNRSGAPWPCHCGPHDPVVAVAPLLRTPALLGCVALGAAGAGGLV
FT                   AAVAAGTTGPGNAPGTAAVEAAMFYAYTVVLVALTYRVSTWMLGVVWEIDRSRAAHASL
FT                   AVAEERLRFARDLHDVLGYNLSLMAVQSELAARLADLGAELAGAQSLLRSAGVACQVTG
FT                   AASRDGREQALPPSAQAALGWVVREATTNVIHHSEATTCAIDLEVRDGPGHARTAVLRI
FT                   TNDGVPPVPAGATRPGGSPPAPGAGSGLAGIEERLAGLGGVLTAAREPGGSFVLEARLP
FT                   VPADAAHGAAPVGTPPPARGAAIVLEAGS"
FT   gene            614951..615556
FT                   /locus_tag="Franean1_0528"
FT   CDS_pept        614951..615556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0528"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70 region 4 type 2;
FT                   KEGG: sco:SCO4072 LuxR family two component system response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09988"
FT                   /db_xref="GOA:A8KX85"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX85"
FT                   /protein_id="ABW09988.1"
FT                   /translation="MIKVLLADDENLIRGALAVLLSMEDDITVVAQAASGPEALATARL
FT                   HRPDVALLDLQMPGLDGIAVAQALHADLPACANVIVTSHGRPGYLRRALAAGARGFLPK
FT                   TVSVQVLADVVRVVHGGGRYVDPELAAEAIAAGDSPLTPREAEVLELAAGGAPVEEIAA
FT                   RLSLSRGTVRNYLSSAVAKLGAVNRHEAVQLARVRGWI"
FT   gene            complement(615599..618124)
FT                   /locus_tag="Franean1_0529"
FT   CDS_pept        complement(615599..618124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0529"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sma:SAV3635 putative ABC transporter integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09989"
FT                   /db_xref="GOA:A8KX86"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX86"
FT                   /protein_id="ABW09989.1"
FT                   /translation="MIRLVWHTVRARKGSLVGTFVALTLGVALLAAMALTLVSSVGGGG
FT                   GRPTWYVDADVVVAGGGIVSVTTGSGEDRETASLRTATARGLPSGLRDRLAGLDASLVL
FT                   DFAAYATAPGAPGDTVRPWSAAALHAYGWVAGGPPRGARDVVLSAPTAHRPGAEITVVT
FT                   GRGVERFVVSGVLRTDAPAALYTADAVAEELADGRVAAVALNAPGAGPAGASTPAVMSL
FT                   ADAARAVVGDTALEDGSVQVLTGDDRRRAEPDPDAERRTEAVALLAATTGLAGFVSIFV
FT                   VSGTFAYAVTARRREFGLLRAAGATPRQVFRIVLGEALTVGVLASLAGGALGAAIAPDF
FT                   AARLARTGFVPSDFTARFVFWPVAAAFGTGLGVALLGAWVAARRAGRVRPVEALRDAAV
FT                   DRRPMTTARALAGLLALGCCVPLVAVLVANPSADAVALIMITALFLIVACAMFAPLVVP
FT                   PLVSLLSAPLSGSSGAVGLLAGHGARAAVLRTAATAAPILVTVGIAGSTLTGLGTLQAA
FT                   TQNAARERITAEALTMPVTGKGLPDASVAALREVPGVSAAVPVTESRVYVRDGDEPEGW
FT                   TGYYASGADLAAVLDVPLVAGSLADLAGTDTVAVPEGRWELGETAELWLGDSTPARLRV
FT                   VAVFERQLDLSETVLLPSRLRDRHALPGADVVYLRLAPDASLEQVRAAAAAGAGTVVDT
FT                   GSYLSAAGEEEARVNRQASVAMLGLSLVYTGIAIANTLVMATRDRAREFATIRLAGATR
FT                   RQVLWVVGTEAVLVTCIGVLLAAVVTAVTALGARHGLADIAPSVPLAVPWAPLAGIVLA
FT                   CLVTAVLASVIPAALLLRRRPAELAGVRE"
FT   sig_peptide     complement(618020..618124)
FT                   /locus_tag="Franean1_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.593 at
FT                   residue 35"
FT   gene            complement(618121..618954)
FT                   /locus_tag="Franean1_0530"
FT   CDS_pept        complement(618121..618954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0530"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV3634 putative ABC-transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09990"
FT                   /db_xref="GOA:A8KX87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX87"
FT                   /protein_id="ABW09990.1"
FT                   /translation="MTAAVALRGVSKVYGRRTAAVTALDDVTLAFVCGTFTAVMGPSGS
FT                   GKSTLLQCAAGLDRPTAGEVFLDGENLARLSENALTVLRRDRVGFVFQAFNLVPSLTAE
FT                   LNVALPLRLAGRRPRRREVREVLEAVGLADRGRRRPAELSGGQQQRVAIARALVTRPSV
FT                   LFADEPTGALDSTTGREVLTLLRGLVDRDGQTIVMVTHDPVAASHADRVVFLADGRPAG
FT                   ELRDPTPRTVAARLAGLEPVAEAAEAAEATAAAVTRARAGEPPSGRLTGPVGERP"
FT   gene            complement(618951..619637)
FT                   /locus_tag="Franean1_0531"
FT   CDS_pept        complement(618951..619637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09991"
FT                   /db_xref="GOA:A8KX88"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX88"
FT                   /protein_id="ABW09991.1"
FT                   /translation="MSTLASSTGPARGRGHAAAWWFALSAVAIALFAPLPYLTTSLTAL
FT                   AEQDSDLALNYVDRPTPIQIAFYLHVALGGLALLLSPVQLSARVRARAPRLHRTAGRIT
FT                   LSAILVAGVAGAVLSSVNLAGPVGTAGFGLLALLWVSFAVAAWRAIRHRDVPAHRRWAL
FT                   RAFALTYAAVTLRLWLGVLIATQTGLAGTDADVAFGRAYHVVPFLCWVPNLLVAQWFLT
FT                   RREVSA"
FT   sig_peptide     complement(619497..619637)
FT                   /locus_tag="Franean1_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.688 at
FT                   residue 47"
FT   gene            619891..621204
FT                   /locus_tag="Franean1_0532"
FT   CDS_pept        619891..621204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0532"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: sma:SAV5604 two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09992"
FT                   /db_xref="GOA:A8KX89"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX89"
FT                   /protein_id="ABW09992.1"
FT                   /translation="MASRPRSRSRWAVSSAMVASDVLSVPPGPLPREGAASPGARPGHP
FT                   LWRARPYRADVWLAIGLAVATITVTLVSSGRAPYHPPDAVTAALAAVSALALAWRQAAP
FT                   LAAMAVTSTIVAVNAAAGYAVVAVQWPAWLALFGCFSVGGRGVRIASTALCVMAVGGYA
FT                   LFDRGALTVEDMAGITMSFLIATVGGDAARSRRAVAAAQHAQVRGEAREQALAAERLLH
FT                   EERGRLAGELHDALGHTVNVMVLQAGVARRLFAENPAFAQQALADIENVGREALGELDR
FT                   MLRVLHPVQDPRQGDGGLDVSDDDPDDAHGQAGAQGLAALADRIRATGREVDLDAEPVD
FT                   LSAGSERVLYRIVREALTNAVRHTDTGRIRVRVSRVADQIRVEVFNEGAGFASPVPGRG
FT                   LIGMRERARLEGGSFEAGPVEGGFRVLATLPTHPATGS"
FT   gene            621210..621869
FT                   /locus_tag="Franean1_0533"
FT   CDS_pept        621210..621869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0533"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; sigma-70 region 4 domain protein; Sigma-70 region
FT                   4 type 2; KEGG: tfu:Tfu_0767 regulatory protein,
FT                   LuxR:response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09993"
FT                   /db_xref="GOA:A8KX90"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX90"
FT                   /protein_id="ABW09993.1"
FT                   /translation="MLLADDDGLVRSGLRALLDAEPDICVAAEAATGEEAVLAARSYRP
FT                   DVVLMDVRMPRRDGVWATSQITSWPHPRPRVLVLTTFDVDKVVEDALAAGADGFLLKRA
FT                   TPEQLIDGIRVVAGGDALVAPAVTRRLLVTLARRRVPDRELLTRADQLTDREAEVLRAL
FT                   AEGRSNTEIAAVLNLSVETVRTHVKRILSKLGVRDRTQAVVWAYRAGFVDMTAPGP"
FT   gene            complement(622204..622494)
FT                   /pseudo
FT                   /locus_tag="Franean1_0534"
FT   gene            622605..622970
FT                   /locus_tag="Franean1_0535"
FT   CDS_pept        622605..622970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09994"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX91"
FT                   /protein_id="ABW09994.1"
FT                   /translation="MGVSPHPRRTSSARHQDRTLHRVVDLERATVSSPSPNATTPPGPP
FT                   SYDPRHVRVLGATAHPTAAWVTQPARHQAMDPEDAGAQAKYLTRDRGSAFRWHTHHHAA
FT                   RHHHVAHLPVRSADEAP"
FT   gene            623083..623922
FT                   /locus_tag="Franean1_0536"
FT   CDS_pept        623083..623922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0536"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL2957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09995"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX92"
FT                   /protein_id="ABW09995.1"
FT                   /translation="MSDTPTGHRRWKTLVDKVDRAELRTDAPHSARMYDYYLGGKDNFP
FT                   ADREGAEQAIAVFPTLRDAARENRAFLVRAIRYLASEVGIRQFLDIGTGIPTSPNLHEV
FT                   AQGIAPDARVVYADNDPIVLAHARALLTSTPEGRTVYLDADVRNVDQILAAPALRDTLD
FT                   LTRPVALSLLAVLPFVEGDAPYAIVRSFLDALPAGSYLVLSHGTADLDPSARRIETSYR
FT                   ERGLECQFRSRAEVERLFDGLTLVDPGVQVIHRWRPDGTAEHLSDAEVCGYCGVGRK"
FT   gene            624519..624797
FT                   /locus_tag="Franean1_0537"
FT   CDS_pept        624519..624797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09996"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX93"
FT                   /protein_id="ABW09996.1"
FT                   /translation="MDRWHKAGGAPAGRPVALHDYLGLGPIEYALWVERPSSLRFVTEA
FT                   RRAGRRVDDITGLASIAVEEANDDDAEAQRLVAWLRATRRIPTDHTG"
FT   gene            complement(625110..625553)
FT                   /locus_tag="Franean1_0538"
FT   CDS_pept        complement(625110..625553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0474 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09997"
FT                   /db_xref="GOA:A8KX94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX94"
FT                   /protein_id="ABW09997.1"
FT                   /translation="MGVPADPGELLKLGHRVVDFFHVDCAVTLRRLYCFFVLDVGTRTV
FT                   HILGVTTHPDGPWTTQQARNLLMDLGARAADFQVLVRDRAGQFTASFDAVLAGAGITAV
FT                   KIPPRTPRTNAYAERFVRTVRTEVTGPACDGWVAMPPRSLPRT"
FT   gene            625581..625838
FT                   /locus_tag="Franean1_0539"
FT   CDS_pept        625581..625838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09998"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX95"
FT                   /protein_id="ABW09998.1"
FT                   /translation="MRVAISVLTGGRPVLWGWVHFRVIRRRCHRRTVPGVTGRCARSVL
FT                   GRTLISAASTARSAQSQRGLGWVRRSTATSCRRQTSGSDR"
FT   gene            626232..626450
FT                   /locus_tag="Franean1_0540"
FT   CDS_pept        626232..626450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABW09999"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX96"
FT                   /protein_id="ABW09999.1"
FT                   /translation="MTIFEALTTGLNDTDRNLTLDVIRQSFDDGQAAARQGRPHRNVEE
FT                   ITRRRRSAQSSRPTVVGDRAEAARCGA"
FT   gene            626542..627879
FT                   /locus_tag="Franean1_0541"
FT   CDS_pept        626542..627879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0541"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="PFAM: GAF domain protein; Stage II sporulation E
FT                   family protein; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: fal:FRAAL5352 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10000"
FT                   /db_xref="GOA:A8KX97"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX97"
FT                   /protein_id="ABW10000.1"
FT                   /translation="MDNAPAPEGTGPARDAGPDQAASVLLRAEPEEPFDRLTRLAAVML
FT                   GAPFAFVMAMDDGRSYWKSRAGTAAGDLTGRQIAAADSLCRLAVGTGLPLVVPDAGRDD
FT                   RVRGDSLVRSAGIRAWASFPLRDPSGRTLGAFGAADVRPRLWTARDLELLETLAQAVSG
FT                   EIALRHVAAAATALARTLQQSLLPPEVPEIPGLEVSARYRPAGEGAEVLGDFFDVFQTG
FT                   RTSFGVVLGDVAGKGVEAAKVTALAHYTIRAAASRTRDPAAILNQLNRALLTQHPDSER
FT                   FLTVAYMAVDRSRRNRTLALCSAGHTPVLLRGRDGTVTPIGSHGLVLGVFEDPELTTSR
FT                   PRFGPGDTILLYTDGVTEARRGNDQYGDDRLRALLAATDPAAGRLTATIEAAVLDFADG
FT                   PPQDDIAILAIHFPDISSVAMKTVRSRLRSRRRPRRPFTRRGTPTV"
FT   gene            628130..629374
FT                   /locus_tag="Franean1_0542"
FT   CDS_pept        628130..629374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0542"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fal:FRAAL1700 putative phosphatidylinositol
FT                   alpha-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10001"
FT                   /db_xref="GOA:A8KX98"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX98"
FT                   /protein_id="ABW10001.1"
FT                   /translation="MPLRYGFLSTYPPTQCGLATFTAALFDELNSPAPGASSGVVRLLD
FT                   ATDRAGVVRAGATRAGATAEPAEPVARPPGRSGGAGRPVLVGDLVAGTPGGPRAAARLL
FT                   NGFDVVVVQHEYGVYGGPDGDEVLAVLDALDVPVIVVLHTVLVKPTSHQRHVLESVVAS
FT                   ADAVVVMTETARIRLVEGFQVHPRRVVVIPHGAADNRRAPAEHSGGPTILTWGLIGPGK
FT                   GIEWGIAAMADLADLDPAPHYVIAGQTHPKVLAREGEAYREGLAARVRDLGLTGSVSFD
FT                   DRYLDPVSLTELVRQADVVLLPYDSVDQVTSGVLIEAVAALRPIVATRFPHAVELLGDG
FT                   SGLLVPHRDPAAIAAAVRRITTDETVSAGLASAAAVQAPDLLWPAVAGRYRRLAAGLVA
FT                   RTGSRPSTAPVPVAR"
FT   gene            629371..630387
FT                   /locus_tag="Franean1_0543"
FT   CDS_pept        629371..630387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1701 hypothetical protein; putative
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10002"
FT                   /db_xref="UniProtKB/TrEMBL:A8KX99"
FT                   /protein_id="ABW10002.1"
FT                   /translation="MSSAISFDHLFRLTDDIGLFEHALGSVPRREHGYCVDDVARGLVV
FT                   LTREPSPGVDLVRLLERYLAFVLAAQAVDGAVHNRRDSDGRWRDDPGLGDCWGRALWGL
FT                   GTAAASAPTRRLRASARAGFLASAGRRSPWPRAMTFAALGAGEVLLAHPDDEPARALLT
FT                   AAVEVIGPVGANPGWPWPEPTLRYANGAVPEALILAGMCLPDKVVLADGLRLLAWLLQV
FT                   ETRDGNLSPTPVGGRRPGGDPGPGFDQQPIEAAAIADACARAHAATGRKRWLTGLGRAH
FT                   GWFLGDNDSSMALLNPDTGGCYDGLEPGGRNLNQGAESTLALLSTTQHARRLLASTP"
FT   gene            630384..631904
FT                   /locus_tag="Franean1_0544"
FT   CDS_pept        630384..631904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0544"
FT                   /product="glycosidase PH1107-related"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   fal:FRAAL1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10003"
FT                   /db_xref="GOA:A8KXA0"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA0"
FT                   /protein_id="ABW10003.1"
FT                   /translation="MIGSTRTTAAGSAQNDLVTRHPLGLSPNSDRVIAKLFLPGEEGSQ
FT                   PHSRAAGIVARALALPEREVDSLVADLLERFEPRHRDYRGILARHAAVVTPRVPVPAEL
FT                   SPARCLLLGACFTAEYAVEGAAVTNPSAVPHPDQTGLPSGALRLALSLRAVGEGHLSSI
FT                   GFAVAVIGPGPAVRLESRTGPLTTGVAVPVEWEAARLRAVLTEHGLDDEVTRAVLQSLD
FT                   PRRPGSEPDPDLSRAFAAVPPDLLRRPQAPGILAGIRSIAGSLRRVEFPPDSALPQRVL
FT                   WPTVTSESNGMEDARFVRFTAPDGTADYRATYTAFDGTDISPRLLTSPDLRVFTTAPLT
FT                   GPAARNKGMALFPRLVDGRHLALCRSDGESTGLTASDDGQVWGPARPLHGPRVAFELLQ
FT                   VGNCGSPVETSAGWLTLTHGVGPMRTYTIGAILLDLDDPGRVVAALPEPLLAPTGQEST
FT                   GYVPNVVYSCGSLIHHGLLWLPYGIGDTRIGMASVPVDRLLARMVPVG"
FT   gene            complement(631927..632940)
FT                   /locus_tag="Franean1_0545"
FT   CDS_pept        complement(631927..632940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0545"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fal:FRAAL1703 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10004"
FT                   /db_xref="GOA:A8KXA1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA1"
FT                   /protein_id="ABW10004.1"
FT                   /translation="MRIAILAPVAWRTPPRHYGPWEQVASTIAEGLVEHGVDVTLFATL
FT                   DSVTAGELDGVCPHGYAEDPSLDGRVWEALHVAHALARSSEFDLVHNHLDWLPLAFAPS
FT                   FQAPMVTTIHGFSDPRIVPAYARAASAYVSISDADRSPELKYVSTVHHGVDLDELPFSA
FT                   AGGDDLVVLGRVHPDKGTAVAVDIARHAGRRLVICGIVQDERYFAEQVLPHVDGDRVRY
FT                   LGSVGPAQRAEVLGSAAALLHPIAFDEPFGLAVVEAMACGTPVVAYPRGAMPEVVDEGV
FT                   TGFLVDGPVAAAAAVDRAAALDRAACRAMARRRFSTARMVADYLAVYAGVLADPVL"
FT   gene            complement(632937..633494)
FT                   /locus_tag="Franean1_0546"
FT   CDS_pept        complement(632937..633494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10005"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA2"
FT                   /protein_id="ABW10005.1"
FT                   /translation="MAAGQMISFLDRADFARFDDDGGAPTRLRVASADACPEAPTGDRG
FT                   LRLSLAPAGGRGSFDGVWWPHSRRLDREAPALVAALSAAGHPISRLAVNGDVWTGIPRR
FT                   LSQPTRPPVRISWFRTLDPHTVTLDGGNRPRFFLLVIPPDTAADVAADALRMAAAGGLS
FT                   GPSGQILRHAGAVPLGARSGAP"
FT   gene            633885..634436
FT                   /locus_tag="Franean1_0547"
FT   CDS_pept        633885..634436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10006"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA3"
FT                   /protein_id="ABW10006.1"
FT                   /translation="MLASTKSARRKELGGLFSDTVVDSQQSPHRCPPARAPHGAQNVEF
FT                   HDPSRAHRRREPIRCRGRRDRFQPGRDPDTAGPPSPDRHEHRRDGRIRSTAGLSAGRPP
FT                   GAAPLPAARPSAPARIPRGACYRRRSPAVNVSSPPSFTTARCAPDGSWPICAVADTAYR
FT                   TAEQLLASVEPADKAATPTD"
FT   gene            complement(634760..636262)
FT                   /locus_tag="Franean1_0548"
FT   CDS_pept        complement(634760..636262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0548"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fal:FRAAL0341 putative MFS transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10007"
FT                   /db_xref="GOA:A8KXA4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA4"
FT                   /protein_id="ABW10007.1"
FT                   /translation="MTNSPTRSPARSGGRLALIAFAQLIIALDYNIVYVALPEIGADLD
FT                   FSAQSLQWVVSAYAVGFGGLLLFGGRAVDRLGARRIFLVAVAIYGVSSLAGGLAPEPGL
FT                   LVAARALQGIGGALLFPAILTLIYSGFVEGAERNRALAVWGAVGSGGLAAGSLLGGLFT
FT                   DWWGWESVLFVNVPLALIALLAAPRLLPADAPVKRGVKAFDVPGALLATAGSSLIVFGL
FT                   ASGPESGWTSVRALGTIVIGGVLLVALLVTEARTPDGLLPLRLVRTRTLATTMAVAFLF
FT                   MGTLATGYYVLTTYLQPVLGYSPTEAGLAFLPVCVFSMIGGPVTAVLLNRFGIRATLAG
FT                   ALMTNGGGVALVCVVMAVDGSFWSMLPGMVLWGLGGGVGFTATFAAAGMGVAPMEQGVA
FT                   SAVASTSQQIGGAVGLAALIAVANHGLDYNAVPGPTLDEIVDGLRWAGVLAGALSVVGG
FT                   FVALILKSGKATAAAVGEEPAGDEDEQVTASGTADEAIVTAQ"
FT   gene            complement(636420..637109)
FT                   /locus_tag="Franean1_0549"
FT   CDS_pept        complement(636420..637109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0549"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: afm:AFUA_2G13050 arylesterase/monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10008"
FT                   /db_xref="GOA:A8KXA5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA5"
FT                   /protein_id="ABW10008.1"
FT                   /translation="MTFALDPQLAVAIAPFLAAAPEVEPPPVGGWKTRRVSVEAELYDP
FT                   WVARYVSATGVPMLSVEYRLAPEHSHPTPAEDCYAALRWLADHAVELGVDPARIAVMGD
FT                   SGGGGLAAAVALLARDRGGPVLARQILIYPMLDDRNTTPDPAIPPYAAPARADDLTGLP
FT                   PAYVEVGELDIFRDESIEYARRLAAAGVSTELHVHPGAPHGFDALGPETDVGRRATADR
FT                   VRVLTGL"
FT   gene            637442..638293
FT                   /locus_tag="Franean1_0550"
FT   CDS_pept        637442..638293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0550"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL3443
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10009"
FT                   /db_xref="GOA:A8KXA6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA6"
FT                   /protein_id="ABW10009.1"
FT                   /translation="MRRPYLVYRPISVQCLVSMQSTIQARRTMSSVGEQTPGRRARLRA
FT                   QTTAEIQAIALRHMAEGGPDAISLRAIAREMDMSGSAIYSYFATRDALIARLINDVYTS
FT                   LMDEVEIARDALPPDDIAGRILALGQAVRRWSVANPERFRLIYDHPAPGHHAPGDGSTF
FT                   DAAKRACLALTELVAAAWPHAEPVQPVGDHQWSDFAPDLVTAVRDAFPELPPAGVALAM
FT                   RVWGRMHGLVALEVHGHLGLLTNDPAELYRVELLDLIRSLGLGQDIDRPGISKPASRTP
FT                   PH"
FT   gene            638310..638540
FT                   /locus_tag="Franean1_0551"
FT   CDS_pept        638310..638540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0551"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: stp:Strop_0353
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10010"
FT                   /db_xref="GOA:A8KXA7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA7"
FT                   /protein_id="ABW10010.1"
FT                   /translation="MAKKREGDPLAALTERERKVLDIMAQGHSNSALSTELCLSGKTVE
FT                   AHVRSIFTKLNRPPDASAHRRVLAVLAFLRS"
FT   gene            complement(638792..639175)
FT                   /locus_tag="Franean1_0552"
FT   CDS_pept        complement(638792..639175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0552"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   stp:Strop_3106 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10011"
FT                   /db_xref="GOA:A8KXA8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA8"
FT                   /protein_id="ABW10011.1"
FT                   /translation="MNRGVLDTSVLVATDVTPIPGELAVSVISIAELQFGILVAKTPQA
FT                   RATRLARLSTIQRRFDPLPIDDAVADSYGRLAARVVEAGRQPRARTMDLLIAATAHAHG
FT                   ASIYTRNAADLAGLEDLLRIVTI"
FT   gene            complement(639172..639420)
FT                   /locus_tag="Franean1_0553"
FT   CDS_pept        complement(639172..639420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0553"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   stp:Strop_3107 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10012"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXA9"
FT                   /protein_id="ABW10012.1"
FT                   /translation="MDEIGLREVRQNASDLVRRAQAGERLTITVAGRPAAVLGPVSPRV
FT                   WRHWDDLAELFAQPEDTDWPEDRNLVDGSLTDPWESR"
FT   gene            639570..640046
FT                   /locus_tag="Franean1_0554"
FT   CDS_pept        639570..640046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10013"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB0"
FT                   /protein_id="ABW10013.1"
FT                   /translation="MVLDLDGLTPRALGTFERLDVCLQAEARRLRRPPNNRGGDGVSLP
FT                   GQLLSQVLQRLRRPPQRRLRVTPLVRLDQPQQHFQRGRVVLLDPLAVTARRTDTTTRQR
FT                   SGARFQLRHPPTRGGLAHLGRSARRRVHRHVRAAGPPWPGPTSATPMPMAGSDL"
FT   gene            complement(640412..641632)
FT                   /locus_tag="Franean1_0555"
FT   CDS_pept        complement(640412..641632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL3467 hypothetical protein; putative
FT                   signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10014"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB1"
FT                   /protein_id="ABW10014.1"
FT                   /translation="MFLGRLSARLLGGAAAAILTVAVTGCSASGDGGKAEAAACNSPGV
FT                   TANQINLGLVVTDSGPGSAAFDSARSGVDARIGLANQEGGIHGRRIVYQWRDDANSPPQ
FT                   NANVTTNLVQQDSIFGLVTATAALGDSLDGLAAQKVPIVGFAQPDWGKYQNFFTYLYAA
FT                   SPDTIGRYIQASGGTKVAFVTTGASAFTLQVMARYQAAFQAIGLGTTDAISYASSTDSP
FT                   ARVVQQISAAGADSMIGFTTSGDFAAIAQAARAAHLDLSSSVALTGYDHSLLATLGPAL
FT                   SGVSFPVYFRPFEAGGAAIDRYRAAMARFAPETFVPEQQFAMHAYIYTDMFLRGLELAG
FT                   SCPTREGFISALRKVSDYDAGGLIAPIDLSNNASQPLNCYAFVKINPAGNAFQVVHERL
FT                   CADGTGT"
FT   sig_peptide     complement(641546..641632)
FT                   /locus_tag="Franean1_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.467 at
FT                   residue 29"
FT   gene            641796..642038
FT                   /locus_tag="Franean1_0556"
FT   CDS_pept        641796..642038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10015"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB2"
FT                   /protein_id="ABW10015.1"
FT                   /translation="MSCSVESGDGTAGPPPSAFPAPPAHRSLSRLLCWRKFGRPGSGHD
FT                   PFRWAAQPPAHLCSKAGDWITGQTMVVDGGWIKRL"
FT   gene            642145..642372
FT                   /locus_tag="Franean1_0557"
FT   CDS_pept        642145..642372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10016"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB3"
FT                   /protein_id="ABW10016.1"
FT                   /translation="MCCVDLICVAARAGHGRKEQVGRLPALVPVSYMTRMARWRAVSAR
FT                   QDGRGIVGRGPSMTSVSPEFRSSWAHSEDR"
FT   gene            642386..643735
FT                   /locus_tag="Franean1_0558"
FT   CDS_pept        642386..643735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0558"
FT                   /product="transposase"
FT                   /note="KEGG: gka:GK3116 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10017"
FT                   /db_xref="GOA:A8KXB4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB4"
FT                   /protein_id="ABW10017.1"
FT                   /translation="MLMNLGRVDRVDMDGLLRLAASIRAHFGDGGPDAAGSGDAGLAAG
FT                   TGPMEVVDARPVGATWLLDGLWRELGVAAALEKGVADRRFTTAVERVLFALVANRAVEP
FT                   MSKLSAAEWASEDVVVPGLNSMDDDQAYRAMDLLVEADVAGAVQEAVFFSVAHLLNLEA
FT                   DLLFFDTTSTYFERDTEEDDQAGADGEVSPGFRKYGKSKDHRDDLPQVVIGLAVTREGI
FT                   PVRVWCWPGNTSDQTVLAQVKDDLRSWKLGRVVTVVDRGFSSAANLAYLRRAGGHYLAG
FT                   MRMRDGNPLVDTVLAHQGRYQTVRDNLRVKEIKLPEAGDTRFVLCYNPDEAVCDQAKRE
FT                   AAVQRVEDELARVRDQRKRDRDRQLTPAARERVEAAHLRAECALRDHPSLGRWVRQTPT
FT                   GRLALDRAKVKAEAGWTASTCSPPPTRTCPPKTPPWATRTSSKPNAASVT"
FT   gene            643732..644034
FT                   /locus_tag="Franean1_0559"
FT   CDS_pept        643732..644034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0559"
FT                   /product="transposase"
FT                   /note="KEGG: gka:GK0888 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10018"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB5"
FT                   /protein_id="ABW10018.1"
FT                   /translation="MKSELLLRPVFHRLEHRIRAHVLICWLALLLVRVAERRTGQTWRT
FT                   LRRQTGRIVQVTLAGPAGTVAQTTTLTPAQKALYQAVSVPGTTSVMRSGPGVSSL"
FT   gene            complement(644304..644507)
FT                   /locus_tag="Franean1_0560"
FT   CDS_pept        complement(644304..644507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0560"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: sco:SCO4505 cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10019"
FT                   /db_xref="GOA:A8KXB6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB6"
FT                   /protein_id="ABW10019.1"
FT                   /translation="MAQGTVKWFNGEKGFGFIAQDGGGPDVFVHYSAIDSAGFRSLDEN
FT                   QRVEFDVTQGQKGPQAEHVRPV"
FT   gene            complement(645162..646802)
FT                   /locus_tag="Franean1_0561"
FT   CDS_pept        complement(645162..646802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0561"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: fal:FRAAL5548 hypothetical
FT                   protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10020"
FT                   /db_xref="GOA:A8KXB7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB7"
FT                   /protein_id="ABW10020.1"
FT                   /translation="MGDAAIAPAEQPRAALSRGRAGRGFWWAVTICLLLVVASAIVAVI
FT                   LPDRAALLTIRLAMMLCLLLGGVTCVVTGLRRGGADRAWRLLVAVMVLSICAGSAAIFL
FT                   DTVAGAPPVPRQTPVSLIYLIPQAFGLAGVLRYPSDPLDGSSREPGRGRDRHWYVITIL
FT                   DGLIVVGAITLLAWIAVLEEAVEGKGPLAAGPIYSIILAAASLVVTVAVFLVAVFRQPR
FT                   PGLGLELGLLTLGLLTVTVSIICYTAVVVRGLRDVPRLVDLIQLAGPLFIGLAALSPDT
FT                   SQSTRNAGPDADRPFVPARRRWWHAVLPYLPLTAAGIATVIEASGGDIARQEEVWAMLA
FT                   LLLIALVRQMVTMADNIRLLSQVEEKQHELRYQAFHDPLTGLANRTLFIDRLALALRHR
FT                   DQPAGRLAVLFCDLDNFKRVNDAVGHAAGDDLLRITARRLVNNVRPSDTVARLGGDEFA
FT                   IILDPVVEDPEMVGRRLAASVRAPIDLEGTTYTIATSTGLVVVDPASEPPTAETLLHRA
FT                   DLAMYAAKARRTGDPTAYTPDLAPGRPTL"
FT   gene            647077..647499
FT                   /locus_tag="Franean1_0562"
FT   CDS_pept        647077..647499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_0724 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10021"
FT                   /db_xref="GOA:A8KXB8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB8"
FT                   /protein_id="ABW10021.1"
FT                   /translation="MLAALIGVTTSAVQAGAMRGVVWAAQGLRVSARNALLADIVPAAY
FT                   GFEWTMDNLGAIVGPLLALGLLSLVSVRTAMLLSVVPGLLASVQAVGNIAASVVAGLLY
FT                   TVASPTLAFSYLAVWMVLALTALLWATRNTAVHGDQ"
FT   sig_peptide     647077..647151
FT                   /locus_tag="Franean1_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.863 at
FT                   residue 25"
FT   gene            complement(647569..647967)
FT                   /locus_tag="Franean1_0563"
FT   CDS_pept        complement(647569..647967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0563"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: fal:FRAAL3368
FT                   putative ArsR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10022"
FT                   /db_xref="GOA:A8KXB9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXB9"
FT                   /protein_id="ABW10022.1"
FT                   /translation="MATTSPPATLPVTETTGDHSSSLAETIAACCTPLARAPLSAEEAD
FT                   KLVAVLKAIAVPARLRLLSMIYARDGGEACVCELTEPLGLTQPTISHHLKVLVDAGLIT
FT                   RDKRGVWAYYRAVPEALAALATVFSPPQ"
FT   gene            648063..648569
FT                   /locus_tag="Franean1_0564"
FT   CDS_pept        648063..648569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0564"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: fal:FRAAL3367 cadmium-induced
FT                   protein CadI (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10023"
FT                   /db_xref="GOA:A8KXC0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC0"
FT                   /protein_id="ABW10023.1"
FT                   /translation="MARVQLALNVSDVDAAVEFYTKLFGVEPAKRRPGYANFAVEVPPL
FT                   KLVLIENPDARGTGVAGALNHLGVEIETSEEVSAAATRLQDSGLVTAVEENTACCYALQ
FT                   DKVWVDDPDGAPWEIYTVLADIAESTGTQLRTVEPGDGPGSACDCGPVCAPRVTIEPAP
FT                   AGVTR"
FT   gene            648578..649360
FT                   /locus_tag="Franean1_0565"
FT   CDS_pept        648578..649360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0565"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: fal:FRAAL3366
FT                   putative arsenate reductase (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10024"
FT                   /db_xref="GOA:A8KXC1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC1"
FT                   /protein_id="ABW10024.1"
FT                   /translation="MSGNGESQPPLVRRLAAETVGSMLLAALVIGSGIAAQQLSPDQIG
FT                   LQLVENAAATAAGLYAIILMLGPVSGAHFNPVVTAVDAAFGGLSRRDAAAYLPAQIAGC
FT                   IAGAVLANLMFDRSAVSISTHHRASGPHLLAEVVATAGLILLIFALVRSERGERAPAAV
FT                   GAYIGAAYWFTSSTSFANPAISVGRIFSDTFAGIAPASVPAFIAVQAAGGLVGYGLVRL
FT                   FYPPTPTTPAQAAQVLLPHTDTAAPNGTAHPHLSGGIP"
FT   gene            649615..650025
FT                   /locus_tag="Franean1_0566"
FT   CDS_pept        649615..650025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0566"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: fal:FRAAL3366 putative arsenate
FT                   reductase (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10025"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC2"
FT                   /protein_id="ABW10025.1"
FT                   /translation="MSEKPSVLFVCVHNAGRSQMAAGWLTHLAAGKIEVRSAGSMPAEQ
FT                   INPTAVAAMREVGIDITAETPKILTVEAVQASDVVITMGCGDACPVFPGTRYEDWKLDD
FT                   PAGQGIDAVRPIRDDIRARVEELIGELLPAGT"
FT   gene            complement(650057..650494)
FT                   /locus_tag="Franean1_0567"
FT   CDS_pept        complement(650057..650494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10026"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC3"
FT                   /protein_id="ABW10026.1"
FT                   /translation="MMSRMSSPSRARTSGRGTTSRRRTQDQDGQRAAQSPVEQMGADAK
FT                   ERHETHSATLRLPFLNARFEIPHPSGEPMHLGPMTLPPPGKTAYYVGLGLLAVTEVIEW
FT                   PVVAAIAAGTYVAQHTGTPRVDQLRAEQARNGQREPATVSA"
FT   gene            complement(650584..655125)
FT                   /locus_tag="Franean1_0568"
FT   CDS_pept        complement(650584..655125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0568"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; E1-E2 ATPase-associated domain
FT                   protein; KEGG: stp:Strop_0017 ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10027"
FT                   /db_xref="GOA:A8KXC4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC4"
FT                   /protein_id="ABW10027.1"
FT                   /translation="MRIPGSRSVWHLPAAVLHTLTPPLFDRFEPRTEPGRRDRVAGRMA
FT                   SFEVRGASGPEGETRCRALEEALGRHPGVAWARVNAPLKRILIGLVDSAPTADELAAAV
FT                   RQVEGVMTEPSVDLLPGGFTGPVRRSGMALAADAAALALASAGRLSRWASLPAELASLV
FT                   TLVDTQPRLRCQLERVLGQDNADLALAVANAAALGLTQGYASLGTDVAYRLLALDAARA
FT                   RRDAFAAVADELLGRPEWAGARPVVVERPRPLPAGPIEHYADVAVLGGLAAGAAAAGLT
FT                   RAPRRAAALALTALPRSTRLGREGFALQLTRVLARRGAQVMSPAALRLLDRVDTVIVDH
FT                   DVLVSGQHTIGDIVSLPGADPSEVAVRSHALFRPADTTARVSRDGWTLGPVERLAIRGR
FT                   TGVRERRRLAAAGAVTVLGLAHGTRLMALVGLVPERVEASEQFLAACRRSGCAVFVAGG
FT                   PEGEPSGRTPWDGWAGFQHAPGGTRLVATVRGLQAERGGVLVVSGQRAAVGCADCGVGV
FT                   AGPDGSPAWGAHVLVGNDLLAAGLVVEAAGVASRVSRHAVRLAELGTGTAALVALTGAG
FT                   EALAARAQLMVTVAAAAALGEGAWAARELGRRPVPPTIPHIPWHVLPPEACLDRLGSTR
FT                   RGLSAGQVAQRQVGETSVSVNAPGLARAFAAELANPLTPVLLGGAALSASTGSVLDSGL
FT                   VVSVAVGSALIGAVQRLRADRALARLFAVSAIPALVRRDGADVELTADDLVAGDVLTLG
FT                   PGDVIPADCRLLSTEALEVDESSLTGESLPVAKSPKPVAARDLAERTCMVFQGTTVAAG
FT                   RATALVVATGTATEAGRGLAAAAEPARPVGVQARLAAITDLTIPVALGAAGTLLLSGLV
FT                   RGLPIRNTLSAGVALAVAAVPEGLPFLATAAQLSSARRLAGRGALVRNPRTIETLGRVD
FT                   VLCFDKTGTLTKGKIRLTAVSDGSRSCPLADLDETGHQVVAVGLRATPDDQHRKLPHPT
FT                   DRAVVKGAAAAGVGRAPDGREWSPLTALPFDPSRSYHACLGQLGAATLLSVKGAPEVVL
FT                   PRCTHRRTSRRTQPLDVRGQARLAREHHRLAAAGYRVLAVAERRVAATGPAARRQLADD
FT                   DVAGLAFLGFLALSDPVRDTATPSLDQLRAAGVQIIMITGDHPSTARTIAAELGVLDGD
FT                   AQVVTGAELDAMADAELDAMLPLVAVVARGTPAHKVRVIEAFQRLGRTVAMTGDGDNDA
FT                   PAIRLADVGIALGKRGTPAARAAADVIITENRLDAILAVLVEGRSMWASVRKALGIFVG
FT                   GNLGEIAFTLLGSLATGRSPLSARQLLLVNLLTDLAPGLAVALRPPDPEAAGRLLGEGP
FT                   ERSLGSPLNAEIAVRATATTLAAAGAWIAARLTGRRRRADTVGLAALVGSQLGQTLLVG
FT                   GRSRMVILSSLVSAVVLAAVVQAPGLSHFFGCTPLGTAGWTIAVAASAVATLLSFLLQR
FT                   RTERLLQRRTERPVLARADLTQILHGLARVPRAAVRTSAAGPVPAPAGRGAG"
FT   gene            655376..655804
FT                   /locus_tag="Franean1_0569"
FT   CDS_pept        655376..655804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0569"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL2957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10028"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC5"
FT                   /protein_id="ABW10028.1"
FT                   /translation="MTDADADAGAGASSARRWFTPVTEQLTPADLKIDVSHSARVYDYF
FT                   LGGKDNFPADREAAEQTLAIFPDMRTGARENRAFLHRATRKLVRELGLRQFLDIGTGIP
FT                   TSPNLHEVAQEAAADARIVYADNDPIVLAQFQAPHQHL"
FT   gene            complement(656325..656918)
FT                   /locus_tag="Franean1_0570"
FT   CDS_pept        complement(656325..656918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10029"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC6"
FT                   /protein_id="ABW10029.1"
FT                   /translation="MIRAKSRHRHQTLAFIAVFVCVIATVVAPAPAHAGLTGMQKCQAH
FT                   QAPTESLDISQWGNFSGLSYPDGSNPPNGLNPGDALHLVVYNSWTTDTMVGISWWGEWY
FT                   TIDGKFEPATAGYPFPGFSKYANYFRMNNNPGGWVASGTDPNPWNPHPMRELNTTACWA
FT                   TPNLPVRMLIQINDDNVGDNRGRWQYTLQIWRNS"
FT   sig_peptide     complement(656814..656918)
FT                   /locus_tag="Franean1_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            complement(657818..658441)
FT                   /locus_tag="Franean1_0571"
FT   CDS_pept        complement(657818..658441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0571"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: bra:BRADO5623 conserved hypothetical protein;
FT                   putative isoprenylcysteine O-methyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10030"
FT                   /db_xref="GOA:A8KXC7"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC7"
FT                   /protein_id="ABW10030.1"
FT                   /translation="MSGRWTTIVVVICWGLVTLVWLTGAAFNRRRAPRVLARSRPKILR
FT                   LLGPLAATAWIVTELAHRQIGLPAEEWLSTIALCALPLCAAFTTWARFSLGTMWTPAPC
FT                   VRRDHVLRTSGPYAMIRHPIYTGVLGMALCTAATTRQAWLLAVFLVAVVTLNIKIRSEE
FT                   RIMRQAFPADYDRYRRRVPRLVPSPFLHVKSRQRSRTASPEAIR"
FT   gene            complement(658712..659566)
FT                   /locus_tag="Franean1_0572"
FT   CDS_pept        complement(658712..659566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0572"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6987 putative exported protein of
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10031"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC8"
FT                   /protein_id="ABW10031.1"
FT                   /translation="MPRLFGWLAALAAAIVVTAILGPAPPASAGEYGPDTCRQGWVWRE
FT                   AVPGDHVCVTPQTRNQTWADNAQAANRREPAGGPYGPDTCRQGWVWREAVPGDHVCVTP
FT                   QTRSQAWADNAQAASRVAPDIPPPCRAVGGLPSDRGIPKQVVRCSVSGYWRATFTAFVH
FT                   DYTIFGSDAGSSVRVEHFENGSWVERPARMISVHNEYSARRAGEAGNTDCPVFGSMTGR
FT                   CWVPPAPRDCRIENASSIDCRDYAIGTPFSGINLNARSVRSTGSLTFGNGQFTTLPLVA
FT                   DSF"
FT   sig_peptide     complement(659477..659566)
FT                   /locus_tag="Franean1_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(660451..665550)
FT                   /locus_tag="Franean1_0573"
FT   CDS_pept        complement(660451..665550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0573"
FT                   /product="transcriptional activator domain"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   transcriptional activator domain; SMART: WD-40 repeat
FT                   protein; KEGG: sen:SACE_2545 WD-40 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10032"
FT                   /db_xref="GOA:A8KXC9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXC9"
FT                   /protein_id="ABW10032.1"
FT                   /translation="MLDEGIGAAGDEPSVQNRTPPAGGRPAGLSFQVLGPLEVRRGGTP
FT                   VQLRGTRERTLLAILLSERNRAVPLSRLVTGLWGAQPPASAERTVQAYVARLRPMLEPE
FT                   RPEAGWSVLVTSPTGYCLRVDDAAFDAASFARLVDRAQSALVAGAPDLALTRFRRAEAM
FT                   WRGDEPYQDLADVAYLTPERDRLIELRLTAAADRLDAERALGRAAGTVGDLRRLVADHP
FT                   TNERFWGQLMVALYESQRQKEALDTYRAAWTRLVDDGGIEPGPKLRALHDTIVSQRPVE
FT                   VAWPVRPGDVPAPLSADRTPLIGRDGAQRWLRDVWDQVLDDVGRLVVVEAEPGGGASRL
FT                   LAEFARTVAARGAVVETTLTPALTTQVAQRPVLVVVDQPAGPEPAEAVPAGLGPAGAES
FT                   AGVGPAGRGPAWVKRVAAAVGGSGRPVLVVVVVAASDRAAHPDEWADAVPAERVLRLGP
FT                   LGGDAVGNIVAGYVQPADLDEATSVILDTAGGNPARVHEAAARWAAERARAQAGRSAER
FT                   MAAVHRTLAQAEQEMLDDVTDLQRVRASRAPGPDTVVCPYKGLARFDEADAAYFFGRQR
FT                   LIAQLVTGCVAAPLLTVVGPSGSGKSSVVRAGLLPALRAGALPGSERWRYTPLRTGATD
FT                   EAALRAVLRDGGAEDPDGTDLLVLDQFEEAFTAWSPATRTAVVDWLVGELELRDGRLRV
FT                   VITVRADYYGRFAHHPTLARLIGRNTLLVGPMTDDELSQAIEQPARVAGLGVEDGFVAA
FT                   VLGDAKHEPGALPLLSTALLATWERRDGRMLRTAAYREAGGVAGAVTRLAEDVYKGLDP
FT                   GEQAIARRLLLRLVSPGEDGLDVRRRAARDELVDSDAADRILTLLVERRLVTADDDTVE
FT                   VAHEALLRAWPRLRGWLEADRDGRRLHRQLTEAAAAWQRSDQDPGYLYHGTRLHALQEW
FT                   AQANPGDANALERLFLAASVAVEERQLRDARRSARRSRSWASVLAILLVVALTMTVLAV
FT                   VQWSAANQQANVAREATTLSQAGRLATLAANLGPDQVDLALLLGVQGYQLAPSRDTEGG
FT                   LQAALARTPANLDQIIRFPSSSFLPAVVPPSVSPDGRLVAAPGQDGTVRLWDLHAARIV
FT                   RELHWPTGRQLAVFSADASMLAVGGSDGKVVVWEVATGRQVGAPIPAGTGLAYGQFDPR
FT                   DPDRFFAVDNSGQIVAWDRSVPERPRQLGQPLRFPAAPGEIPIFVLNATGTRMAAGAYG
FT                   RPTTRVWDIDSGAVLRDLAGAPGFFGADGVTLPTSLRDRVTLWDVNTGLAKQELTGLSG
FT                   AAPGIVLSQNLRRLAVNDGGNAIRIFDVGSGREQVTLSAAGRASTPVAFLADGRLMTSG
FT                   AAEADIWRLDRGGSPLGFTLAGHDGRVTGSFTASGTEVITQGLDDHRVLVWDAADGREL
FT                   GPLLNGAVSAPVALSPDGARIVGVGANGVLRLWDRAGKTELAVLAPADHPAAVEWSPAG
FT                   DRVAAVHAGGVLLWDVGDPHRPRLVADLDTAGSTGSTGQPRPAFSPDGQRLAVTDQQGH
FT                   RITMFDAATGRSVWLRQLETADQATLAFSPDSTKIAIGFGTIASGFVEFLDTSDGTVRR
FT                   HLNTTSVGGVAFLRDGDLVMTTSDTGDQSSVQLWDATTTASVGEPATQAHGAGILARSP
FT                   DGMSVVAGSDRGIAQVWHVDLPEWMATACRIAGRNLTRVEWERYLPGEPYRASCAQWPP
FT                   TP"
FT   gene            665803..666447
FT                   /locus_tag="Franean1_0574"
FT   CDS_pept        665803..666447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0574"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL0617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD0"
FT                   /protein_id="ABW10033.1"
FT                   /translation="MRQPARFCRWRPSAAGGGSPAVGAGRGGVCTAGRRARPLGLVIGV
FT                   CNQGVVPIVLAHARALLTGTRQGRTAYLDADLREPEKILASPELAETLDLDRPLVLSLI
FT                   AVLHFIPESDDPYGLVRRYTEVLPSGSYVALTHATGDFAPEEAERVSAVYQARGIALTP
FT                   RSRGGVEGFLTGLDLVEPGVVPVHRWHAEMDAGEELADSRVNVYGAIARVP"
FT   gene            complement(666727..668487)
FT                   /locus_tag="Franean1_0575"
FT   CDS_pept        complement(666727..668487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0575"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: fal:FRAAL5548 hypothetical
FT                   protein; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10034"
FT                   /db_xref="GOA:A8KXD1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD1"
FT                   /protein_id="ABW10034.1"
FT                   /translation="MPELRNVVVSAHSPWRLTGSGRTPRVLRCAIAASLALLGLDVAFA
FT                   VLLDLRSARVATDLVSTAAQFAAAAACFWTARRVRGAERRWRVLIGLTAAGAMLASLSI
FT                   APTLLAGDLPHRQGMSPAYAVFLSLYGVALAGLLSLPTDPVDSRGGSAGRRWYGAHRWY
FT                   AITLLDCLLIAGSLVLLQWGTVLSAVVQTGPDIRPFRLALTHQGAGLILATAVVLIASF
FT                   RRPRAPATLALLGTGLLAYGLTTNIISYVAAEYGFHLPPWGLIGFALAYLLVFLAAFVP
FT                   VPTRTPPEGPAPPSPRAMWAHAALPYAALTAAGLLILGKLATGARLDRFETYGMITLLV
FT                   LALLRQMVTLAENTRLLAEIRERERQLHHQAFHDPLTGLANRTLFTRRLQRALTQGTDS
FT                   DTTHTPAITSGEDTVSVLFLDLDGFKKVNDTFGHAVGDELLQISADRLRAETRAIDTVA
FT                   RLGGDEFGVILDGGGPDDPRRIGERLATAVQAPCLLAGRPYTPRASLGLVTLDSTTTRP
FT                   ATPDILIHQADLAMYTAKRTQTGGLVIYQPDPSTPTTTTNHHPDHPTRSVESSVCGFRD
FT                   RPAHDPGPVP"
FT   gene            complement(668480..668725)
FT                   /locus_tag="Franean1_0576"
FT   CDS_pept        complement(668480..668725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10035"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD2"
FT                   /protein_id="ABW10035.1"
FT                   /translation="MSPAITACTPPPADRRQRRQDVSLPATPASPQPAATAPRYSRSVT
FT                   TFAVTEPSLFTPPSPNRHCTNLNDCDTLPCGGVGDA"
FT   gene            668762..669523
FT                   /locus_tag="Franean1_0577"
FT   CDS_pept        668762..669523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10036"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD3"
FT                   /protein_id="ABW10036.1"
FT                   /translation="MRATFATEHTPGRVNEDAVAVGDGWAFILDGATARAGVVSGCVHD
FT                   VRWLASTLAGELAQRLLSSQQTLPALPDLLAESIQATCRQHGPDCDLSNPNSPSSTAVI
FT                   ARWTSDEFEYLVLADSPLILDLGRTIRPIIDDRIAHLPDYSADGVARSRNQPGGFWVAS
FT                   TNPDAAYQAVTGSVPADEVHRAALLSDGASRLVEQFGVLDWRGLVDLLDKSGPAELIRR
FT                   TRAAERAEAPEMAARRQEKRHDDATAILLRR"
FT   gene            complement(670881..671684)
FT                   /locus_tag="Franean1_0578"
FT   CDS_pept        complement(670881..671684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0578"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: psb:Psyr_2378 regulatory protein,
FT                   TetR:Tetracyclin repressor, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10037"
FT                   /db_xref="GOA:A8KXD4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD4"
FT                   /protein_id="ABW10037.1"
FT                   /translation="MTSSPPAVTDSLRSPAHDDGAAPTEETAVPAEPGSARWWAERALV
FT                   DRRRRPRAGGLSTERIVETALEILREEGLEALTVRSVAERLGTSNASLYRHIASRDELI
FT                   ALIADHVMGDIRLDRTGRGWRADVEALMFEMRRVILSQPLPPSAGRSKSGSGSGPNMLR
FT                   LVEFALALYREAGLTDRQAVYTTITMIEFVGGSTNIRRSPAGRGSNGVAGAADLRQLLD
FT                   GLPADDFPALRTAGNLYTAASADDVFTHGMTLFLDGVASQLPSSQ"
FT   gene            671804..672259
FT                   /locus_tag="Franean1_0579"
FT   CDS_pept        671804..672259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10038"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD5"
FT                   /protein_id="ABW10038.1"
FT                   /translation="MCLPTWVPTAGHESGGVPRRRRRRTLAGRMTRPTPATTHPADRQT
FT                   SCLLPTRAIWPAPSAFSGHHRKGFSARPAEQAGDLRLDLRQPAGKIPRPTSSVDFAGAP
FT                   AGRAPHRRPRRAHQRAGNPPRRKGDPPIPAYTMWPVTVTGDEAGECS"
FT   gene            672256..673473
FT                   /locus_tag="Franean1_0580"
FT   CDS_pept        672256..673473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0580"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: fal:FRAAL3129 putative formyl-coenzyme A
FT                   transferase (formyl-CoA transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10039"
FT                   /db_xref="GOA:A8KXD6"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD6"
FT                   /protein_id="ABW10039.1"
FT                   /translation="MTAVMQGVRILEVAEHTFVPAASALLSDWGADVIKIEHVERGDAM
FT                   RALASSGVAVVPKDVHVLLEHSNRGKRSLGLDLTSQAGRDILYKLAGTCDVFLTNKLPS
FT                   VRTKLHVDVEDIRAHNPNIIYVRGTGQGERGPDADRGSYDSLAFWARAGVAVGSMRPEY
FT                   SHVPVPPAPGFGDSIGAMTIAGGIMGALFHRERTGEATEVDVSLMATGMWAMGQALALS
FT                   LLLDIPWTPPPLDAPRSNPLTGNYQTKDGRWLSFTCLQAGKYWAPMCEAIGRPELGADP
FT                   RFVDHAALMANSREAIAILEAAFAEHPLAEWRERLATFIGQWTVVQDTLEAAADPQAVA
FT                   NGYVQDCATAAGIPFRMAAAPVQYGGKPAPAGRAPLFNEHGDEILTELGLDTDAVLDLK
FT                   IRGVVA"
FT   gene            673508..674332
FT                   /locus_tag="Franean1_0581"
FT   CDS_pept        673508..674332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0581"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mav:MAV_1264 oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10040"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD7"
FT                   /protein_id="ABW10040.1"
FT                   /translation="MTLFDAFRFDGKRVLVVGGATGMGAAAAELAQAAGAEVIVADYAE
FT                   VTLPGAKSIHVNLADAASIDTAVDQLGGPVHALLSAAGVADGTPGIERINFIGHRYLID
FT                   RLLAGGLLPRGSAIGFISSAAGLGWEANLPLLKEYLAITDFDEATKWAVEHGKADYMWS
FT                   KQAVCAYVATQAMPLLKQGIRINAICPGPTDTPLARANEERWLGFGTDYRAELGIEAAT
FT                   PLEQAYPLLFLCSDAASAINGITIVTDSGYFTAGISDSFPPATPIVKFMLGR"
FT   sig_peptide     673508..673609
FT                   /locus_tag="Franean1_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.646 at
FT                   residue 34"
FT   gene            674429..674881
FT                   /locus_tag="Franean1_0582"
FT   CDS_pept        674429..674881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0582"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: fal:FRAAL2441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10041"
FT                   /db_xref="GOA:A8KXD8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD8"
FT                   /protein_id="ABW10041.1"
FT                   /translation="MKEQRRGRKIAMSRDEIDAFLTEERTCRVATSSPSGPHLTPLWFV
FT                   WDGAALWLNSVVKSQRWTDIARDPRVAVLIDGGHAFNELHGVELRGKLESVGEAPRTGT
FT                   PDPDLETPEKLFAQKYTGRDEMHYDGRHAWLRLTPEKITSWDFRKM"
FT   gene            674962..676218
FT                   /locus_tag="Franean1_0583"
FT   CDS_pept        674962..676218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0583"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mjl:Mjls_2729
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10042"
FT                   /db_xref="GOA:A8KXD9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXD9"
FT                   /protein_id="ABW10042.1"
FT                   /translation="MNVDDLILVSIDDHVVEPADMFKNHLPANLADQAPHVETDESGVD
FT                   RWIYQGRVTGVSGLNAVITWPPEEWAKDPAGFAEMRPAVYDIHDRVRDMDRNGILASMC
FT                   FPTFAGFSAGHLNHFKDPLTVIMIQAYNDWHIDEWAGTYPGRFIPLALLPTWDPQLMVN
FT                   EIRRVAAKGCRAVTMPELPHLEGLPSYHNLDFWAPVFEALSDTGMVMCLHIGTGFGALK
FT                   LAPDAPIDNLIILACQISSLAVQDLLWGPAMRTYPDLKFAFSEGGIGWIPFYLDRCDRH
FT                   YTNQRWLRRDFGGKLPSEVFRDHSLACYVTDPTSLKLRREIGIDIIAWECDYPHADSIW
FT                   PEAPEFVLNELNNAGATDEEIDKITWRNACRFFNWDPFSEIPKERATVGARRAIATDVD
FT                   TTIRSRKEWARLYAQRQTT"
FT   gene            676319..677506
FT                   /locus_tag="Franean1_0584"
FT   CDS_pept        676319..677506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0584"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mgi:Mflv_4145
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10043"
FT                   /db_xref="GOA:A8KXE0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE0"
FT                   /protein_id="ABW10043.1"
FT                   /translation="MTEDLYWDPFDREFHVDPHPVWHRMRDEAPVYRNEKMDFYALSRF
FT                   ADVDAAHLDTATYSSAYGTVLELMSPEPLKTGQIIFMDPPIHTTLRVLVSRAFTPRRVG
FT                   GLEGHIRQICAELLDRQVGGGGFDYIQDFAALLPSMVISQLIGVDPADREEIRHTIDQT
FT                   FHLDPEKGMVNDISMAASAKFHAYLSEQLEARRAAPRDDMMTALVQAEIATDGGTRQLT
FT                   TSEAADFTALLVAAGTETVARLLGWACDALEAHPDQRAELAVDPSLLGNAVEETLRYES
FT                   PSPVQGRVTTRDVELHGTTIPARSKIILLTASAGRDGRRYDDPDRFDIRRRVDSHVAFG
FT                   RGAHFCLGAALARMEGRIALEETLRRFPTWEVDRDNAARLHTSTVRGYEKLPIVV"
FT   gene            677604..678638
FT                   /locus_tag="Franean1_0585"
FT   CDS_pept        677604..678638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0585"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: fal:FRAAL5526
FT                   putative aldoketoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10044"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE1"
FT                   /protein_id="ABW10044.1"
FT                   /translation="MRYRRFGTTGVEVSTQCLGTMNFGRLGNVDPDDSVRVVNRALDGG
FT                   INFIDTADVYSHGESEEIIGRAVKSRRDDVVLATKCFFPMGGQLQRGSSRRWIMQAVEG
FT                   SLRRLGTDRIDLYQIHKLDWNTDLEETLGALTDLVRQGKVLYLGSSSFPADWIVEAQWT
FT                   AARRGGERFVCEQPQYSVFARSVEQAVLPACQRHRMAVIPWSPLAGGWLTGKYQRGQEP
FT                   PTGSRYDPDSPFMQGTVSSAAERSSPVRFDAVDALRGVADQAGITLTELAMAFVANHPA
FT                   ITSTIIGPRTMKHLEDALNAADVDLDEDVLDAIDKIVPPGTDMPGIDHFTQHPALLPAA
FT                   RRRT"
FT   gene            678635..679573
FT                   /locus_tag="Franean1_0586"
FT   CDS_pept        678635..679573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0586"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rxy:Rxyl_1589 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10045"
FT                   /db_xref="GOA:A8KXE2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE2"
FT                   /protein_id="ABW10045.1"
FT                   /translation="MKAARPKAGEITVVDLDEPPGVGDEVIRIAAASICSSDLMYMRFG
FT                   LERVIGHELAGVRADGTGAVVEALYGCMECDLCLDGRYNLCPTHIHRALGSSADGGMAE
FT                   QFRVPSQRLVALPPGLDIRDASLVEPASVSWHALRLAGTGPDTRLAVVGAGALGLLAAA
FT                   GARRQGAPEVDLEARHPHQVEAGERLGAKVGTTGLYDVVVEAAGTSASLARAVDLVAPG
FT                   GTVVVVGFHMGTVEVNWSPLFHREARLIPSMSYCRHANGREMEDAAAMLADNPEIARTL
FT                   ITHRFPLEDAVEAFRVAADRKAGALRVVVEP"
FT   gene            680099..680359
FT                   /locus_tag="Franean1_0587"
FT   CDS_pept        680099..680359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5680 molybdenum cofactor biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10046"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE3"
FT                   /protein_id="ABW10046.1"
FT                   /translation="MPACRSWSAGLDRVNVSLDTTSPDRFRAITAPEIPASLRAEFTLT
FT                   PLAGRGSAPAELFEVDGGPGPGPGPGRSARPADVGDRWLSW"
FT   gene            680387..682402
FT                   /locus_tag="Franean1_0588"
FT   CDS_pept        680387..682402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0588"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: fal:FRAAL0440 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10047"
FT                   /db_xref="GOA:A8KXE4"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8KXE4"
FT                   /protein_id="ABW10047.1"
FT                   /translation="MTEISVTDTRTVRSFCRICTSVCGILVETAGDKVVRVRGDRDHPL
FT                   SRGYTCPKGRSLPQMHHHPDRIERPLMKVDGELRPTTWEECLDDLGARLRNIIERYGPE
FT                   SVGVFFGSGIGMDAAGYRMAQALHAAIGTPAKFSPMTIDGTAKVLTADLVGGSPALSGR
FT                   PDYDNASFVLFVGSNPVVSHGHTVAMPNPTGTLRALRERAEVWVIDPRHTETARLAGHH
FT                   LAPRPGTDYAVLAYLVREILRDGADREMLSRHTQGGEILAAAVEPFTLEHAARIADVSA
FT                   DELAALLAGVRRAGRVAIETGTGVTMASSANVTQWLAWSLMIITGSMNQPGGAWFHPGF
FT                   KNQLEAFKLPISPPEGSFGPGPRSRPETQSFLGEWPCAVLADEIRAGNIRAVLNLGGHL
FT                   VAAFPDTETLVPALRDLELFATIEIIGNETTALSTHVLPTKDQLERADVSLWDFLIQRV
FT                   AVQHTPAVVEPVGDRRSVWWVLAELGQRLGYQLADSRSGQVTDDTLLAEITAHARRPFG
FT                   EVVSEGWVEVPREIPAPWVDGHVERMGGWRLAPRLLVDQLAALQPPAPLVLTPRRQKRH
FT                   LNSQFDYLGEQPEIILHPDDAAAAGVVDSQPVTVRSTSGEITGIAKVDGTIRRGAVSIP
FT                   HGHQSANVNRLTDKSQVDIVTGMVRYCGIPVSVHPA"
FT   gene            complement(682592..683167)
FT                   /locus_tag="Franean1_0589"
FT   CDS_pept        complement(682592..683167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0589"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msm:MSMEG_0227
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10048"
FT                   /db_xref="GOA:A8KYF2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF2"
FT                   /protein_id="ABW10048.1"
FT                   /translation="MTVQRRAGAARERVLAVALELFARNGVSGTSIQMIADELGVTKAA
FT                   VYFQFNAKEELLRAVVAPALEEMRRVTEAAEARRRPADQLSTALTGVVDMIINNSRLNA
FT                   VVWADPAVSRLTREDPILRDLVARLDRILAGPDPDVEALVTTVMVSGGLMAATTDPRLA
FT                   DLDKDVLRRQLLNTARRMLGLRAIRTQV"
FT   gene            complement(683536..683943)
FT                   /locus_tag="Franean1_0590"
FT   CDS_pept        complement(683536..683943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10049"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF3"
FT                   /protein_id="ABW10049.1"
FT                   /translation="MVSLRMLPRNLVAAALAIVMMVAVIGFGQGTAHAATCSDRQLPVS
FT                   SAASYLGVDRRHSAQFRGVLSGGVTYVNFWFDGVYRGLYNANGVLVTGSAPISALYKTV
FT                   TTTEIWLGRVRQVVKNVPYLRVCGNYWIKLS"
FT   sig_peptide     complement(683839..683943)
FT                   /locus_tag="Franean1_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.959 at
FT                   residue 35"
FT   gene            684026..684784
FT                   /locus_tag="Franean1_0591"
FT   CDS_pept        684026..684784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3188 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10050"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF4"
FT                   /protein_id="ABW10050.1"
FT                   /translation="MSLKAGSGGCVRCRVRPGVRVAAQEPGGLVRSKRAKIPALMEPPS
FT                   GTSKVETRLLRDPWPSRKPVIVTRYSTSSTYTRSFSWTFGSWTTSFGCAPWFGVSSSPR
FT                   SLLFRDVARSEAGAATLYAVTDDQPARSTRWREFIAPQGYGDELRAAFRLGGTTWGVVD
FT                   LMRDRSRAPFTPAEVELVRAIAPAVGAALRALATREAAMKLQSPRGRRPRDRAVRRRGH
FT                   VALPRRAGGTAVRRALRPRHPRSRCPGCPR"
FT   gene            685253..686605
FT                   /locus_tag="Franean1_0592"
FT   CDS_pept        685253..686605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0592"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   fal:FRAAL4708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10051"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF5"
FT                   /protein_id="ABW10051.1"
FT                   /translation="MLATLRRRVSVQVDVQSQGCSPGPVPDRFLTSSEQILAASDRPDA
FT                   PLTCGFLVQFEGELDAARLRCAVREASRRHPMMRAALYGARQYAWRFGTEPPAGSVGLV
FT                   EDGSSGWDVHEMMVSGRFDLHAHPPLRIALVRGPDGDQLSLVAHHLAVDGMGLTTILSD
FT                   IIAEYRLAEVATVTAGPVDTHVGLPAGVPPAAKAAVAGWTAFTRRSGRHITPMGTGRDT
FT                   GYGYQPLTLPVPGRVLLGSGRRITVNDLLMAATHLTIDRWNRQRGGESGKLRIRMPISL
FT                   GNAAEVGGNNTGQALVVTEPTDRADLARLAARVVDQTERAKQAATAPPIAGVAGKVGMV
FT                   ATELTPGPWRVPLLRWGVRAARPLITPAAAVSNIGSLSSLASDEPKISSVYFTATVGMP
FT                   QGLLICVAGYGNNIHVTFGYHRHLFGREAASAFANLFRTAFGELTRIGSAM"
FT   gene            complement(686811..687362)
FT                   /locus_tag="Franean1_0593"
FT   CDS_pept        complement(686811..687362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0593"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   fal:FRAAL4727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10052"
FT                   /db_xref="GOA:A8KYF6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF6"
FT                   /protein_id="ABW10052.1"
FT                   /translation="MSTHPDQPAAPRPTASPQPPHPRLRPHPRVRNERALAARARTSQD
FT                   RVSDAITAFAGSMPFVYLHAAWFTIWILLNKGAFGDAAVFDPYPFGLLTMIVSLEAIFL
FT                   STFVMISQNRQAAREDIRADLDFETNLRSEVWSVHIGKALGLDAEAIERHATEVITESK
FT                   AMISRGETSSRQVTPPAQSQ"
FT   gene            687567..688085
FT                   /locus_tag="Franean1_0594"
FT   CDS_pept        687567..688085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0594"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: fal:FRAAL1001
FT                   thiol:disulfide interchange protein HelX precursor
FT                   (cytochrome c biogenesis protein HelX)"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10053"
FT                   /db_xref="GOA:A8KYF7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF7"
FT                   /protein_id="ABW10053.1"
FT                   /translation="MEVLRLVVDEAGGGDVAYTLGDELTMRRWAWRLVPPAVALVVGPG
FT                   ASGCSIGADAADGSAEGRWAVRSADGPPCRAETPALVMLAGRYPQVAFVGVNEKEPATV
FT                   ARGFVRHNEVAYPNIIDRDGTLAARWPGVPGLPTTFVLDARGRIATRVVGGVTAESLGG
FT                   LLDRLAVER"
FT   gene            complement(688108..688356)
FT                   /locus_tag="Franean1_0595"
FT   CDS_pept        complement(688108..688356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0595"
FT                   /product="putative branched-chain amino acid ABC transport
FT                   system, solute-binding protein"
FT                   /note="KEGG: fal:FRAAL4068 putative branched-chain amino
FT                   acid ABC transport system, solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10054"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF8"
FT                   /protein_id="ABW10054.1"
FT                   /translation="MLLRGLAVAGPCPTRAGFHSRLRSVTDYDAAGLMPGGLDLSTNRG
FT                   SPSTCLTFAEVNATGTGYEVIPGPDGRQQWCGTRHRL"
FT   gene            complement(689068..689679)
FT                   /locus_tag="Franean1_0596"
FT   CDS_pept        complement(689068..689679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0596"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mav:MAV_0966
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10055"
FT                   /db_xref="GOA:A8KYF9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYF9"
FT                   /protein_id="ABW10055.1"
FT                   /translation="MVSQRQAGSATSSTRDQLLDAAEQLMLEEGYAAVTSRRVGARAGL
FT                   TPQLVHYYFRTMDDLFLEVFRRRADVGLELFRAALQSRPTLRQLWDLRDTGMTTPRFNL
FT                   EFMALANHRKAIRVVLTEYYRSYREVQLAAFTAALADLGVPPERCPPLVARLVMIGITQ
FT                   IMAIDAELGVESDSEVVDDFIRRQIEDLVEQGPERTDSDT"
FT   gene            complement(689762..691048)
FT                   /locus_tag="Franean1_0597"
FT   CDS_pept        complement(689762..691048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0597"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: msm:MSMEG_4780
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10056"
FT                   /db_xref="GOA:A8KYG0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG0"
FT                   /protein_id="ABW10056.1"
FT                   /translation="MTDWTTTDFFNDESLAEDPYPYFDELRSVCPVLPLPHLGVVAVTG
FT                   YDEAHEVYRDVDTFSSCNSVVGPFATFPVPLEGDEVGAIIDRHRDQLPMNEHMVTMDPP
FT                   MHTRERALVMRMLTPKRLQENEAFIWRLADQQLDEFIADGRCEFIRAYAQPFSMLAVAD
FT                   VLGVLESDHQRFREGFGLTVSPGQIGAGEQTDGELNALGWLDAWFARYIESRRHEPRND
FT                   VLTQMAAATYPDGTTPEVTSVVRAATFLFAAGQETTARLLGAALKFIAENPGLQEEIRE
FT                   HRERIPDLIEETLRVESPVKADFRLARRTTTIGDVEVPAGTPVMLLNGAANRDPRQFEC
FT                   PAEFRISRRNVRQHIAFGRGIHSCPGGPLARVEGRISLERILDRTRDIRISEEHHGPPD
FT                   ARRFDYEPTWILRGLTNLHLEFTPVESAR"
FT   gene            complement(691509..692768)
FT                   /locus_tag="Franean1_0598"
FT   CDS_pept        complement(691509..692768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0598"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: sen:SACE_0229
FT                   cytochrome P450-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10057"
FT                   /db_xref="GOA:A8KYG1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG1"
FT                   /protein_id="ABW10057.1"
FT                   /translation="MSQLTTRPNAVRRSLPDLLRWLDELRRRGQVHRDDRQRCWHVLGH
FT                   PEAGAVLADHRSFTSDLRGLLPRPEDMPEYNLQEGSFQEDMELFQRGNFVRLDPPEHHR
FT                   LRGLASRAFTSRTVAGLAPRIAEVTTELLDATGGRTRLELIDDLAYPLPVIVIAELLGL
FT                   PAADRPMFRGWADALFDREVADPDQPLTELAAANTRAAVPVLREMNAYLLDRIRACRAH
FT                   PGDDLTGRLVQVEVDGQRLADEEIVGFVGLLLLAGHITTTATLGNAALALDEHPGAAAE
FT                   LRAEPELLPATIEEVLRLRTPFPRLVRRAVADTRVGDEVIPAGAVVTVWLTAANRDERV
FT                   FAEPDRFDPRRAPNPHIAFGQGIHFCLGAPLARLEARTALGILLDRYSDIAVAADVPVE
FT                   HRDPWAMVSVNSLPLDVRPR"
FT   gene            complement(692912..695728)
FT                   /locus_tag="Franean1_0599"
FT   CDS_pept        complement(692912..695728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0599"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG: fal:FRAAL5304
FT                   sensory histidine kinase in two-component regulatory system
FT                   wtih KdpE, regulation of potassium translocation"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10058"
FT                   /db_xref="GOA:A8KYG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG2"
FT                   /protein_id="ABW10058.1"
FT                   /translation="MRNAGRGRAGAFRRPPRRPHHGWVPRGTLRIYLGAAPGVGKTYAA
FT                   LDEAHRRSERGTDVVIGFVETHGRPRTAAMLHDLEIVPRRTLTYRGGSFTEMDLDAVLA
FT                   RRPKVAFVDELAHTNVPGSRHAKRWHDVQELLAAGIDVISTVNVQHLESLNDVVGTITG
FT                   VPQRETVPDDVVRRADQVELVDMAPEALRRRMAHGNVYGPEKVDAALANYFRVGNLTAL
FT                   RELALLWLAGKVDDQLDRYRADHGIGGTWETRERVVVALTGGPEGDTLIRRACRIAARG
FT                   KGADLLAVHVARSDGLTGADPSALARQRALVESLGGSYHQVIGDDVPTALLEFARAENA
FT                   TQLVLGASRRGRLARILSPGIGATTTTRSGSIDVHMVTHPEAWGHRPAPAGGVDAAAHR
FT                   PARPGWPGWRLPRGRTALEPRRRIIAAGLTLVLVPALTAGLAASRGTFNLTTEMLAYLL
FT                   IVVTVALVGGFGPALLCAIASSLLLNYYFTAPVRAWTIADGDNALALLGFVLVASLVSR
FT                   VVSTSARRYEQAVRASAEAATLSVLAGSVLRGEDALPALLARARETFGMTSVTLLERTD
FT                   DDQVGVEWSPVATIAGTGPDGASVDGASGAGPGTSQAGAGGPTGGRADPDGDGDGSEIV
FT                   DIPVREDLRLVLTGRSLPAADRRILTAFAAQAAVALDQHRLREAAAEAAPIAAADKVRT
FT                   ALLTAVSHDLRTPLAAAKAAVSCLRGYDITLTDDEEAELLATADESLDKLTRLVENLLD
FT                   MSRLQAGALSVFPRAVGLDDIVPPALDEIGPAANRIGVRVPDDLPDVRADPVLLERVIV
FT                   NLVTNALRYAPADTPPVITASALGDRVELRVVDSGPGIPVRQRDNVFQPFQRLGDRDNT
FT                   TGVGLGLALSRGLAEAMGGALTPDETPGGGLTMVLSLPAALNPTAVTNPITAPLDVPTG
FT                   PAADDRAG"
FT   gene            696069..697778
FT                   /locus_tag="Franean1_0600"
FT   CDS_pept        696069..697778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0600"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: fal:FRAAL5302 P-type ATPase, high-affinity
FT                   potassium transport system, A chain; TIGRFAM:
FT                   potassium-transporting ATPase, A subunit; PFAM: K
FT                   transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10059"
FT                   /db_xref="GOA:A8KYG3"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG3"
FT                   /protein_id="ABW10059.1"
FT                   /translation="MSMTVAGILVALLLVGALATTYRPFGDYMFRVYTSEKHLPVERAI
FT                   YRLTGVNPNAGQRWTVYARSVLAFSAVSVLFLYLLQRVQDHLPWDLGFSGVSPALAWNT
FT                   AVSFTTNTDWQAYSGESTMSHFTQMAGLAVQNFASAAVGIAVAIAVVRGFARRRAPVAA
FT                   GPGSMDGVVGTGDEIGNFWVDLTRTIVRILLPICVLGAIVLIAGGAIQNLHGNHVVTTV
FT                   AGGRQAITGGPVASQEVIKELGTNGGGFYNVNSAHPFENPATWTNLFEIYLLLMIGFSL
FT                   PRTFGRLVGDRRQGLAIVAVMALIALGSLTVNMAFQVAHHGTVPEAVGAAAEGTDARFG
FT                   VANSAIFATATTLTSTGAVNSFHDSYTSLGGASLLFNMMLGEVAPGGVGSGLYGMLVLA
FT                   VVTVFVAGLMIGRTPEYVGKKIGAREMKFASLYFLTTPIIVLLGTGVAMALPGQRAGML
FT                   NSGAHGLSEVLYSFTSAGNNNGSAFAGITVNTTWYNTALGLAMMFGRFLPIIFVLGLAG
FT                   SLARQTPVPVTAGTLPTHRPQFVGMLAGVTLIIVALTFFPALALGPFAEGIH"
FT   sig_peptide     696069..696128
FT                   /locus_tag="Franean1_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.978 at
FT                   residue 20"
FT   gene            697782..700046
FT                   /locus_tag="Franean1_0601"
FT   CDS_pept        697782..700046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0601"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   fal:FRAAL5301 P-type ATPase, high-affinity potassium
FT                   transport system, B chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10060"
FT                   /db_xref="GOA:A8KYG4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG4"
FT                   /protein_id="ABW10060.1"
FT                   /translation="MSTTTIAAHQDGASAAGRRETQPARPRRVGGGLLDPKQLWTSLPS
FT                   AVRKLDPRTLWHNPVMLIVEVGAAYTTVLAIIDPSAFGWMITVWLWLTVIFANLAEAVA
FT                   EGRGKAQAAALRRARTETVARRLVGWRAGQPVESAAVESVPAPRLAQHDLVVVEAGELI
FT                   PGDGDIVEGIASVDESAITGESAPVIRESGGDRSSVTGGTRVLSDRIVVRITQKPGESF
FT                   IDRMIALVEGANRRKTPNEIALNILLAALTVIFLLAVATLQPLAIYSKAQQPALPDSST
FT                   LTGDGITGIVLASLLVCLIPTTIGALLSAIGIAGMDRLVQRNVLAMSGRAVEAAGDVNT
FT                   LLLDKTGTITLGNRQASAFLAVGGVSEAELADAAQLSSLADETPEGRSVVVFAKEHHGL
FT                   RERTPGELAHATFVHFTAQTRMSGVDLAPEPTGPGAPGAPGTSSAVGARRVRKGAASAV
FT                   TRWVRENGGQVPAQVGEIVDGISASGGTPLVVGEVIDGPSGPSGPSGPAARVLGVIQLK
FT                   DVVKSGMRERFDAMRRMGIRTVMITGDNPLTAKAIADEAGVDDFLAEATPEDKLALIRR
FT                   EQAGGKLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSNPTKLIEIVEI
FT                   GKQLLITRGALTTFSIANDVAKYFAIIPAMFAGVYTGLDRLNVMRLASPESAILSAVIF
FT                   NALVIVALIPLALRGVRYTPASASKLLSRNLYVYGLGGIVVPFAGIKVIDLLVQFIPGV
FT                   G"
FT   gene            700050..700958
FT                   /locus_tag="Franean1_0602"
FT   CDS_pept        700050..700958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0602"
FT                   /product="K transporting ATPase KdpC subunit"
FT                   /note="PFAM: K transporting ATPase KdpC subunit; KEGG:
FT                   fal:FRAAL5300 P-type ATPase, high-affinity potassium
FT                   transport system, C chain"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10061"
FT                   /db_xref="GOA:A8KYG5"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG5"
FT                   /protein_id="ABW10061.1"
FT                   /translation="MSTRLPSWLRQHLAALRALLVLTVLLGLAYPLAILALAQIPGLKD
FT                   RADGSLVTNAEGQRVGSSLIGQSFTDSDGNALPAYFQSRPSAAGDGYDPTATSASNLGP
FT                   EDVVDTPDDLATPEDESRQSLLTQVCERSLAIGEREGVDGGRKYCTASGVGAVLAVYHA
FT                   GPGPAGPIIRVVSANEPCPTTPFLATYQGIAVACRAPGDDIAAGERVLVRGDAPETPAV
FT                   PADAVTASGSGLDPGISPAYAELQIPRVARERGLPAGKVRDLVNENTTGRALGFIGERS
FT                   VDVLELNLDLDALAPAAAARS"
FT   sig_peptide     700050..700166
FT                   /locus_tag="Franean1_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.821 at
FT                   residue 39"
FT   gene            701147..701395
FT                   /locus_tag="Franean1_0603"
FT   CDS_pept        701147..701395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10062"
FT                   /db_xref="GOA:A8KYG6"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG6"
FT                   /protein_id="ABW10062.1"
FT                   /translation="MRPVAAAQGQADATHEGPNTTDLSTQTKPRSAQARARTSPGQARA
FT                   ELVVVGFGALMVSMSQSLLVPVLPTLPAELNASASEV"
FT   gene            701435..701854
FT                   /locus_tag="Franean1_0604"
FT   CDS_pept        701435..701854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0604"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2831 putative membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10063"
FT                   /db_xref="GOA:A8KYG7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG7"
FT                   /protein_id="ABW10063.1"
FT                   /translation="MPVFGRLGDMFGKRRLLLVALAMLVVGSLLAALTDNIALLIGTSS
FT                   YVQAPETSGYGFGSSMVVGGLVLLPGALGMLFLAPVSARLVAMRGAGQTLALGRSSSPS
FT                   DGWRGSPSPGPCRRSSRVRRWSASGRASATRRCRH"
FT   sig_peptide     701435..701530
FT                   /locus_tag="Franean1_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 32"
FT   gene            701806..702111
FT                   /locus_tag="Franean1_0605"
FT   CDS_pept        701806..702111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0605"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: art:Arth_3936 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10064"
FT                   /db_xref="GOA:A8KYG8"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG8"
FT                   /protein_id="ABW10064.1"
FT                   /translation="MVGIGTGIGYAAMPSLINAHTPPEEIAAANGLNTLFRAIGSSLAS
FT                   AIGGSILVAETMTVGAAELPSLTGYRELFGLYAGAAVAAAVAALAIPRHRAATPAS"
FT   gene            complement(702229..703443)
FT                   /locus_tag="Franean1_0606"
FT   CDS_pept        complement(702229..703443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0606"
FT                   /product="putative Leu/Ile/Val-binding lipoprotein
FT                   transmembrane"
FT                   /note="KEGG: fal:FRAAL4866 putative Leu/Ile/Val-binding
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10065"
FT                   /db_xref="GOA:A8KYG9"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYG9"
FT                   /protein_id="ABW10065.1"
FT                   /translation="MRLGGLTRRLSVAAVAALAVAVAGCSSTGGGGDSPAACNSPGVTP
FT                   DQVKIGFVYSDSGTGSSSLSSARAGLDARIGLANQEGGVHGRRIAYEWRDDGSSATEDA
FT                   RATTELVRDRSVFGLVTATAFLSGSVESLAAQKVPVSGLIQPAWANYPNLFSFMYEVAP
FT                   EAAGQYLQLNGAKKVAFLVTGSGAFTLETVERYKAAFGRIGLATADTISFARSTDSPAQ
FT                   VAQRLSSMGADALVGFSTPEDFADVLGAARAANVRIVSSLSLTGYDRNVLHQLGPSLAG
FT                   VSFGVNFKPFEVGDAPIQRYRDAMTRFAPETVVPEQQFAMYAYLYTDLFLRGLEIAGDC
FT                   PTREAFISGLRKVTNYDAGGLIEPVNLGTNATQPLQCNAFVRINQTGDAFEVANRRLCA
FT                   DGSSS"
FT   sig_peptide     complement(703348..703443)
FT                   /locus_tag="Franean1_0606"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.265 at
FT                   residue 32"
FT   gene            complement(705079..705282)
FT                   /locus_tag="Franean1_0607"
FT   CDS_pept        complement(705079..705282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10066"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH0"
FT                   /protein_id="ABW10066.1"
FT                   /translation="MAVPGVLNMVLADASSALKAAGFSNIPYLYECLGAASLGTVVTQS
FT                   PAPGTSQGTSAAVDLRLQANNY"
FT   gene            706383..707201
FT                   /locus_tag="Franean1_0608"
FT   CDS_pept        706383..707201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0608"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: fal:FRAAL2875
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10067"
FT                   /db_xref="GOA:A8KYH1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH1"
FT                   /protein_id="ABW10067.1"
FT                   /translation="MPMGARRPWCVRHDVVMTVETVRLRLGRGGNGVGNEDRGCADAPG
FT                   GTVPVSVAAPASAVSPRGGVIVIPDARGITNYVLAVCEQLCAEGWLALTPHLYHRDGLT
FT                   EVPVAEGSSKMLTLTAAGIAADVDACLEHLATVGLPPSRAAIIGFCMGGTAAFLTSVRH
FT                   RLGAAVSFYGGAVSTPYWTGAPPLLDVADQLRTPWLGLYGENDTWVTLDEIRSLRAAAA
FT                   RAPVPTELISYPGAQHAFHTPERPSTHDPVAARDAWARMLRWLEIHVATT"
FT   gene            complement(707259..708572)
FT                   /locus_tag="Franean1_0609"
FT   CDS_pept        complement(707259..708572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0609"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: dvl:Dvul_1439
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10068"
FT                   /db_xref="GOA:A8KYH2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH2"
FT                   /protein_id="ABW10068.1"
FT                   /translation="MDEFSYRDGTLWCEQTELREVAEKFGTPTYVYSAATLVDHYVRFA
FT                   KAFESINPLICFSAKALSNVHLLRLLAGQGAGIDTVSGGELHRALVAGVDPERIVLAGV
FT                   GKSVDELRAAVRHDIRCINVESEAEVELLARVAREEDRRPRLAIRVNPDIAPDMRTPAR
FT                   TTTAIRGAKFGVDIERAAALFRAASTDEFLRAEGFHVHIGSPIFDPRVYATALDRILAL
FT                   TAGLEADGHSVTTLNVGGGFPAEYTEGSAPGWDDFAEAICPRLQGFVDRGGQVVFEPGR
FT                   TIAANAGILLATVRYRKRAGDRELVVIDAGMTHIVRAAMYDSYHFMWPVTPVNGTVPRS
FT                   RDQQSIDDLVDYDVVGPICESSDYLAKGRALPAMVSGDLIAIFSAGAYGMTMTSNYNSQ
FT                   LRPAEVLVRGGRADLIRRRETYDDLVALELLDGLTPPL"
FT   gene            708972..709787
FT                   /locus_tag="Franean1_0610"
FT   CDS_pept        708972..709787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0610"
FT                   /product="Survival protein SurE"
FT                   /note="PFAM: Survival protein SurE; KEGG: mem:Memar_1385
FT                   stationary-phase survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10069"
FT                   /db_xref="GOA:A8KYH3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH3"
FT                   /protein_id="ABW10069.1"
FT                   /translation="MKRRVQSTGGRSGDSGRRRGDLVGQVGRSDRRRRTARASAALLAA
FT                   VAVVLTAAGCGGGGKTTMPTPTHRDAATAGGITATAVDGFPADAVTVALDVLRLTPDLV
FT                   VSGINQGQNLGPVVDLSGTVGAARAAASRGVPAIASSMGTGDAFDFAPAVKLVTDWVTA
FT                   HRAELSAGAPSSGPRATIANLNIPNCAAGGRIRGERELPTQPALPDLAVALAPQDCTSS
FT                   AEPGEEVAAFTAGFATLTEIPASPASPASPDTPAAVVTAAPAGPSPAAK"
FT   gene            709944..711356
FT                   /locus_tag="Franean1_0611"
FT   CDS_pept        709944..711356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10070"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH4"
FT                   /protein_id="ABW10070.1"
FT                   /translation="MSGTGGKTAARRATRVSAVVGSAVMGIALAVPFAVAVGPAASAAS
FT                   AAAPVVSAGGDAARGAGSTVPTVLSTATLPDIPLADFSNGLIRGSVDTDRGVDLGGIGS
FT                   DLFPAGRPNEFWTITDRGPNGQIKIDGKNRRTFPVPGFDPAIVRVRADGSTIKVLDALP
FT                   ITTAHGKPVTGLSNINGFDETPYTWDAQTPLPFDPNGLDTEGLIRTRSGEFWLVDEYSP
FT                   SLLRVSARGQVLARYIPAGVNLTGADYPVVASLPGVLGGRKINRGFEGIALAPDGRTLY
FT                   LAVQSPLQLPDAGTGNASRNVRIFRFDTASSKVTGEYVYRFEDVATFDPDADGDPSEMK
FT                   ISSLAAVDGNTLLVNERTDAVSRLYSVDLRQATNILGSRWDHTATAPSLESLADPAKAG
FT                   VTVLPKRLAVDLEGVAGMPDKIEGIAIVDRRTIAVANDNDFGLGSFNEAGQLVDSGVES
FT                   KILQLRLNRPLG"
FT   sig_peptide     709944..710084
FT                   /locus_tag="Franean1_0611"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.435 at
FT                   residue 47"
FT   gene            711806..712036
FT                   /locus_tag="Franean1_0612"
FT   CDS_pept        711806..712036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10071"
FT                   /db_xref="GOA:A8KYH5"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH5"
FT                   /protein_id="ABW10071.1"
FT                   /translation="MSGRHSARRRAARRPHVRRVDRAYRVYRAHVADRAYLAERADVAD
FT                   RRSAFLATTASLAVIVAAFGMLGLMALGTAA"
FT   gene            complement(712287..713753)
FT                   /locus_tag="Franean1_0613"
FT   CDS_pept        complement(712287..713753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0613"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: hne:HNE_2179 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10072"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH6"
FT                   /protein_id="ABW10072.1"
FT                   /translation="MPDDLRVTGPITQGSRANAFAAPAFDLGGYGYTSEEFLIEGRATA
FT                   YATGPGGEDGPGGEDGPAGGRATDGRWTVRPVREAPFRTRILVMRPSDPREFSGTTWLT
FT                   WVNVTAGFEIGDITRANLRDGDAIVYVSAQRAGVEGVPGAEGNGLRVWDPGRYGTLSHP
FT                   GDDFSYDIFTAAALVVGRDRPRLPVDPLRGLDVRRVLGTGASQSAIRLTSYLNGVQPFA
FT                   RALDGVLLVANFGRSAFFAAPAGGNDLDETFRRPPVRVRDDLDIPVLLVSTETEAEHLH
FT                   PVRQPDTPTFRTWEVAGAAHAGAGQDSITDVVATFTRDGLVLPSGSLGSSSGAVGHAAT
FT                   PNSLDWLPVVSAARRGLVAWASGGPEPASLPPITVEGMPGRVRRDEHGNAHGGVRLPQL
FT                   EVPVATHRGTVEGADLMGSLFGSMLVFPAGKLRALYPTRAAYLTAFSAAVDRAVEAGYV
FT                   LPRDADAVRSIAAKNAADLLPDEVELPAKA"
FT   gene            complement(713794..715302)
FT                   /locus_tag="Franean1_0614"
FT   CDS_pept        complement(713794..715302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0614"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mav:MAV_1627 feruloyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10073"
FT                   /db_xref="GOA:A8KYH7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH7"
FT                   /protein_id="ABW10073.1"
FT                   /translation="MEEQVSSARRIRQLAAERPDDLALRHIALDGGEPAFTWRELDRRS
FT                   SQLAGALAERGLGFGEHLGLGLRNSPQFVLAVFAAWKLGAVPIPVRWDVPEWELGRLKE
FT                   VIEPRVYLGGEDLPWIDSTERLDVPDLPDATSPQIHGICSSGSTGTPKVIVSDRPSVYV
FT                   ARMATPLAEGWGPVPRPQTVLVLAPMYHANGLTTLYNLLGGDHLVVMEKFDAARVVDVI
FT                   ERHRITTFTATPTMLQRIADLPGVDGRDLSSIRWFTQGAAPMPPSLVHRWAGLVGAEKI
FT                   HMVYGMTEGLGLTALRGDEWMEHQGSVGRGIRGTEVRILDADDKELPTGEIGDIYLRTP
FT                   GSDTSSHYLGAAPKLHRTEDGFKSAGDLGYLDQNGYLHLVDRRVDMIISGGANVFPAEV
FT                   EAALIDHPKIADVVVIGLRDPEWGRRVHAVIEPADPAAPPTASEVISYAKSRLAPYKVP
FT                   KTVELVDAIPRSEATKVNRGAMVAARDEAVPTANTGAAPGHGWS"
FT   gene            715666..716901
FT                   /locus_tag="Franean1_0615"
FT   CDS_pept        715666..716901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0615"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: fal:FRAAL3537 putative fatty acid-CoA
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10074"
FT                   /db_xref="GOA:A8KYH8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH8"
FT                   /protein_id="ABW10074.1"
FT                   /translation="MGWPMEDSASEGAFKGVRVVELAQWVFVPVAGALLADWGADVIRV
FT                   ERPEGDPYRALATQGIGTDGGGVNLSVALANRGKRSVALDLRGEQGKAILHKMLETADV
FT                   FLTNFRPGALRRLGLDADELTRRYPRLVYARGHGFGARGPDADHPGYDSSAFWARGGMG
FT                   YTLTPEEREYPISQRGAMGDRNGAMALAFGIAAALLGRTRTGRGTVVDVSLLATAMWTL
FT                   SSDLLVALTGQAPRISSGPGDGPNPLVGAYRTKDGRHIQLVFLESDRYWAPFCELIGRG
FT                   DLVADPRFADLRARGENRVACRAELEAAFATRTFEEWKDLLAGIDAPWAPVQSVLELVD
FT                   DPQVVANGYVGEVQLDGGGSYRLPTVPVQFDSQPPVPRRAPEHGEHTESVLLELGYTWE
FT                   EIAALTEAGAIP"
FT   gene            716898..717428
FT                   /locus_tag="Franean1_0616"
FT   CDS_pept        716898..717428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0616"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   fal:FRAAL0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10075"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYH9"
FT                   /protein_id="ABW10075.1"
FT                   /translation="MTAGPAAASAPAGPAGASGSAGPAAAPEPTRPVPAPDERSAPYWA
FT                   AAARHVLTVARCARCSTYVVPPDHTCPHCGSTDPGFAFEPVSGRGTVRSWTVVRQSFLP
FT                   GFRGEVPFLLVDVELAEQPELRIIGRLLDGPDTTLRIGAPVAVAFEDVADGVSVPAFAL
FT                   AESSATGPGEVRS"
FT   sig_peptide     716898..716975
FT                   /locus_tag="Franean1_0616"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.620 at
FT                   residue 26"
FT   gene            717425..718627
FT                   /locus_tag="Franean1_0617"
FT   CDS_pept        717425..718627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0617"
FT                   /product="DitF protein"
FT                   /note="KEGG: mav:MAV_2586 DitF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10076"
FT                   /db_xref="GOA:A8KYI0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI0"
FT                   /protein_id="ABW10076.1"
FT                   /translation="MSARPGSKGQVAIVGYAHSDVTRHAGRPLGALAVDTARAAIADAG
FT                   LTAGQVDGFVTSALFPTAGAHAAEDGVSLVSADWLAQRLGGSPRYVAGFQGIGQIPGSV
FT                   ALAVNAVASGAADYVVMHRALHNPKGSYHANPMRTAGGAQQWTVPQGFFGPLSMIALPY
FT                   NEYLQRYGASRETTAAVVAEARKNGARIPWSYWHDRPLTTEEYLAAPLLSDPICRYDCD
FT                   IPVDGVAAFVFTSAERARDLPHRPVYVAGQASSAPPRRRLPLHWPLDDIMAGGTALAKR
FT                   LWEQSGVSPADVDLPQVYDGFSPFVYFWLEVLGLCPVGEAHRFVLDGGIDSDRPGALPA
FT                   LSGGGALGNGRMHGIPQMLECYLQLAGRAGERQRERATVGVACASSPHFGGAVVYSTAP
FT                   A"
FT   gene            718750..720219
FT                   /locus_tag="Franean1_0618"
FT   CDS_pept        718750..720219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0618"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mpa:MAP2187c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10077"
FT                   /db_xref="GOA:A8KYI1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI1"
FT                   /protein_id="ABW10077.1"
FT                   /translation="MAAIIAERRSYVAGTWVEGDEVFAVENPADETSVADVAATPLPEI
FT                   ERAITEARRSFDEGVWADRSPAERARVLGAFLDYFQSARAELVATMVAEAGQPTGFAER
FT                   AQFGAGLGLARGTIDLYLSMSHEEANPVPLDDLVRAGASLSFRRHEPVGVVTAITPYNG
FT                   AIIMAMQKIIPALIAGNSVILRPSPLTPLSSLVFGAAAEAAGLPPGVLSVVVEGGAAGA
FT                   ELLTTHRAVDMVSFTGSTVVGRQILAQAAPTVKRVALELGGKSAQIYLPDAVGRATAGA
FT                   VAVVAATAGQACVAATRMLVPRERKDEVLDAVSRAYGALTVGPPTDPSAKLGPVISAGQ
FT                   RDRCERFVRLAEENGGKVVTGGGRPAGLERGYYFEPTVLDLPDNANPAAQEEIFGPVIS
FT                   VLGYRDLDDAVRIANDSDYGLSGQVYGADVAAAVGVARRLRTGAVNVNTAVFSAYAPGG
FT                   GYKHSGLGRERGPDGIRAFQEVKHLAIGELR"
FT   gene            720249..721457
FT                   /locus_tag="Franean1_0619"
FT   CDS_pept        720249..721457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0619"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mpa:MAP2185c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10078"
FT                   /db_xref="GOA:A8KYI2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI2"
FT                   /protein_id="ABW10078.1"
FT                   /translation="MTSSQSLDWLISVDDHVLEPPNLWTDRLPAKDHDRAPHMVIDDTG
FT                   MDCWVYDGKRFPSSGLSAVAGKEKEEFSPEPLSYADMRPGCYDPQARLEDMNRAGILAS
FT                   LCFPTVTRFCGQMFSEASDREFGLVCLKIYNDWMIEEWCGSAPGRYIPLTLIPLWDPQL
FT                   AVKELERCAAKGSTTFAFSENPAPLGLPTIHDRDGYWEPVMAAANDLEMVASMHVGSSS
FT                   QVPKIAPDAPFMANLTWGAMRTSGAMLSWLFSGMFQRYPKLKIALSEGEIGWMPYYLER
FT                   AEQVIDKQRHWVKRGVRFNEHAGADALDLDTLDIRASFREHVFGCFIDDAHGIASIDEI
FT                   GEDNIMCETDYPHSDSTWPNCIDVVRNRIGHLSEEVQYKILRGNAERLYRFTPAEPPVL
FT                   AKA"
FT   gene            721459..721710
FT                   /locus_tag="Franean1_0620"
FT   CDS_pept        721459..721710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0620"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10079"
FT                   /db_xref="GOA:A8KYI3"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI3"
FT                   /protein_id="ABW10079.1"
FT                   /translation="MAGRAPLAVVDRERCIGSGMCVDYAPGTFTQDEQAKAVVLAEADD
FT                   PADVVGIAVESCPTGALRLAHDAGLAQNTGLAQDGTGA"
FT   gene            721716..722495
FT                   /locus_tag="Franean1_0621"
FT   CDS_pept        721716..722495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0621"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mpa:MAP2184c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Franean1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABW10080"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8KYI4"
FT                   /protein_id="ABW10080.1"
FT                   /translation="MMLEGKIAVVMGAGSGVGRASALRFAEEGARVLCADIRPEGIKET
FT                   AAAIEAAGGTAAAAECDVSKEADVAAAIGAAVAQFGRIDIVFNNVGVPTPRLGAKLEDH
FT                   TAEDFQRLVAVNFGGVFNGCKQAVLQFKRQGGGGAILNTGSVAGLVAWGGSVYGATKGA
FT                   VHQLTRAVAIEGAPFGIRANAICPAGMPHTNFMAAGGLTISGDAREKMVENVGATHPLG
FT                   RPITAEDCAEAAVYLVSDRALNITGVLLPVDGGYVAR"
FT   gene            722500..723747
FT                   /locus_tag="Franean1_0622"
FT   CDS_pept        722500..723747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Franean1_0622"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP2183c
FT                   hypothetical protein"
FT