(data stored in SCRATCH zone)

EMBL: CP000821

ID   CP000821; SV 1; circular; genomic DNA; STD; PRO; 5517674 BP.
XX
AC   CP000821; ABDD01000000-ABDD01000087;
XX
PR   Project:PRJNA18789;
XX
DT   19-SEP-2007 (Rel. 93, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 6)
XX
DE   Shewanella sediminis HAW-EB3 chromosome, complete genome.
XX
KW   .
XX
OS   Shewanella sediminis HAW-EB3
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-5517674
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chertkov O., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Zhao J.-S., Richardson P.;
RT   "Complete sequence of Shewanella sediminis HAW-EB3";
RL   Unpublished.
XX
RN   [2]
RP   1-5517674
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chertkov O., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Richardson P.;
RT   ;
RL   Submitted (29-AUG-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 28ad49fae9abe2682b4ead6075bcf193.
DR   BioSample; SAMN02598412.
DR   EnsemblGenomes-Gn; EBG00001049128.
DR   EnsemblGenomes-Gn; EBG00001049129.
DR   EnsemblGenomes-Gn; EBG00001049130.
DR   EnsemblGenomes-Gn; EBG00001049131.
DR   EnsemblGenomes-Gn; EBG00001049132.
DR   EnsemblGenomes-Gn; EBG00001049133.
DR   EnsemblGenomes-Gn; EBG00001049134.
DR   EnsemblGenomes-Gn; EBG00001049135.
DR   EnsemblGenomes-Gn; EBG00001049136.
DR   EnsemblGenomes-Gn; EBG00001049137.
DR   EnsemblGenomes-Gn; EBG00001049138.
DR   EnsemblGenomes-Gn; EBG00001049139.
DR   EnsemblGenomes-Gn; EBG00001049140.
DR   EnsemblGenomes-Gn; EBG00001049141.
DR   EnsemblGenomes-Gn; EBG00001049142.
DR   EnsemblGenomes-Gn; EBG00001049143.
DR   EnsemblGenomes-Gn; EBG00001049144.
DR   EnsemblGenomes-Gn; EBG00001049145.
DR   EnsemblGenomes-Gn; EBG00001049146.
DR   EnsemblGenomes-Gn; EBG00001049147.
DR   EnsemblGenomes-Gn; EBG00001049148.
DR   EnsemblGenomes-Gn; EBG00001049149.
DR   EnsemblGenomes-Gn; EBG00001049150.
DR   EnsemblGenomes-Gn; EBG00001049151.
DR   EnsemblGenomes-Gn; EBG00001049152.
DR   EnsemblGenomes-Gn; EBG00001049153.
DR   EnsemblGenomes-Gn; EBG00001049154.
DR   EnsemblGenomes-Gn; EBG00001049155.
DR   EnsemblGenomes-Gn; EBG00001049156.
DR   EnsemblGenomes-Gn; EBG00001049157.
DR   EnsemblGenomes-Gn; EBG00001049158.
DR   EnsemblGenomes-Gn; EBG00001049159.
DR   EnsemblGenomes-Gn; EBG00001049160.
DR   EnsemblGenomes-Gn; EBG00001049161.
DR   EnsemblGenomes-Gn; EBG00001049162.
DR   EnsemblGenomes-Gn; EBG00001049163.
DR   EnsemblGenomes-Gn; EBG00001049164.
DR   EnsemblGenomes-Gn; EBG00001049165.
DR   EnsemblGenomes-Gn; EBG00001049166.
DR   EnsemblGenomes-Gn; EBG00001049167.
DR   EnsemblGenomes-Gn; EBG00001049168.
DR   EnsemblGenomes-Gn; EBG00001049169.
DR   EnsemblGenomes-Gn; EBG00001049170.
DR   EnsemblGenomes-Gn; EBG00001049171.
DR   EnsemblGenomes-Gn; EBG00001049172.
DR   EnsemblGenomes-Gn; EBG00001049173.
DR   EnsemblGenomes-Gn; EBG00001049174.
DR   EnsemblGenomes-Gn; EBG00001049175.
DR   EnsemblGenomes-Gn; EBG00001049176.
DR   EnsemblGenomes-Gn; EBG00001049177.
DR   EnsemblGenomes-Gn; EBG00001049178.
DR   EnsemblGenomes-Gn; EBG00001049179.
DR   EnsemblGenomes-Gn; EBG00001049180.
DR   EnsemblGenomes-Gn; EBG00001049181.
DR   EnsemblGenomes-Gn; EBG00001049182.
DR   EnsemblGenomes-Gn; EBG00001049183.
DR   EnsemblGenomes-Gn; EBG00001049184.
DR   EnsemblGenomes-Gn; EBG00001049185.
DR   EnsemblGenomes-Gn; EBG00001049186.
DR   EnsemblGenomes-Gn; EBG00001049187.
DR   EnsemblGenomes-Gn; EBG00001049188.
DR   EnsemblGenomes-Gn; EBG00001049189.
DR   EnsemblGenomes-Gn; EBG00001049190.
DR   EnsemblGenomes-Gn; EBG00001049191.
DR   EnsemblGenomes-Gn; EBG00001049192.
DR   EnsemblGenomes-Gn; EBG00001049193.
DR   EnsemblGenomes-Gn; EBG00001049194.
DR   EnsemblGenomes-Gn; EBG00001049195.
DR   EnsemblGenomes-Gn; EBG00001049196.
DR   EnsemblGenomes-Gn; EBG00001049197.
DR   EnsemblGenomes-Gn; EBG00001049198.
DR   EnsemblGenomes-Gn; EBG00001049199.
DR   EnsemblGenomes-Gn; EBG00001049200.
DR   EnsemblGenomes-Gn; EBG00001049201.
DR   EnsemblGenomes-Gn; EBG00001049202.
DR   EnsemblGenomes-Gn; EBG00001049203.
DR   EnsemblGenomes-Gn; EBG00001049204.
DR   EnsemblGenomes-Gn; EBG00001049205.
DR   EnsemblGenomes-Gn; EBG00001049206.
DR   EnsemblGenomes-Gn; EBG00001049207.
DR   EnsemblGenomes-Gn; EBG00001049208.
DR   EnsemblGenomes-Gn; EBG00001049209.
DR   EnsemblGenomes-Gn; EBG00001049210.
DR   EnsemblGenomes-Gn; EBG00001049211.
DR   EnsemblGenomes-Gn; EBG00001049212.
DR   EnsemblGenomes-Gn; EBG00001049213.
DR   EnsemblGenomes-Gn; EBG00001049214.
DR   EnsemblGenomes-Gn; EBG00001049215.
DR   EnsemblGenomes-Gn; EBG00001049216.
DR   EnsemblGenomes-Gn; EBG00001049217.
DR   EnsemblGenomes-Gn; EBG00001049218.
DR   EnsemblGenomes-Gn; EBG00001049219.
DR   EnsemblGenomes-Gn; EBG00001049220.
DR   EnsemblGenomes-Gn; EBG00001049221.
DR   EnsemblGenomes-Gn; EBG00001049222.
DR   EnsemblGenomes-Gn; EBG00001049223.
DR   EnsemblGenomes-Gn; EBG00001049224.
DR   EnsemblGenomes-Gn; EBG00001049225.
DR   EnsemblGenomes-Gn; EBG00001049226.
DR   EnsemblGenomes-Gn; EBG00001049227.
DR   EnsemblGenomes-Gn; EBG00001049228.
DR   EnsemblGenomes-Gn; EBG00001049229.
DR   EnsemblGenomes-Gn; EBG00001049230.
DR   EnsemblGenomes-Gn; EBG00001049231.
DR   EnsemblGenomes-Gn; EBG00001049232.
DR   EnsemblGenomes-Gn; EBG00001049233.
DR   EnsemblGenomes-Gn; EBG00001049234.
DR   EnsemblGenomes-Gn; EBG00001049235.
DR   EnsemblGenomes-Gn; EBG00001049236.
DR   EnsemblGenomes-Gn; EBG00001049237.
DR   EnsemblGenomes-Gn; EBG00001049238.
DR   EnsemblGenomes-Gn; EBG00001049239.
DR   EnsemblGenomes-Gn; EBG00001049240.
DR   EnsemblGenomes-Gn; EBG00001049241.
DR   EnsemblGenomes-Gn; EBG00001049242.
DR   EnsemblGenomes-Gn; EBG00001049243.
DR   EnsemblGenomes-Gn; EBG00001049244.
DR   EnsemblGenomes-Gn; EBG00001049245.
DR   EnsemblGenomes-Gn; EBG00001049246.
DR   EnsemblGenomes-Gn; EBG00001049247.
DR   EnsemblGenomes-Gn; EBG00001049248.
DR   EnsemblGenomes-Gn; EBG00001049249.
DR   EnsemblGenomes-Gn; EBG00001049250.
DR   EnsemblGenomes-Gn; EBG00001049251.
DR   EnsemblGenomes-Gn; EBG00001049252.
DR   EnsemblGenomes-Gn; EBG00001049253.
DR   EnsemblGenomes-Gn; EBG00001049254.
DR   EnsemblGenomes-Gn; EBG00001049255.
DR   EnsemblGenomes-Gn; EBG00001049256.
DR   EnsemblGenomes-Gn; EBG00001049257.
DR   EnsemblGenomes-Gn; EBG00001049258.
DR   EnsemblGenomes-Gn; EBG00001049259.
DR   EnsemblGenomes-Gn; EBG00001049260.
DR   EnsemblGenomes-Gn; EBG00001049261.
DR   EnsemblGenomes-Gn; EBG00001049262.
DR   EnsemblGenomes-Gn; EBG00001049263.
DR   EnsemblGenomes-Gn; EBG00001049264.
DR   EnsemblGenomes-Gn; EBG00001049265.
DR   EnsemblGenomes-Gn; EBG00001049266.
DR   EnsemblGenomes-Gn; EBG00001049267.
DR   EnsemblGenomes-Gn; EBG00001049268.
DR   EnsemblGenomes-Gn; EBG00001049269.
DR   EnsemblGenomes-Gn; EBG00001049270.
DR   EnsemblGenomes-Gn; EBG00001049271.
DR   EnsemblGenomes-Gn; EBG00001049272.
DR   EnsemblGenomes-Gn; EBG00001049273.
DR   EnsemblGenomes-Gn; EBG00001049274.
DR   EnsemblGenomes-Gn; EBG00001049275.
DR   EnsemblGenomes-Gn; EBG00001049276.
DR   EnsemblGenomes-Gn; EBG00001049277.
DR   EnsemblGenomes-Gn; EBG00001049278.
DR   EnsemblGenomes-Gn; EBG00001049279.
DR   EnsemblGenomes-Gn; EBG00001049280.
DR   EnsemblGenomes-Gn; EBG00001049281.
DR   EnsemblGenomes-Gn; EBG00001049282.
DR   EnsemblGenomes-Gn; EBG00001049283.
DR   EnsemblGenomes-Gn; EBG00001049284.
DR   EnsemblGenomes-Gn; EBG00001049285.
DR   EnsemblGenomes-Gn; EBG00001049286.
DR   EnsemblGenomes-Gn; EBG00001049287.
DR   EnsemblGenomes-Gn; EBG00001049288.
DR   EnsemblGenomes-Gn; EBG00001049289.
DR   EnsemblGenomes-Gn; EBG00001049290.
DR   EnsemblGenomes-Gn; EBG00001049291.
DR   EnsemblGenomes-Gn; EBG00001049292.
DR   EnsemblGenomes-Gn; EBG00001049293.
DR   EnsemblGenomes-Gn; EBG00001049294.
DR   EnsemblGenomes-Gn; EBG00001049295.
DR   EnsemblGenomes-Gn; EBG00001049296.
DR   EnsemblGenomes-Gn; EBG00001049297.
DR   EnsemblGenomes-Gn; EBG00001049298.
DR   EnsemblGenomes-Gn; EBG00001049299.
DR   EnsemblGenomes-Gn; EBG00001049300.
DR   EnsemblGenomes-Gn; EBG00001049301.
DR   EnsemblGenomes-Gn; EBG00001049302.
DR   EnsemblGenomes-Gn; EBG00001049303.
DR   EnsemblGenomes-Gn; EBG00001049304.
DR   EnsemblGenomes-Gn; EBG00001049305.
DR   EnsemblGenomes-Gn; EBG00001049306.
DR   EnsemblGenomes-Gn; EBG00001049307.
DR   EnsemblGenomes-Gn; EBG00001049308.
DR   EnsemblGenomes-Gn; EBG00001049309.
DR   EnsemblGenomes-Gn; EBG00001049311.
DR   EnsemblGenomes-Gn; EBG00001049312.
DR   EnsemblGenomes-Gn; EBG00001049313.
DR   EnsemblGenomes-Gn; EBG00001049314.
DR   EnsemblGenomes-Gn; EBG00001049315.
DR   EnsemblGenomes-Gn; EBG00001049316.
DR   EnsemblGenomes-Gn; EBG00001049317.
DR   EnsemblGenomes-Gn; EBG00001049318.
DR   EnsemblGenomes-Gn; EBG00001049319.
DR   EnsemblGenomes-Gn; EBG00001049320.
DR   EnsemblGenomes-Gn; EBG00001049321.
DR   EnsemblGenomes-Gn; EBG00001049322.
DR   EnsemblGenomes-Gn; EBG00001049323.
DR   EnsemblGenomes-Gn; EBG00001049324.
DR   EnsemblGenomes-Gn; EBG00001049325.
DR   EnsemblGenomes-Gn; EBG00001049326.
DR   EnsemblGenomes-Gn; Ssed_R0001.
DR   EnsemblGenomes-Gn; Ssed_R0002.
DR   EnsemblGenomes-Gn; Ssed_R0003.
DR   EnsemblGenomes-Gn; Ssed_R0004.
DR   EnsemblGenomes-Gn; Ssed_R0005.
DR   EnsemblGenomes-Gn; Ssed_R0006.
DR   EnsemblGenomes-Gn; Ssed_R0007.
DR   EnsemblGenomes-Gn; Ssed_R0008.
DR   EnsemblGenomes-Gn; Ssed_R0009.
DR   EnsemblGenomes-Gn; Ssed_R0010.
DR   EnsemblGenomes-Gn; Ssed_R0011.
DR   EnsemblGenomes-Gn; Ssed_R0012.
DR   EnsemblGenomes-Gn; Ssed_R0013.
DR   EnsemblGenomes-Gn; Ssed_R0014.
DR   EnsemblGenomes-Gn; Ssed_R0015.
DR   EnsemblGenomes-Gn; Ssed_R0016.
DR   EnsemblGenomes-Gn; Ssed_R0017.
DR   EnsemblGenomes-Gn; Ssed_R0018.
DR   EnsemblGenomes-Gn; Ssed_R0019.
DR   EnsemblGenomes-Gn; Ssed_R0020.
DR   EnsemblGenomes-Gn; Ssed_R0021.
DR   EnsemblGenomes-Gn; Ssed_R0022.
DR   EnsemblGenomes-Gn; Ssed_R0023.
DR   EnsemblGenomes-Gn; Ssed_R0024.
DR   EnsemblGenomes-Gn; Ssed_R0025.
DR   EnsemblGenomes-Gn; Ssed_R0026.
DR   EnsemblGenomes-Gn; Ssed_R0027.
DR   EnsemblGenomes-Gn; Ssed_R0028.
DR   EnsemblGenomes-Gn; Ssed_R0029.
DR   EnsemblGenomes-Gn; Ssed_R0030.
DR   EnsemblGenomes-Gn; Ssed_R0031.
DR   EnsemblGenomes-Gn; Ssed_R0032.
DR   EnsemblGenomes-Gn; Ssed_R0033.
DR   EnsemblGenomes-Gn; Ssed_R0034.
DR   EnsemblGenomes-Gn; Ssed_R0035.
DR   EnsemblGenomes-Gn; Ssed_R0036.
DR   EnsemblGenomes-Gn; Ssed_R0037.
DR   EnsemblGenomes-Gn; Ssed_R0038.
DR   EnsemblGenomes-Gn; Ssed_R0039.
DR   EnsemblGenomes-Gn; Ssed_R0040.
DR   EnsemblGenomes-Gn; Ssed_R0041.
DR   EnsemblGenomes-Gn; Ssed_R0042.
DR   EnsemblGenomes-Gn; Ssed_R0043.
DR   EnsemblGenomes-Gn; Ssed_R0044.
DR   EnsemblGenomes-Gn; Ssed_R0045.
DR   EnsemblGenomes-Gn; Ssed_R0046.
DR   EnsemblGenomes-Gn; Ssed_R0047.
DR   EnsemblGenomes-Gn; Ssed_R0048.
DR   EnsemblGenomes-Gn; Ssed_R0050.
DR   EnsemblGenomes-Gn; Ssed_R0051.
DR   EnsemblGenomes-Gn; Ssed_R0052.
DR   EnsemblGenomes-Gn; Ssed_R0053.
DR   EnsemblGenomes-Gn; Ssed_R0054.
DR   EnsemblGenomes-Gn; Ssed_R0055.
DR   EnsemblGenomes-Gn; Ssed_R0056.
DR   EnsemblGenomes-Gn; Ssed_R0057.
DR   EnsemblGenomes-Gn; Ssed_R0058.
DR   EnsemblGenomes-Gn; Ssed_R0059.
DR   EnsemblGenomes-Gn; Ssed_R0060.
DR   EnsemblGenomes-Gn; Ssed_R0061.
DR   EnsemblGenomes-Gn; Ssed_R0062.
DR   EnsemblGenomes-Gn; Ssed_R0063.
DR   EnsemblGenomes-Gn; Ssed_R0064.
DR   EnsemblGenomes-Gn; Ssed_R0065.
DR   EnsemblGenomes-Gn; Ssed_R0066.
DR   EnsemblGenomes-Gn; Ssed_R0067.
DR   EnsemblGenomes-Gn; Ssed_R0068.
DR   EnsemblGenomes-Gn; Ssed_R0069.
DR   EnsemblGenomes-Gn; Ssed_R0070.
DR   EnsemblGenomes-Gn; Ssed_R0071.
DR   EnsemblGenomes-Gn; Ssed_R0072.
DR   EnsemblGenomes-Gn; Ssed_R0073.
DR   EnsemblGenomes-Gn; Ssed_R0074.
DR   EnsemblGenomes-Gn; Ssed_R0075.
DR   EnsemblGenomes-Gn; Ssed_R0076.
DR   EnsemblGenomes-Gn; Ssed_R0077.
DR   EnsemblGenomes-Gn; Ssed_R0078.
DR   EnsemblGenomes-Gn; Ssed_R0079.
DR   EnsemblGenomes-Gn; Ssed_R0080.
DR   EnsemblGenomes-Gn; Ssed_R0081.
DR   EnsemblGenomes-Gn; Ssed_R0082.
DR   EnsemblGenomes-Gn; Ssed_R0083.
DR   EnsemblGenomes-Gn; Ssed_R0084.
DR   EnsemblGenomes-Gn; Ssed_R0085.
DR   EnsemblGenomes-Gn; Ssed_R0086.
DR   EnsemblGenomes-Gn; Ssed_R0087.
DR   EnsemblGenomes-Gn; Ssed_R0088.
DR   EnsemblGenomes-Gn; Ssed_R0089.
DR   EnsemblGenomes-Gn; Ssed_R0090.
DR   EnsemblGenomes-Gn; Ssed_R0091.
DR   EnsemblGenomes-Gn; Ssed_R0092.
DR   EnsemblGenomes-Gn; Ssed_R0093.
DR   EnsemblGenomes-Gn; Ssed_R0094.
DR   EnsemblGenomes-Gn; Ssed_R0095.
DR   EnsemblGenomes-Gn; Ssed_R0096.
DR   EnsemblGenomes-Gn; Ssed_R0097.
DR   EnsemblGenomes-Gn; Ssed_R0098.
DR   EnsemblGenomes-Gn; Ssed_R0099.
DR   EnsemblGenomes-Gn; Ssed_R0100.
DR   EnsemblGenomes-Gn; Ssed_R0101.
DR   EnsemblGenomes-Gn; Ssed_R0102.
DR   EnsemblGenomes-Gn; Ssed_R0103.
DR   EnsemblGenomes-Gn; Ssed_R0104.
DR   EnsemblGenomes-Gn; Ssed_R0105.
DR   EnsemblGenomes-Gn; Ssed_R0106.
DR   EnsemblGenomes-Gn; Ssed_R0107.
DR   EnsemblGenomes-Gn; Ssed_R0108.
DR   EnsemblGenomes-Gn; Ssed_R0109.
DR   EnsemblGenomes-Gn; Ssed_R0110.
DR   EnsemblGenomes-Gn; Ssed_R0111.
DR   EnsemblGenomes-Gn; Ssed_R0112.
DR   EnsemblGenomes-Gn; Ssed_R0113.
DR   EnsemblGenomes-Gn; Ssed_R0114.
DR   EnsemblGenomes-Gn; Ssed_R0115.
DR   EnsemblGenomes-Gn; Ssed_R0116.
DR   EnsemblGenomes-Gn; Ssed_R0117.
DR   EnsemblGenomes-Gn; Ssed_R0118.
DR   EnsemblGenomes-Gn; Ssed_R0119.
DR   EnsemblGenomes-Gn; Ssed_R0120.
DR   EnsemblGenomes-Gn; Ssed_R0121.
DR   EnsemblGenomes-Gn; Ssed_R0122.
DR   EnsemblGenomes-Gn; Ssed_R0123.
DR   EnsemblGenomes-Gn; Ssed_R0124.
DR   EnsemblGenomes-Gn; Ssed_R0125.
DR   EnsemblGenomes-Gn; Ssed_R0126.
DR   EnsemblGenomes-Gn; Ssed_R0127.
DR   EnsemblGenomes-Gn; Ssed_R0128.
DR   EnsemblGenomes-Gn; Ssed_R0129.
DR   EnsemblGenomes-Gn; Ssed_R0130.
DR   EnsemblGenomes-Gn; Ssed_R0131.
DR   EnsemblGenomes-Gn; Ssed_R0132.
DR   EnsemblGenomes-Gn; Ssed_R0133.
DR   EnsemblGenomes-Gn; Ssed_R0134.
DR   EnsemblGenomes-Gn; Ssed_R0135.
DR   EnsemblGenomes-Gn; Ssed_R0136.
DR   EnsemblGenomes-Gn; Ssed_R0137.
DR   EnsemblGenomes-Gn; Ssed_R0138.
DR   EnsemblGenomes-Gn; Ssed_R0139.
DR   EnsemblGenomes-Gn; Ssed_R0140.
DR   EnsemblGenomes-Gn; Ssed_R0141.
DR   EnsemblGenomes-Gn; Ssed_R0142.
DR   EnsemblGenomes-Gn; Ssed_R0143.
DR   EnsemblGenomes-Gn; Ssed_R0144.
DR   EnsemblGenomes-Gn; Ssed_R0145.
DR   EnsemblGenomes-Gn; Ssed_R0147.
DR   EnsemblGenomes-Gn; Ssed_R0148.
DR   EnsemblGenomes-Gn; Ssed_R0149.
DR   EnsemblGenomes-Gn; Ssed_R0150.
DR   EnsemblGenomes-Gn; Ssed_R0151.
DR   EnsemblGenomes-Gn; Ssed_R0152.
DR   EnsemblGenomes-Gn; Ssed_R0153.
DR   EnsemblGenomes-Gn; Ssed_R0154.
DR   EnsemblGenomes-Gn; Ssed_R0155.
DR   EnsemblGenomes-Gn; Ssed_R0156.
DR   EnsemblGenomes-Gn; Ssed_R0157.
DR   EnsemblGenomes-Gn; Ssed_R0158.
DR   EnsemblGenomes-Gn; Ssed_R0159.
DR   EnsemblGenomes-Gn; Ssed_R0160.
DR   EnsemblGenomes-Gn; Ssed_R0161.
DR   EnsemblGenomes-Gn; Ssed_R0162.
DR   EnsemblGenomes-Gn; Ssed_R0163.
DR   EnsemblGenomes-Gn; Ssed_R0164.
DR   EnsemblGenomes-Gn; Ssed_R0165.
DR   EnsemblGenomes-Tr; EBT00001651273.
DR   EnsemblGenomes-Tr; EBT00001651274.
DR   EnsemblGenomes-Tr; EBT00001651275.
DR   EnsemblGenomes-Tr; EBT00001651276.
DR   EnsemblGenomes-Tr; EBT00001651277.
DR   EnsemblGenomes-Tr; EBT00001651278.
DR   EnsemblGenomes-Tr; EBT00001651279.
DR   EnsemblGenomes-Tr; EBT00001651280.
DR   EnsemblGenomes-Tr; EBT00001651281.
DR   EnsemblGenomes-Tr; EBT00001651282.
DR   EnsemblGenomes-Tr; EBT00001651283.
DR   EnsemblGenomes-Tr; EBT00001651284.
DR   EnsemblGenomes-Tr; EBT00001651285.
DR   EnsemblGenomes-Tr; EBT00001651286.
DR   EnsemblGenomes-Tr; EBT00001651287.
DR   EnsemblGenomes-Tr; EBT00001651288.
DR   EnsemblGenomes-Tr; EBT00001651289.
DR   EnsemblGenomes-Tr; EBT00001651290.
DR   EnsemblGenomes-Tr; EBT00001651291.
DR   EnsemblGenomes-Tr; EBT00001651292.
DR   EnsemblGenomes-Tr; EBT00001651293.
DR   EnsemblGenomes-Tr; EBT00001651294.
DR   EnsemblGenomes-Tr; EBT00001651295.
DR   EnsemblGenomes-Tr; EBT00001651296.
DR   EnsemblGenomes-Tr; EBT00001651297.
DR   EnsemblGenomes-Tr; EBT00001651298.
DR   EnsemblGenomes-Tr; EBT00001651299.
DR   EnsemblGenomes-Tr; EBT00001651300.
DR   EnsemblGenomes-Tr; EBT00001651301.
DR   EnsemblGenomes-Tr; EBT00001651302.
DR   EnsemblGenomes-Tr; EBT00001651303.
DR   EnsemblGenomes-Tr; EBT00001651304.
DR   EnsemblGenomes-Tr; EBT00001651305.
DR   EnsemblGenomes-Tr; EBT00001651306.
DR   EnsemblGenomes-Tr; EBT00001651307.
DR   EnsemblGenomes-Tr; EBT00001651308.
DR   EnsemblGenomes-Tr; EBT00001651309.
DR   EnsemblGenomes-Tr; EBT00001651310.
DR   EnsemblGenomes-Tr; EBT00001651311.
DR   EnsemblGenomes-Tr; EBT00001651312.
DR   EnsemblGenomes-Tr; EBT00001651313.
DR   EnsemblGenomes-Tr; EBT00001651314.
DR   EnsemblGenomes-Tr; EBT00001651315.
DR   EnsemblGenomes-Tr; EBT00001651316.
DR   EnsemblGenomes-Tr; EBT00001651317.
DR   EnsemblGenomes-Tr; EBT00001651318.
DR   EnsemblGenomes-Tr; EBT00001651319.
DR   EnsemblGenomes-Tr; EBT00001651320.
DR   EnsemblGenomes-Tr; EBT00001651321.
DR   EnsemblGenomes-Tr; EBT00001651322.
DR   EnsemblGenomes-Tr; EBT00001651323.
DR   EnsemblGenomes-Tr; EBT00001651324.
DR   EnsemblGenomes-Tr; EBT00001651325.
DR   EnsemblGenomes-Tr; EBT00001651326.
DR   EnsemblGenomes-Tr; EBT00001651327.
DR   EnsemblGenomes-Tr; EBT00001651328.
DR   EnsemblGenomes-Tr; EBT00001651329.
DR   EnsemblGenomes-Tr; EBT00001651330.
DR   EnsemblGenomes-Tr; EBT00001651331.
DR   EnsemblGenomes-Tr; EBT00001651332.
DR   EnsemblGenomes-Tr; EBT00001651333.
DR   EnsemblGenomes-Tr; EBT00001651334.
DR   EnsemblGenomes-Tr; EBT00001651335.
DR   EnsemblGenomes-Tr; EBT00001651336.
DR   EnsemblGenomes-Tr; EBT00001651337.
DR   EnsemblGenomes-Tr; EBT00001651338.
DR   EnsemblGenomes-Tr; EBT00001651339.
DR   EnsemblGenomes-Tr; EBT00001651340.
DR   EnsemblGenomes-Tr; EBT00001651341.
DR   EnsemblGenomes-Tr; EBT00001651342.
DR   EnsemblGenomes-Tr; EBT00001651343.
DR   EnsemblGenomes-Tr; EBT00001651344.
DR   EnsemblGenomes-Tr; EBT00001651345.
DR   EnsemblGenomes-Tr; EBT00001651346.
DR   EnsemblGenomes-Tr; EBT00001651347.
DR   EnsemblGenomes-Tr; EBT00001651348.
DR   EnsemblGenomes-Tr; EBT00001651349.
DR   EnsemblGenomes-Tr; EBT00001651350.
DR   EnsemblGenomes-Tr; EBT00001651351.
DR   EnsemblGenomes-Tr; EBT00001651352.
DR   EnsemblGenomes-Tr; EBT00001651353.
DR   EnsemblGenomes-Tr; EBT00001651354.
DR   EnsemblGenomes-Tr; EBT00001651355.
DR   EnsemblGenomes-Tr; EBT00001651356.
DR   EnsemblGenomes-Tr; EBT00001651357.
DR   EnsemblGenomes-Tr; EBT00001651358.
DR   EnsemblGenomes-Tr; EBT00001651359.
DR   EnsemblGenomes-Tr; EBT00001651360.
DR   EnsemblGenomes-Tr; EBT00001651361.
DR   EnsemblGenomes-Tr; EBT00001651362.
DR   EnsemblGenomes-Tr; EBT00001651363.
DR   EnsemblGenomes-Tr; EBT00001651364.
DR   EnsemblGenomes-Tr; EBT00001651365.
DR   EnsemblGenomes-Tr; EBT00001651366.
DR   EnsemblGenomes-Tr; EBT00001651367.
DR   EnsemblGenomes-Tr; EBT00001651368.
DR   EnsemblGenomes-Tr; EBT00001651369.
DR   EnsemblGenomes-Tr; EBT00001651370.
DR   EnsemblGenomes-Tr; EBT00001651371.
DR   EnsemblGenomes-Tr; EBT00001651372.
DR   EnsemblGenomes-Tr; EBT00001651373.
DR   EnsemblGenomes-Tr; EBT00001651374.
DR   EnsemblGenomes-Tr; EBT00001651375.
DR   EnsemblGenomes-Tr; EBT00001651376.
DR   EnsemblGenomes-Tr; EBT00001651377.
DR   EnsemblGenomes-Tr; EBT00001651378.
DR   EnsemblGenomes-Tr; EBT00001651379.
DR   EnsemblGenomes-Tr; EBT00001651380.
DR   EnsemblGenomes-Tr; EBT00001651381.
DR   EnsemblGenomes-Tr; EBT00001651382.
DR   EnsemblGenomes-Tr; EBT00001651383.
DR   EnsemblGenomes-Tr; EBT00001651384.
DR   EnsemblGenomes-Tr; EBT00001651385.
DR   EnsemblGenomes-Tr; EBT00001651386.
DR   EnsemblGenomes-Tr; EBT00001651387.
DR   EnsemblGenomes-Tr; EBT00001651388.
DR   EnsemblGenomes-Tr; EBT00001651389.
DR   EnsemblGenomes-Tr; EBT00001651390.
DR   EnsemblGenomes-Tr; EBT00001651391.
DR   EnsemblGenomes-Tr; EBT00001651392.
DR   EnsemblGenomes-Tr; EBT00001651393.
DR   EnsemblGenomes-Tr; EBT00001651394.
DR   EnsemblGenomes-Tr; EBT00001651395.
DR   EnsemblGenomes-Tr; EBT00001651396.
DR   EnsemblGenomes-Tr; EBT00001651397.
DR   EnsemblGenomes-Tr; EBT00001651398.
DR   EnsemblGenomes-Tr; EBT00001651399.
DR   EnsemblGenomes-Tr; EBT00001651400.
DR   EnsemblGenomes-Tr; EBT00001651401.
DR   EnsemblGenomes-Tr; EBT00001651402.
DR   EnsemblGenomes-Tr; EBT00001651403.
DR   EnsemblGenomes-Tr; EBT00001651404.
DR   EnsemblGenomes-Tr; EBT00001651405.
DR   EnsemblGenomes-Tr; EBT00001651406.
DR   EnsemblGenomes-Tr; EBT00001651407.
DR   EnsemblGenomes-Tr; EBT00001651408.
DR   EnsemblGenomes-Tr; EBT00001651409.
DR   EnsemblGenomes-Tr; EBT00001651410.
DR   EnsemblGenomes-Tr; EBT00001651411.
DR   EnsemblGenomes-Tr; EBT00001651412.
DR   EnsemblGenomes-Tr; EBT00001651413.
DR   EnsemblGenomes-Tr; EBT00001651414.
DR   EnsemblGenomes-Tr; EBT00001651415.
DR   EnsemblGenomes-Tr; EBT00001651416.
DR   EnsemblGenomes-Tr; EBT00001651417.
DR   EnsemblGenomes-Tr; EBT00001651418.
DR   EnsemblGenomes-Tr; EBT00001651419.
DR   EnsemblGenomes-Tr; EBT00001651420.
DR   EnsemblGenomes-Tr; EBT00001651421.
DR   EnsemblGenomes-Tr; EBT00001651422.
DR   EnsemblGenomes-Tr; EBT00001651423.
DR   EnsemblGenomes-Tr; EBT00001651424.
DR   EnsemblGenomes-Tr; EBT00001651425.
DR   EnsemblGenomes-Tr; EBT00001651426.
DR   EnsemblGenomes-Tr; EBT00001651427.
DR   EnsemblGenomes-Tr; EBT00001651428.
DR   EnsemblGenomes-Tr; EBT00001651429.
DR   EnsemblGenomes-Tr; EBT00001651430.
DR   EnsemblGenomes-Tr; EBT00001651431.
DR   EnsemblGenomes-Tr; EBT00001651432.
DR   EnsemblGenomes-Tr; EBT00001651433.
DR   EnsemblGenomes-Tr; EBT00001651434.
DR   EnsemblGenomes-Tr; EBT00001651435.
DR   EnsemblGenomes-Tr; EBT00001651436.
DR   EnsemblGenomes-Tr; EBT00001651437.
DR   EnsemblGenomes-Tr; EBT00001651438.
DR   EnsemblGenomes-Tr; EBT00001651439.
DR   EnsemblGenomes-Tr; EBT00001651440.
DR   EnsemblGenomes-Tr; EBT00001651441.
DR   EnsemblGenomes-Tr; EBT00001651442.
DR   EnsemblGenomes-Tr; EBT00001651443.
DR   EnsemblGenomes-Tr; EBT00001651444.
DR   EnsemblGenomes-Tr; EBT00001651445.
DR   EnsemblGenomes-Tr; EBT00001651446.
DR   EnsemblGenomes-Tr; EBT00001651447.
DR   EnsemblGenomes-Tr; EBT00001651448.
DR   EnsemblGenomes-Tr; EBT00001651449.
DR   EnsemblGenomes-Tr; EBT00001651450.
DR   EnsemblGenomes-Tr; EBT00001651451.
DR   EnsemblGenomes-Tr; EBT00001651452.
DR   EnsemblGenomes-Tr; EBT00001651453.
DR   EnsemblGenomes-Tr; EBT00001651454.
DR   EnsemblGenomes-Tr; EBT00001651455.
DR   EnsemblGenomes-Tr; EBT00001651456.
DR   EnsemblGenomes-Tr; EBT00001651457.
DR   EnsemblGenomes-Tr; EBT00001651458.
DR   EnsemblGenomes-Tr; EBT00001651459.
DR   EnsemblGenomes-Tr; EBT00001651460.
DR   EnsemblGenomes-Tr; EBT00001651461.
DR   EnsemblGenomes-Tr; EBT00001651462.
DR   EnsemblGenomes-Tr; EBT00001651463.
DR   EnsemblGenomes-Tr; EBT00001651464.
DR   EnsemblGenomes-Tr; EBT00001651465.
DR   EnsemblGenomes-Tr; EBT00001651466.
DR   EnsemblGenomes-Tr; EBT00001651467.
DR   EnsemblGenomes-Tr; EBT00001651468.
DR   EnsemblGenomes-Tr; EBT00001651469.
DR   EnsemblGenomes-Tr; EBT00001651470.
DR   EnsemblGenomes-Tr; Ssed_R0001-1.
DR   EnsemblGenomes-Tr; Ssed_R0002-1.
DR   EnsemblGenomes-Tr; Ssed_R0003-1.
DR   EnsemblGenomes-Tr; Ssed_R0004-1.
DR   EnsemblGenomes-Tr; Ssed_R0005-1.
DR   EnsemblGenomes-Tr; Ssed_R0006-1.
DR   EnsemblGenomes-Tr; Ssed_R0007-1.
DR   EnsemblGenomes-Tr; Ssed_R0008-1.
DR   EnsemblGenomes-Tr; Ssed_R0009-1.
DR   EnsemblGenomes-Tr; Ssed_R0010-1.
DR   EnsemblGenomes-Tr; Ssed_R0011-1.
DR   EnsemblGenomes-Tr; Ssed_R0012-1.
DR   EnsemblGenomes-Tr; Ssed_R0013-1.
DR   EnsemblGenomes-Tr; Ssed_R0014-1.
DR   EnsemblGenomes-Tr; Ssed_R0015-1.
DR   EnsemblGenomes-Tr; Ssed_R0016-1.
DR   EnsemblGenomes-Tr; Ssed_R0017-1.
DR   EnsemblGenomes-Tr; Ssed_R0018-1.
DR   EnsemblGenomes-Tr; Ssed_R0019-1.
DR   EnsemblGenomes-Tr; Ssed_R0020-1.
DR   EnsemblGenomes-Tr; Ssed_R0021-1.
DR   EnsemblGenomes-Tr; Ssed_R0022-1.
DR   EnsemblGenomes-Tr; Ssed_R0023-1.
DR   EnsemblGenomes-Tr; Ssed_R0024-1.
DR   EnsemblGenomes-Tr; Ssed_R0025-1.
DR   EnsemblGenomes-Tr; Ssed_R0026-1.
DR   EnsemblGenomes-Tr; Ssed_R0027-1.
DR   EnsemblGenomes-Tr; Ssed_R0028-1.
DR   EnsemblGenomes-Tr; Ssed_R0029-1.
DR   EnsemblGenomes-Tr; Ssed_R0030-1.
DR   EnsemblGenomes-Tr; Ssed_R0031-1.
DR   EnsemblGenomes-Tr; Ssed_R0032-1.
DR   EnsemblGenomes-Tr; Ssed_R0033-1.
DR   EnsemblGenomes-Tr; Ssed_R0034-1.
DR   EnsemblGenomes-Tr; Ssed_R0035-1.
DR   EnsemblGenomes-Tr; Ssed_R0036-1.
DR   EnsemblGenomes-Tr; Ssed_R0037-1.
DR   EnsemblGenomes-Tr; Ssed_R0038-1.
DR   EnsemblGenomes-Tr; Ssed_R0039-1.
DR   EnsemblGenomes-Tr; Ssed_R0040-1.
DR   EnsemblGenomes-Tr; Ssed_R0041-1.
DR   EnsemblGenomes-Tr; Ssed_R0042-1.
DR   EnsemblGenomes-Tr; Ssed_R0043-1.
DR   EnsemblGenomes-Tr; Ssed_R0044-1.
DR   EnsemblGenomes-Tr; Ssed_R0045-1.
DR   EnsemblGenomes-Tr; Ssed_R0046-1.
DR   EnsemblGenomes-Tr; Ssed_R0047-1.
DR   EnsemblGenomes-Tr; Ssed_R0048-1.
DR   EnsemblGenomes-Tr; Ssed_R0050-1.
DR   EnsemblGenomes-Tr; Ssed_R0051-1.
DR   EnsemblGenomes-Tr; Ssed_R0052-1.
DR   EnsemblGenomes-Tr; Ssed_R0053-1.
DR   EnsemblGenomes-Tr; Ssed_R0054-1.
DR   EnsemblGenomes-Tr; Ssed_R0055-1.
DR   EnsemblGenomes-Tr; Ssed_R0056-1.
DR   EnsemblGenomes-Tr; Ssed_R0057-1.
DR   EnsemblGenomes-Tr; Ssed_R0058-1.
DR   EnsemblGenomes-Tr; Ssed_R0059-1.
DR   EnsemblGenomes-Tr; Ssed_R0060-1.
DR   EnsemblGenomes-Tr; Ssed_R0061-1.
DR   EnsemblGenomes-Tr; Ssed_R0062-1.
DR   EnsemblGenomes-Tr; Ssed_R0063-1.
DR   EnsemblGenomes-Tr; Ssed_R0064-1.
DR   EnsemblGenomes-Tr; Ssed_R0065-1.
DR   EnsemblGenomes-Tr; Ssed_R0066-1.
DR   EnsemblGenomes-Tr; Ssed_R0067-1.
DR   EnsemblGenomes-Tr; Ssed_R0068-1.
DR   EnsemblGenomes-Tr; Ssed_R0069-1.
DR   EnsemblGenomes-Tr; Ssed_R0070-1.
DR   EnsemblGenomes-Tr; Ssed_R0071-1.
DR   EnsemblGenomes-Tr; Ssed_R0072-1.
DR   EnsemblGenomes-Tr; Ssed_R0073-1.
DR   EnsemblGenomes-Tr; Ssed_R0074-1.
DR   EnsemblGenomes-Tr; Ssed_R0075-1.
DR   EnsemblGenomes-Tr; Ssed_R0076-1.
DR   EnsemblGenomes-Tr; Ssed_R0077-1.
DR   EnsemblGenomes-Tr; Ssed_R0078-1.
DR   EnsemblGenomes-Tr; Ssed_R0079-1.
DR   EnsemblGenomes-Tr; Ssed_R0080-1.
DR   EnsemblGenomes-Tr; Ssed_R0081-1.
DR   EnsemblGenomes-Tr; Ssed_R0082-1.
DR   EnsemblGenomes-Tr; Ssed_R0083-1.
DR   EnsemblGenomes-Tr; Ssed_R0084-1.
DR   EnsemblGenomes-Tr; Ssed_R0085-1.
DR   EnsemblGenomes-Tr; Ssed_R0086-1.
DR   EnsemblGenomes-Tr; Ssed_R0087-1.
DR   EnsemblGenomes-Tr; Ssed_R0088-1.
DR   EnsemblGenomes-Tr; Ssed_R0089-1.
DR   EnsemblGenomes-Tr; Ssed_R0090-1.
DR   EnsemblGenomes-Tr; Ssed_R0091-1.
DR   EnsemblGenomes-Tr; Ssed_R0092-1.
DR   EnsemblGenomes-Tr; Ssed_R0093-1.
DR   EnsemblGenomes-Tr; Ssed_R0094-1.
DR   EnsemblGenomes-Tr; Ssed_R0095-1.
DR   EnsemblGenomes-Tr; Ssed_R0096-1.
DR   EnsemblGenomes-Tr; Ssed_R0097-1.
DR   EnsemblGenomes-Tr; Ssed_R0098-1.
DR   EnsemblGenomes-Tr; Ssed_R0099-1.
DR   EnsemblGenomes-Tr; Ssed_R0100-1.
DR   EnsemblGenomes-Tr; Ssed_R0101-1.
DR   EnsemblGenomes-Tr; Ssed_R0102-1.
DR   EnsemblGenomes-Tr; Ssed_R0103-1.
DR   EnsemblGenomes-Tr; Ssed_R0104-1.
DR   EnsemblGenomes-Tr; Ssed_R0105-1.
DR   EnsemblGenomes-Tr; Ssed_R0106-1.
DR   EnsemblGenomes-Tr; Ssed_R0107-1.
DR   EnsemblGenomes-Tr; Ssed_R0108-1.
DR   EnsemblGenomes-Tr; Ssed_R0109-1.
DR   EnsemblGenomes-Tr; Ssed_R0110-1.
DR   EnsemblGenomes-Tr; Ssed_R0111-1.
DR   EnsemblGenomes-Tr; Ssed_R0112-1.
DR   EnsemblGenomes-Tr; Ssed_R0113-1.
DR   EnsemblGenomes-Tr; Ssed_R0114-1.
DR   EnsemblGenomes-Tr; Ssed_R0115-1.
DR   EnsemblGenomes-Tr; Ssed_R0116-1.
DR   EnsemblGenomes-Tr; Ssed_R0117-1.
DR   EnsemblGenomes-Tr; Ssed_R0118-1.
DR   EnsemblGenomes-Tr; Ssed_R0119-1.
DR   EnsemblGenomes-Tr; Ssed_R0120-1.
DR   EnsemblGenomes-Tr; Ssed_R0121-1.
DR   EnsemblGenomes-Tr; Ssed_R0122-1.
DR   EnsemblGenomes-Tr; Ssed_R0123-1.
DR   EnsemblGenomes-Tr; Ssed_R0124-1.
DR   EnsemblGenomes-Tr; Ssed_R0125-1.
DR   EnsemblGenomes-Tr; Ssed_R0126-1.
DR   EnsemblGenomes-Tr; Ssed_R0127-1.
DR   EnsemblGenomes-Tr; Ssed_R0128-1.
DR   EnsemblGenomes-Tr; Ssed_R0129-1.
DR   EnsemblGenomes-Tr; Ssed_R0130-1.
DR   EnsemblGenomes-Tr; Ssed_R0131-1.
DR   EnsemblGenomes-Tr; Ssed_R0132-1.
DR   EnsemblGenomes-Tr; Ssed_R0133-1.
DR   EnsemblGenomes-Tr; Ssed_R0134-1.
DR   EnsemblGenomes-Tr; Ssed_R0135-1.
DR   EnsemblGenomes-Tr; Ssed_R0136-1.
DR   EnsemblGenomes-Tr; Ssed_R0137-1.
DR   EnsemblGenomes-Tr; Ssed_R0138-1.
DR   EnsemblGenomes-Tr; Ssed_R0139-1.
DR   EnsemblGenomes-Tr; Ssed_R0140-1.
DR   EnsemblGenomes-Tr; Ssed_R0141-1.
DR   EnsemblGenomes-Tr; Ssed_R0142-1.
DR   EnsemblGenomes-Tr; Ssed_R0143-1.
DR   EnsemblGenomes-Tr; Ssed_R0144-1.
DR   EnsemblGenomes-Tr; Ssed_R0145-1.
DR   EnsemblGenomes-Tr; Ssed_R0147-1.
DR   EnsemblGenomes-Tr; Ssed_R0148-1.
DR   EnsemblGenomes-Tr; Ssed_R0149-1.
DR   EnsemblGenomes-Tr; Ssed_R0150-1.
DR   EnsemblGenomes-Tr; Ssed_R0151-1.
DR   EnsemblGenomes-Tr; Ssed_R0152-1.
DR   EnsemblGenomes-Tr; Ssed_R0153-1.
DR   EnsemblGenomes-Tr; Ssed_R0154-1.
DR   EnsemblGenomes-Tr; Ssed_R0155-1.
DR   EnsemblGenomes-Tr; Ssed_R0156-1.
DR   EnsemblGenomes-Tr; Ssed_R0157-1.
DR   EnsemblGenomes-Tr; Ssed_R0158-1.
DR   EnsemblGenomes-Tr; Ssed_R0159-1.
DR   EnsemblGenomes-Tr; Ssed_R0160-1.
DR   EnsemblGenomes-Tr; Ssed_R0161-1.
DR   EnsemblGenomes-Tr; Ssed_R0162-1.
DR   EnsemblGenomes-Tr; Ssed_R0163-1.
DR   EnsemblGenomes-Tr; Ssed_R0164-1.
DR   EnsemblGenomes-Tr; Ssed_R0165-1.
DR   EuropePMC; PMC3638456; 23479745.
DR   EuropePMC; PMC3638466; 23479755.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000821.
DR   SILVA-SSU; CP000821.
DR   StrainInfo; 620969; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002758
CC   Source DNA and bacteria available from Jian-Shen Zhao
CC   (Jian-Shen.Zhao@cnrc-nrc.gc.ca)
CC   Contacts: Jian-Shen Zhao (Jian-Shen.Zhao@cnrc-nrc.gc.ca)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5517674
FT                   /organism="Shewanella sediminis HAW-EB3"
FT                   /strain="HAW-EB3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:425104"
FT                   /type_material="type strain of Shewanella sediminis"
FT   gene            complement(521..1882)
FT                   /locus_tag="Ssed_0001"
FT   CDS_pept        complement(521..1882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0001"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="KEGG: slo:Shew_3865 tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34614"
FT                   /db_xref="GOA:A8FP41"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP41"
FT                   /protein_id="ABV34614.1"
FT                   /translation="MTTDTIVAQATAPGRGGVGIIRISGDQASEVAMALLGHIPKTRYA
FT                   DYCDFKDGEGEVIDQGIALYFQGPNSFTGEDVLELQGHGGQIVLDMLIKRVMEVEGIRI
FT                   AKPGEFSEQAFMNDKLDLTQAEAIADLIDATSEQAAKSALNSLQGEFSTQVHELVDRVT
FT                   NLRLYVEAAIDFPDEEVDFLSDGKIAGSLYRIITKLDSVQASAKQGAIIREGMKVVIAG
FT                   RPNAGKSSLLNALAGKESAIVTEIAGTTRDVLREHIHLDGMPLHIIDTAGLRDTADTVE
FT                   QIGIERAWAEIETADQVLFMVDGTTTDAVDPHEIWPDFIDRLPEKLGITVVRNKADITG
FT                   EALTVTQDHGHNVFRISAKTGLGVEELQQHLKSLMGYQSNLEGGFIARRRHLEALELAT
FT                   SHLMIGKEQLEVYQAGELLAEELRMTQMALSEITGKFTSDDLLGKIFSSFCIGK"
FT   gene            complement(1997..3631)
FT                   /locus_tag="Ssed_0002"
FT   CDS_pept        complement(1997..3631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0002"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="KEGG: slo:Shew_3866 60 kDa inner membrane insertion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34615"
FT                   /db_xref="GOA:A8FP42"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP42"
FT                   /protein_id="ABV34615.1"
FT                   /translation="MESQRNILLIGLLFVSFLLWQQWQTDQAPQPVAMESSSTIPSSST
FT                   SDSHSSDVPDADSALPAAVVASKELITVNTDQLIIKINPIGGDIVYSALVEHKLELDKD
FT                   EPFVLLEQTKDINYIAQSGLIGRNGIDSSSKGRAHFDSASREYTLASGQDTLEVPLTFV
FT                   ADNGATYTKMFVFHRGQFKVDVDYVIDNSTDQQLQVQMYGQIKHSIKQSESSMMMPTYR
FT                   GAAFSTANTRYEKYSFDDMADKNLDEKTLGGWAAMLQHYFVSAWVPPANDQNIIFSSIS
FT                   AGGQANIGFRGAVYDVAPGATQTINSEFYVGPKNQEALSAISESLNLVVDYGFLWWLAV
FT                   PIYKLLMFFQSLVTNWGLAIILITLTVRGMLYPLTKAQYTSMAKMRNLQPKLAEMKERF
FT                   GDDRQKMGQAMMELYKKEKVNPMGGCLPILLQMPIFIALYWVLLESVELRHAPFMLWIT
FT                   DLSVQDPYYVMPILMGISMFVMQKMQPMAPTMDPMQQKMMQWMPVVFTVFFLWFPAGLV
FT                   LYWLVGNLVAITQQKIIYAGLAKKGLK"
FT   sig_peptide     complement(3566..3631)
FT                   /locus_tag="Ssed_0002"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.758 at
FT                   residue 22"
FT   gene            complement(3635..3892)
FT                   /locus_tag="Ssed_0003"
FT   CDS_pept        complement(3635..3892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0003"
FT                   /product="protein of unknown function DUF37"
FT                   /note="KEGG: slo:Shew_3867 protein of unknown function
FT                   DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34616"
FT                   /db_xref="GOA:A8FP43"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP43"
FT                   /protein_id="ABV34616.1"
FT                   /translation="MAKTQSPLQWLATTLIRGYQVFISPFLGANKCRFHPTCSTYAIEA
FT                   IRLHGFAKGSWLAARRILKCHPLHPGGIDPVPPKKHRCNK"
FT   gene            complement(3859..4221)
FT                   /locus_tag="Ssed_0004"
FT   CDS_pept        complement(3859..4221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0004"
FT                   /product="ribonuclease P protein component"
FT                   /note="KEGG: sfr:Sfri_4065 ribonuclease P protein
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34617"
FT                   /db_xref="GOA:A8FP44"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP44"
FT                   /protein_id="ABV34617.1"
FT                   /translation="MQVTSYTFTRELRLLTPAQFKSVFTKPIKASSAEITLLAIPNSEQ
FT                   HPRLGLTVAKRFVKKAHQRNRIKRIIRDNFRLHQHELPPIDIVVLVRNGVVEMENTDLH
FT                   KLVEKLWRKLNRRYNG"
FT   gene            complement(4230..4367)
FT                   /locus_tag="Ssed_0005"
FT   CDS_pept        complement(4230..4367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0005"
FT                   /product="ribosomal protein L34"
FT                   /note="KEGG: shw:Sputw3181_4095 ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34618"
FT                   /db_xref="GOA:A8FP45"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP45"
FT                   /protein_id="ABV34618.1"
FT                   /translation="MSKRTFQPSNLKRKRSHGFRARMATVGGRKVLARRRAKGRARLSA
FT                   "
FT   gene            4812..6200
FT                   /locus_tag="Ssed_0006"
FT   CDS_pept        4812..6200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0006"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34619"
FT                   /db_xref="GOA:A8FP46"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP46"
FT                   /protein_id="ABV34619.1"
FT                   /translation="MAVSLWQQCIGRLQDELSAQQFSMWIRPLQAQMDGDTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSRPSAPRPVQATAAVERPKFEQNTK
FT                   PAKTSFNVNSPEPAMAANHRSNINRTYQFENFVEGKSNQLGKAAAMQVAENPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDKYPKEIDGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVA
FT                   RPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDTKEDYANLIR
FT                   TLSS"
FT   gene            6220..7320
FT                   /locus_tag="Ssed_0007"
FT   CDS_pept        6220..7320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0007"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: slo:Shew_0002 DNA polymerase III, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34620"
FT                   /db_xref="GOA:A8FP47"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP47"
FT                   /protein_id="ABV34620.1"
FT                   /translation="MKFSIDRDALLKPLQLVTGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGQVQLEGDVQEGRTTIPAKKFLDIVKSLPDQVELKIEQQENRLLLRSGRS
FT                   RFTLATLPAEEYPNVEAFQADIEFTIKQGTLKSLIDATQFSMANQDVRYYLNGLLLETE
FT                   GNVLRAIATDGHRLALSHRMVEESLPEKQVIVPRKGVVELQRLFEGEDLDITIAIGDNA
FT                   IRATTGSAVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALLRASILSNEKFRGV
FT                   RVQLENNLIKITANNPEQEEAEEILDVEYENTPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIENHIEENSMYVVMPMRL"
FT   gene            7614..8696
FT                   /locus_tag="Ssed_0008"
FT   CDS_pept        7614..8696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0008"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: slo:Shew_0003 DNA replication and repair
FT                   protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34621"
FT                   /db_xref="GOA:A8FP48"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP48"
FT                   /protein_id="ABV34621.1"
FT                   /translation="MSLTRLHIETFRNITSAQLLPGEGINLIYGHNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVIQHSDDKLTLFANLNVLDKESKIGLRRFRSGETEVKIDGDKVKR
FT                   LSTLAESLPIQVITPESFALLFEGPKSRRQFIDWGAFHCDKSFHSAWVNVKRILKQRNQ
FT                   LLKNETSYSQIQFWDKELVRYSEVVTDIRTRYVNSLNEQLKGIIGEFLPLVDVKVSFTR
FT                   GWDSKTDYAQLLEMQYPRDLASGNTGSGPHKADLRLRVGTLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKNSIYLVDDLPAELDAKHRQLLLQQLIDTGAQVFVTAIEPAAILDS
FT                   LITPPSKTFHVEHGRVTVIE"
FT   gene            8689..11130
FT                   /locus_tag="Ssed_0009"
FT   CDS_pept        8689..11130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0009"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: slo:Shew_0004 DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34622"
FT                   /db_xref="GOA:A8FP49"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP49"
FT                   /protein_id="ABV34622.1"
FT                   /translation="MNNRRENNMSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGL
FT                   HHMVFEVVDNSIDEALAGHCNDVIITIHADGSVSVKDDGRGIPVAIHPEEGISAAEVIM
FT                   TVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSHKLQLTIRRDGKLYEQFYTHGEPDEPI
FT                   KAIGDATNTGTEIRFWPSTDTFTDVLFHFDILAKRVRELSFLNSGVGVRLVDERDNRDE
FT                   FFKYDGGISAFVDYLNVNKTPVNKEVFHFIQERDDGITVEVAMQWNDGFQENIFCFTNN
FT                   IPQRDGGTHLAGFRGALTRNLNTYMEREGYNKKGKTGATGDDAREGLTAVISVKVPDPK
FT                   FSSQTKDKLVSSEVKSAVEQTMGEQLGDYLMEHPNEAKLIVGKIIDAARAREAARKARE
FT                   MTRRKGALDLGGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGK
FT                   ILNVEKARFDKMLSSQEVATLITALGCGIGRDEYDPDKTRYHNIVIMTDADVDGSHIRT
FT                   LLLTFFFRQMPELIERGFVYIAQPPLYKVKKGKQEQYLKDDPALTEFLTNLALDGGEIH
FT                   ASANAPAMSGAPLEKLVYQYREVEAIFDRLDQRYPLMLTERMLYHPALSNDVLADEAKV
FT                   QQWCDAYVADLAEKESGGYIFSGEAFLEPERQVYLPKITIRKHGIDTHYLFSYDFLQSS
FT                   DYERMAKLATALDGLIEEGGYVKRGERLKEVSSFVEALDWLMNDSRRGLYIQRYKGLGE
FT                   MNPEQLWETTMDPESRRMLVVTIEDAIAADQLFTCLMGDQVEPRREFIESNALNVANLD
FT                   V"
FT   gene            complement(11580..12326)
FT                   /locus_tag="Ssed_0010"
FT   CDS_pept        complement(11580..12326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0010"
FT                   /product="LamB/YcsF family protein"
FT                   /note="KEGG: slo:Shew_0006 LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34623"
FT                   /db_xref="GOA:A8FP50"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP50"
FT                   /protein_id="ABV34623.1"
FT                   /translation="MLSNPKGYPIDLNADLGEGSEFDAELLLLITSANIACGGHAGDPL
FT                   SMRKTVIQALKSKVNVGAHPSFPDRENFGRVSIDISGKQLSDSIYQQIMALRAICDELG
FT                   AKLFHVKPHGAFYNEVAKDKVLGRILIDVIKRIDPELKLMILAGSPLVKQARQHGLTVI
FT                   EEAFADRTYLSDGSLAPRSEVGAVIHDPQQALQQVRQIVGNMPVTTLGGQPIIINATSI
FT                   CLHGDNQQALEFAKLISENLTEARKP"
FT   gene            complement(12470..13456)
FT                   /locus_tag="Ssed_0011"
FT   CDS_pept        complement(12470..13456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0011"
FT                   /product="UreA amidolyase related protein"
FT                   /note="KEGG: slo:Shew_0007 UreA amidolyase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34624"
FT                   /db_xref="GOA:A8FP51"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP51"
FT                   /protein_id="ABV34624.1"
FT                   /translation="MTKRNSIQVLKAGMHSSVQDLGCTGYRHLGITTGGALDRHALILA
FT                   NRLLGNSDASAGIELTSGIVELKFNCDTWFVLTGANYRISIGQRDIWCNWRNKIRAGET
FT                   LTLRGPKSGMRAYLALEGGIVDGIEGEIRDGSPETNNKLRLKSDSLLGDRFSGVLGAVL
FT                   KDGDRLALGQAGAISKPIGAVQRGYSNEIRALPGPEMPLFSEESKKAFWNSSWQLTNES
FT                   NRMGARLSGITLSLAQQQDMESHAVMPGAVQVPPAGQPIVLLADSQTTGGYPKIATVIE
FT                   ADLWKLAQTRPGEEVRFVHVSPNQADDANYEWEEYFYRLQRAIEANG"
FT   gene            complement(13485..14171)
FT                   /locus_tag="Ssed_0012"
FT   CDS_pept        complement(13485..14171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0230 conserved hypothetical protein
FT                   TIGR00370, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34625"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP52"
FT                   /protein_id="ABV34625.1"
FT                   /translation="MTTEQTPKVFRLGEGAVVIDSTNYFPEVSRLSIQRKIWWLADRCR
FT                   QTDEFIDIVPGMNNLTLFVKSNNRINYWLAQLGTLWLQAKEMSLSGRNVEIPLVYGGEF
FT                   GPDLERLAKYHQLSCKEVVRRHSNGKYTVLFLGFQPGFPYLDGLDSSLFTPRLAVPRLS
FT                   IPAGSVGIGGNQTGIYPASAPGGWQLIGRTNMPLFTPESIGSPTLVEPGDTVQFIPVTS
FT                   LVFSAK"
FT   gene            14650..15705
FT                   /locus_tag="Ssed_0013"
FT   CDS_pept        14650..15705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0013"
FT                   /product="putative signal transduction protein"
FT                   /note="KEGG: sbl:Sbal_0011 putative signal transduction
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34626"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP53"
FT                   /protein_id="ABV34626.1"
FT                   /translation="MVIKLFQKIFNIRDNAVVSQPKSFSQNPELQQISSNKPKASLEPL
FT                   SAVEDSVDVSALFYSLLFPARQKDQGGVANNLEKNVIGDVERALSSPMAIAENVLKLPT
FT                   RMAELNKKLGDESVDIKVLLELMQKDPVLSVEVLKLCNSPVFKRSEREVTSLQQAFVQL
FT                   GRDQLRRFVTTSLVREMIEIKPIYYRRFGLQIWRHSMQVAFLSSELAGELSNDDPDTAF
FT                   MLGLLHDVGKIAIFKMLLDEFNLADPGEQPCSSLFRQVMTSKSLSLSALLARCWQLPAS
FT                   FEVTLNALANTSAKPTERLAAVVWRANLISECSMLHQAGKLDEFGLNRLLIDADLTREE
FT                   FDLFHEKLKEF"
FT   gene            complement(15774..17843)
FT                   /locus_tag="Ssed_0014"
FT   CDS_pept        complement(15774..17843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0014"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: slo:Shew_0009 glycine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34627"
FT                   /db_xref="GOA:A8FP54"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP54"
FT                   /protein_id="ABV34627.1"
FT                   /translation="MNFENLLIEVGTEELPPKSLRKLAESFLSNFTDELKKAELSFESA
FT                   VWHAAPRRLAICVNQLALAQADKVVEKRGPAIAQAFDTDGNPTKAAMGWARGNGITVEQ
FT                   AGRLKTDKGEWLLHQAKVVGVETKSLIAAMAQRSLDKLPIPKPMRWGNNTTQFIRPVHT
FT                   VTMLLGSEVVEGELLGQKSARIIRGHRFMGKASFELVHADNYLSALKEQGKVEANYEVR
FT                   KALIKAGAEAAAAKIGGVADLEDDLLEEVTSLVEWPVVLTANFEEKFLDVPAEALVYTM
FT                   KGDQKYFPVFDKAGQLMPNFIFVTNIESKDPQQIIAGNERVVRPRLADAEFFFETDKKD
FT                   SLESRLTSLETVIFQKQLGTIKDRVARISDMAGFIANSIDANADEAARAGLLSKSDLMT
FT                   NMVMEFTDLQGTMGMHYARLNGETEAVALALQEQYKPKFSGDTVPTAPVSVCVALAEKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGILRICVENNLPLNLIDLIAKAQELHGSNLTN
FT                   DKAAEQVLEFFMGRFRAWYQDQGVSVDVILAVLARRPTSPADFDSRIKAVSHFRSLEQA
FT                   SALAAANKRVSNILAKVEGELPAAIDAGLLVENAEKVLAEKLNELQPQLAPLFAAANYQ
FT                   EALALLADLRESVDTFFEDVMVMADDEALKNNRLALLSSLREQFLHAADISLLQ"
FT   gene            complement(17855..18718)
FT                   /locus_tag="Ssed_0015"
FT   CDS_pept        complement(17855..18718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0015"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: slo:Shew_0010 glycine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34628"
FT                   /db_xref="GOA:A8FP55"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP55"
FT                   /protein_id="ABV34628.1"
FT                   /translation="MTLQEFWAQQGCAIVQPLDMEVGAGTFHPMTFLRALGPEPMSCAY
FT                   VQPSRRPTDGRYGDNPNRLQHFYQFQVVLKPSPDNIQELYLGSLAAAGIDMDIHDVRFV
FT                   EDNWESPTLGAWGLGWEVWLNGMEVSQFTYFQQVGGLECKPVTGEITYGLERLAMYIQE
FT                   VDNVYDLVWTDGPMGKVMYGDIFHQNEVEQSAYNFEHANVEVLFRTFDDCEKACQHLLN
FT                   LEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKGVAESYYQAREAL
FT                   GFPICK"
FT   gene            18917..19507
FT                   /locus_tag="Ssed_0016"
FT   CDS_pept        18917..19507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0016"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: slo:Shew_0011 DNA-3-methyladenine glycosylase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34629"
FT                   /db_xref="GOA:A8FP56"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP56"
FT                   /protein_id="ABV34629.1"
FT                   /translation="MTMEMQRCSWVGADDLYQAYHDKVWGRPVYDSQELFAKLCLDGQQ
FT                   AGLSWITILKKQQNYEAAFANFDPVIIAKFDDEKVEALLQDKGIVRNRLKVNSIIKNAR
FT                   GYISYTEQGNDFSEFLWSFVGGTPIVNTFKTMAEVPAQTPESEEMSKALKKLGFNFVGP
FT                   TICYAFMQAVGMVNDHTTDCFCYDLHLEGSEGE"
FT   gene            19576..20742
FT                   /locus_tag="Ssed_0017"
FT   CDS_pept        19576..20742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0017"
FT                   /product="Chloramphenicol O-acetyltransferase"
FT                   /EC_number="2.3.1.28"
FT                   /note="KEGG: ppr:PBPRA3400 putative transport permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34630"
FT                   /db_xref="GOA:A8FP57"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP57"
FT                   /protein_id="ABV34630.1"
FT                   /translation="MSHKSAAFIWCSNYVFQFFFCFGIFLPFYQLWLSEQGMGSESIGI
FT                   ILAVGLMSRCVASIVGGILAKHESQYQNVLRVVSALGLCTAVSMVYWSPSFYHLLILTV
FT                   LFNAAIAPVFGLSDAIIATLDKRKILSYGPTRMWGSLGFVGATVVGGYCFELWTISVLP
FT                   IILIISCSLMLFSVTLKCPDLQTARSQHKVLEEDGKHWLGAELILLLGILSLLQGSHGF
FT                   FYGFSSVYWQEIGIAEGVIGYLWGISIVSEILVFIFAKKAFSNVSPKLLLQIASAGVLV
FT                   RWGALSLAEQPLYIALSQTLHGVTFAMTHLAAIKSIQLYLPESQMAKFQGLYNGLYMAV
FT                   TALVTFITGYLFDSLKADLFIAMALFGVVGFVLTFSLNLKPIKNPVTV"
FT   gene            complement(20933..24178)
FT                   /locus_tag="Ssed_0018"
FT   CDS_pept        complement(20933..24178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0018"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: slo:Shew_0013 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34631"
FT                   /db_xref="GOA:A8FP58"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP58"
FT                   /protein_id="ABV34631.1"
FT                   /translation="MLKHKLTPLCAAIALSFTPPIFAEETLSEKEPAWQVNAPANAPLE
FT                   KVSIDVTEGTWMNVSVSPNGKHIVFDMLGDIYQIPMKGGEAKVLAKGIAWQMQPVYSPD
FT                   GKYIAFTSDEDGGDNIWVMEADGSNPRAVTEETFRLLNSPAWSPDSQYLVARKHFTGSR
FT                   SLGAGEVWMYHVAGGEGVKLTKRPNEQKDLGEPAYSPDGRYIYFSQDATPGKTFHYSKD
FT                   SVKGIYKIKRYDTQTGDIEVLIEGTGGAIRPTPSPDGKKLAYIKRDGFQSSLYMLDLRS
FT                   GETEKLYGKLDRDMQETWAIHGVYPTMSWTGDNEEIVFWAGGKINKLDVESKSVKQIPF
FT                   SIKTQLDVQPAVRFTQDLDKDKFDVKMLRMAQVSPDGKKVVYEALGKLWVKSLSDGKSD
FT                   GKRTRLTKLDSELRELFPQWSRDGKSIVFTTWDDLEQGSVRVVSLRNKRVKTLTKEPGK
FT                   YVEPTFSPDGSFVVYRKAKGGYITPRSWSQETGLYRVDTKGKENIKITPDGYQPQFGAE
FT                   SDRVYFMDHGETPELASINLDGFQKRVHYTSKHATEFRVSPDGKQLAFAERFKVWVTPF
FT                   AKHGETIEIGPKANNLPVTQLSVRAGESISWNNDSDQLYWTLGPELYQVEVDTAYAAKD
FT                   KTADDKQAKAIEPQITDIGFSQNVDVPRGTVAFVGGKVITMEDDKVIENGIVIVKNNHI
FT                   VAVGGADTEVPDDAQVIDIKGKTIMPGLFDAHAHGSQGEDEIIPQQNWELYSNLSLGVT
FT                   TIHDPSNDTTEIFAASEQQKAGNIAGPRIFSTGTILYGANGPGYTSHIDSLDDAKFHLE
FT                   RLKKVGAFSVKSYNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMIADGHTGIEH
FT                   SLPAASIYNDIKQFWSQTKVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYVPGDL
FT                   LQARSMRRPTAPDEHYNHFNVARVANEMNDLGVKPNIGAHGQREGLAAHWEMWMFAQGG
FT                   MSNLEVLKTATINPAKHFAMDHQIGSIEQGKLADLIVIDGDPLEDIRITDRVTYTMVNG
FT                   KLYNAETMNQLNGGSKNRGKERKPFFFENRTND"
FT   sig_peptide     complement(24107..24178)
FT                   /locus_tag="Ssed_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(24405..24845)
FT                   /locus_tag="Ssed_0019"
FT   CDS_pept        complement(24405..24845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34632"
FT                   /db_xref="GOA:A8FP59"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP59"
FT                   /protein_id="ABV34632.1"
FT                   /translation="MKKLIGIGFKPIKQGPMTLVESANVTQTHGVEQDFFGRPGKRQIT
FT                   VMSKDQWQLVCAELDSPLPWTTRRANLLIEGHCFCAADQGKLLRIGKLTLEITGETDPC
FT                   KKMEIAHAGLEAALTPDWRGGVTCRVLNDAIINKGDLVQLLS"
FT   gene            complement(24870..25115)
FT                   /locus_tag="Ssed_0020"
FT   CDS_pept        complement(24870..25115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0020"
FT                   /product="SirA family protein"
FT                   /note="KEGG: slo:Shew_0015 SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34633"
FT                   /db_xref="GOA:A8FP60"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP60"
FT                   /protein_id="ABV34633.1"
FT                   /translation="MSDPFSEAQHQLDALGLRCPEPVMMVRKSVRKMAQGETLLIIADD
FT                   PATTRDIPSFCEFMDHKLLASQTDSTPYQYLIQKGL"
FT   gene            complement(25322..25789)
FT                   /locus_tag="Ssed_0021"
FT   CDS_pept        complement(25322..25789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0021"
FT                   /product="YbaK/EbsC protein"
FT                   /note="KEGG: slo:Shew_0016 YbaK/EbsC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34634"
FT                   /db_xref="GOA:A8FP61"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP61"
FT                   /protein_id="ABV34634.1"
FT                   /translation="MTPAIDLLKKAHIKHTIHEYQHEASALAYGIEAATKLNLDAKLVF
FT                   KTLVAKLDSGKLVVAIIPVEEKLNMKALAKVAGVKKAAMASAEEVERSTGYVLGGVSPL
FT                   GQKRPLLTYIDTSAEQLDQLYVSGGKRGLDIELTPSALLKLTRALFAPLIV"
FT   gene            complement(26073..27236)
FT                   /locus_tag="Ssed_0022"
FT   CDS_pept        complement(26073..27236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0022"
FT                   /product="Acetyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: slo:Shew_0018 acetyl-CoA C-acyltransferase
FT                   FadA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34635"
FT                   /db_xref="GOA:A8FP62"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP62"
FT                   /protein_id="ABV34635.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKALLVRNPQL
FT                   DPNTIEDVIWGCVQQTLEQGFNIARNASLLAGLPKQIGGVTVNRLCGSSMDALHQAARA
FT                   IMTGQGDTFIIGGVEHMGHVPMNHGVDFHPGLANNVAKASGMMGLTAEMLGKMHGITRE
FT                   QQDEFAVRSHQRAHAATVEGRFANEIHPIEGHDADGALIKVEHDEVIRPETSMESLSGL
FT                   RPAFDPANGTVTAGTSSALSDGASAMLVMEEEKAKALGLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATKKALERANLSIDDLDVIELNEAFAAQSLPCVKELGLMDVVDEKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEAKDAKYGLATMCIGLGQGIATIFERP"
FT   gene            complement(27258..29408)
FT                   /locus_tag="Ssed_0023"
FT   CDS_pept        complement(27258..29408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0023"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="KEGG: shn:Shewana3_0024 fatty oxidation complex,
FT                   alpha subunit FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34636"
FT                   /db_xref="GOA:A8FP63"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP63"
FT                   /protein_id="ABV34636.1"
FT                   /translation="MIYQSPTIQVELLEDNIARLCFNASGSVNKLDRETINSLDAALDA
FT                   IQQDSHIQALVLTSAKGAFIVGADITEFLGLFAQEDSVLLPWIAEANVVFNKLEDLPFP
FT                   TISAINGFALGGGFETVLATDFRIADTTAKIGLPETKLGLIPGFGGTVRLPRLIGTDNA
FT                   LEWITSGKDQRPEAALKVGAIDAVVAPENLQASAIKMLKDALAEKLDWQSRRARKQAAL
FT                   TLPKLEAMMSFATAKGMVFKIAGKHYPAPMAAISVIEQAARCGRADALKVEHQAFVKLA
FT                   KTDVAQALIGIFLNDQLVKGKAKKAGKLAKNIDTAAVLGAGIMGGGIAYQSASKGTPII
FT                   MKDIAQPALELGLGEASKLLAAQIKRGRSTPQKMAKVLNNITATLDYTPVKDVDVVVEA
FT                   VVEHPKVKSMVLAEVEQNVSDDAIITSNTSTISINLLAKSLKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGENSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSGLLADG
FT                   ADFAAIDKVMEKQFGWPMGPAYLLDVVGIDTGHHAQAVMAEGFPDRMGKNGKDAIDIMF
FT                   EAERFGQKNSKGFYAYSVDRRGKPKKDVDPTSYELLGAEFGELKAFESEDIIARTMIPM
FT                   IIETVRCLEEGIIATPAEADMGLVFGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRELAANNGSYYQS"
FT   gene            29795..31114
FT                   /locus_tag="Ssed_0024"
FT   CDS_pept        29795..31114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0024"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /note="KEGG: shw:Sputw3181_0014 Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34637"
FT                   /db_xref="GOA:A8FP64"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP64"
FT                   /protein_id="ABV34637.1"
FT                   /translation="MDQLTNHFHAHVAELNRRVAEIVARENLSGLVIHSGQPHRQFLDD
FT                   MDYPFKVNPHFKAWLPILDNPHCWLLVNGRDKPQLIFYRPVDFWHKVADLPDEFWTAHV
FT                   DIKLLTKADKVADLLPKDIVDWAYVGEHLDVAEVLGFKTRNPDAVMSYLHYHRATKTEY
FT                   ELACMRKSNEIAVKGHVAAKNAFYNGGSEFEIQQQYLMATNQGENEVPYGNIIALNRNA
FT                   SILHYTKLENQSPQPRRSFLIDAGANFFGYASDITRTYAFEKNIFSELIEAMDRAQLEI
FT                   IDTMRPGVKYVDLHLATHQKVAQMLIDFDLATGDREGLIEQGITSVFFPHGLGHMLGLQ
FT                   VHDMGGFLHDERGTHIAAPDAHPFLRCTRTLAANQVLTIEPGLYIIDSLLQGLKQDNRQ
FT                   HQVNWNSVDLLRPFGGIRIEDNVIVHSDKNENMTRDLGLD"
FT   gene            31167..31781
FT                   /locus_tag="Ssed_0025"
FT   CDS_pept        31167..31781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0025"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="KEGG: slo:Shew_0021 protein of unknown function
FT                   UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34638"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP65"
FT                   /protein_id="ABV34638.1"
FT                   /translation="MTDSYQVPSAELVIEEEIKHSRFISVLFHCQSYEELKCVLTNVKA
FT                   DYPGASHYCYAFVAAEPQNSIAIGSSDDGEPAGSAGRPMLATLQGANVGEIGAIVVRYF
FT                   GGTKLGVGGLVRAYSSGIKQGLTQLQTELKQIRYPGSLVCEYSQLKDVEYLLNQYDAVV
FT                   EDRSFAEKVTLEFEIPKRYQETLNLGLATMSQGMLSAKFKS"
FT   gene            31956..33413
FT                   /locus_tag="Ssed_0026"
FT   CDS_pept        31956..33413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0026"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="KEGG: slo:Shew_0022 potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34639"
FT                   /db_xref="GOA:A8FP66"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP66"
FT                   /protein_id="ABV34639.1"
FT                   /translation="MQYRTIIRITGLLMGLFSLSLLPPALVAVIYKDGGGTAFIQAFAL
FT                   SLFLGFILWYPNRKHHKDLRTREGFLLVVLFWGVLGSIGAVPFIFTAQPDLSMTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGIGGMQLYRA
FT                   EMPGPVKDSKMTPRIAETAKALWYIYFALTIACAFAYWVAGMDLFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSTAINMVCVVFLLIAALNFSLHFAAFTRRGINLKVYFRDAEFKALII
FT                   VQLVLTGICFATLYHSGIYDSPEETLDFALFQAVSISTTAGFGTESFHVWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVMRMILLLKQGSRELKRLVHPRGMFSIRIGNKALPERVIDAV
FT                   WGFFSAYALVFVICMLALMAMGMDNITAFSATAACLNNLGPGLGEVASNYASISDGAKW
FT                   VLLIAMLFGRLEVFTLLVLFTPTFWRT"
FT   sig_peptide     31956..32042
FT                   /locus_tag="Ssed_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.701 at
FT                   residue 29"
FT   gene            33511..34038
FT                   /locus_tag="Ssed_0027"
FT   CDS_pept        33511..34038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0027"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: slo:Shew_0023 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34640"
FT                   /db_xref="GOA:A8FP67"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP67"
FT                   /protein_id="ABV34640.1"
FT                   /translation="MSNTLIIYSTVDGQTKSICELVQGINEGAGDSVTLASLDEAKLLN
FT                   LADFDKILIGASIRYGKHRPELYQYINHHHAVLSAKQNAFFTVNVVARKPEKNTPETNP
FT                   YMKKFLELSLWKPQQLAVFAGKIDYPSYRFFDKTMIRLIMWITKGPTDTSGTYEFTDWE
FT                   QVEEFAKAFSEQ"
FT   gene            complement(34180..34488)
FT                   /locus_tag="Ssed_0028"
FT   CDS_pept        complement(34180..34488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0028"
FT                   /product="regulatory protein, ArsR"
FT                   /note="KEGG: shw:Sputw3181_0018 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34641"
FT                   /db_xref="GOA:A8FP68"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP68"
FT                   /protein_id="ABV34641.1"
FT                   /translation="MQKEIDVDAMVTNAESAAKWLKAIANPYRLMILCLLLENEYSVTE
FT                   LNETVPLSQSALSQHLAVLRAQDLVSTRKSSQVVYYKLKNEQVTKIISILHSQYCAN"
FT   gene            34690..35229
FT                   /locus_tag="Ssed_0029"
FT   CDS_pept        34690..35229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0029"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: slo:Shew_0025 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34642"
FT                   /db_xref="GOA:A8FP69"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP69"
FT                   /protein_id="ABV34642.1"
FT                   /translation="MKSVLVLYYSRGGHTAKISRAIAEHIENGGNTCAVMHISEAMKEG
FT                   LDWSKYDSVALGACVMYGTYDKSVFEFTTKHQAALSEKPSSFYSVNVVARKPEKRVPEN
FT                   NKYLQKFIELSPWKPKDVKVIAGKVDYPSWRWWDRLAIQLIMKMTDGPTDPKTVIDYTD
FT                   WDDVKVYADHIVSLAD"
FT   gene            35726..36166
FT                   /locus_tag="Ssed_0030"
FT   CDS_pept        35726..36166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34643"
FT                   /db_xref="GOA:A8FP70"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP70"
FT                   /protein_id="ABV34643.1"
FT                   /translation="MNFSFPNKMSIFTRVFQLILCITLIFILAKLFFEAGVLGVNPILK
FT                   NIVFISSCLAIGWIFKIKYYWNYQQDHQDHLSVILGINLFGFSFVKIFDNGILVMKHRG
FT                   FWKKQLNLDVNSSLTVTVRLDQSQSPSFGCLAVKNSKQLVST"
FT   gene            complement(36602..38044)
FT                   /locus_tag="Ssed_0031"
FT   CDS_pept        complement(36602..38044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0031"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="KEGG: slo:Shew_3740 potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34644"
FT                   /db_xref="GOA:A8FP71"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP71"
FT                   /protein_id="ABV34644.1"
FT                   /translation="MLNLRPLLFILGIFLSTLTVFMFVPLFFALFYGEETVGAFMIASL
FT                   LTGTCASACMHQGRGHQLHLNIRDMFLLTSLTWLIVSFFAAMPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDKMDHSILIWRSLLQWMGGIGFIVMAVAVLPFLNVGGMRLFRTE
FT                   SSDWSDKAIPRTQDMAKHLFYIYIFLTICCGLAYHWAGMSWFEAINHSMTTLSTGGYST
FT                   SDSSMAAFSNQAHWVGTLFMAAGGLPLLIFVNCIQHRSLWVWNDAQVKGFLLFLSTVSI
FT                   GLAFWLWLGHEMTPIDALRLASFNVVSVVTTTGYGLTDYTAWGALANVAFLFLMFVGSC
FT                   SGSTSGGIKIFRFQIAIAIMREQLKQQFHPNGVFKERYNNRVISEDIVRSLVTFVLLFM
FT                   LVIVVLSIILVMTGLDPTTSFTGAVTAVTNVGPGLGHTIGPAGNFSTLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPGFWKY"
FT   gene            complement(38087..39496)
FT                   /locus_tag="Ssed_0032"
FT   CDS_pept        complement(38087..39496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0032"
FT                   /product="TrkA-N domain protein"
FT                   /note="KEGG: slo:Shew_3739 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34645"
FT                   /db_xref="GOA:A8FP72"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP72"
FT                   /protein_id="ABV34645.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDRSRLRSLQDKYDL
FT                   RVVFGHGAHPNVLKEAGAEDADMLIAVTNSDECNMSACQMAYTLFGTPTKIARIRSEQY
FT                   LALRDKLFINTETKKNDNSPRGGFIIDELIAPEQLVTAYIRRLVEYPGALQVLEFAEGR
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHVRAVMSEMQKLDNSYRNIMIAGGGNIGFGLAQQLQRNHSVKLIEHRQERAEEL
FT                   SEKLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SKTSKVVGKQIGNIKLPPGTTIGAIVRDEEVLMAHDKTVIEQGDHVILFLVNKKFIGEV
FT                   EKLFQPSAFFF"
FT   gene            complement(39506..40786)
FT                   /locus_tag="Ssed_0033"
FT   CDS_pept        complement(39506..40786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0033"
FT                   /product="sun protein"
FT                   /note="KEGG: slo:Shew_3738 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34646"
FT                   /db_xref="GOA:A8FP73"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP73"
FT                   /protein_id="ABV34646.1"
FT                   /translation="MNLRALAAKVVFQVLEKGISLSVALPDQQRHLESGKDKALMAELC
FT                   YGVMRHLPQLDKLVSDCMSKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGLVKVVNGVLRNIQRQEKPLPTDNETLALNTPAWIIKRLKAAYPESWKEIVEQS
FT                   HQRPPMWLRSNKLSQTRDEYLASLAEVEIQASAGKSSDAILLESPKDVLQLPGFEEGTA
FT                   SVQDGAAQWAATLLAPIDGELVLDACAAPGGKTCHLLEQAPNIELVAVDFDANRLERVQ
FT                   QNLDRLSLNAKLIHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADI
FT                   EELASLQSKILDHCWQWLKPGGTLLYATCSILPQENEQQIRAFLERANDATLVPIDEQN
FT                   HPDDIGWQITPGLENMDGFYYARLVKG"
FT   gene            complement(40788..41777)
FT                   /locus_tag="Ssed_0034"
FT   CDS_pept        complement(40788..41777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0034"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="KEGG: she:Shewmr4_0028 methionyl-tRNA
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34647"
FT                   /db_xref="GOA:A8FP74"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP74"
FT                   /protein_id="ABV34647.1"
FT                   /translation="MKPLNIIFAGTPDFAARHLQALIDSEHNIIGVYSQPDRPAGRGKK
FT                   LQASPVKSLAIEHNLPVFQPKSLRDEQAQAELANLNADIMVVVAYGLILPKVVLDTPKL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDTETGVTIMQMDIGLDTGDMLLKTRLPIEDNDT
FT                   SASLYEKLALQGPDALIEALTGLAKGELTAEKQDESLANYAEKLSKEEAELDWSKSALE
FT                   LWREIRAFNPWPISHFTHQDASIKVRESAVSNLSSDAPAGTIISAGKQGIDIATGDGVL
FT                   TLLNMQLPGKKPLSVGDILNSRGEWFTPGTLLNSKKLIGKEPAVKEAE"
FT   gene            complement(41785..42297)
FT                   /locus_tag="Ssed_0035"
FT   CDS_pept        complement(41785..42297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0035"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: slo:Shew_3736 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34648"
FT                   /db_xref="GOA:A8FP75"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP75"
FT                   /protein_id="ABV34648.1"
FT                   /translation="MSLLKVLRFPDERLRTIAKPVAEFNADLQAQIDNMFDTMYEEKGI
FT                   GLAATQVDFHQHLIIMDLQDDVERPTVFINMEITARDGSCTNEEGCLSVPGIYANVDRA
FT                   ESVTIKAFDREGVEFTLDADGLFAICLQHELDHLNGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RLEAKQG"
FT   gene            42423..43526
FT                   /locus_tag="Ssed_0036"
FT   CDS_pept        42423..43526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0036"
FT                   /product="peptidoglycan-binding LysM"
FT                   /note="KEGG: slo:Shew_3735 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34649"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP76"
FT                   /protein_id="ABV34649.1"
FT                   /translation="MENPMKRLILLALMIISCSFVFADTLTLKSGHPDSYVVKKGDTLW
FT                   DISEHFLNDPWRWPKLWGANPQIANPHLIYPGDRLTLVFIDGEPRLVVKPHIRKSPEGR
FT                   IMPKGGAIPAVDLSLIRPFLVQNRVVDGDWFDEQPLVMGGESESKYHIANDIIYVQAEL
FT                   TLGDKFGVYAQGREFVSKEEGELLGQEVMLTASGRVIESGPISKVRLLSNFRETKAGYR
FT                   VLPIEEDSLLSAYFMPRAANLETPASVIASDKKNREMGKLDVVYIDKGNEDGVEAGHVF
FT                   SIFREGVDIVINGDGQPVLPQDRSTYESLLTGISSDNAVKMPDIYRGKLMVFKVFDKTS
FT                   LALIMVNERPVRVDDKLIQPSSLLASE"
FT   sig_peptide     42423..42494
FT                   /locus_tag="Ssed_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            43565..44671
FT                   /locus_tag="Ssed_0037"
FT   CDS_pept        43565..44671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0037"
FT                   /product="DNA protecting protein DprA"
FT                   /note="KEGG: slo:Shew_3734 DNA protecting protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34650"
FT                   /db_xref="GOA:A8FP77"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP77"
FT                   /protein_id="ABV34650.1"
FT                   /translation="MITEKLVDWLVVSAVSGLGPARIQQLLNYMDVEELRQRLEHEKDA
FT                   LPLPESLLKRELAPDFSLVDSALDWLQSSSHHHIVTLDDPHYPNLLKQISDPPSILFIK
FT                   GEPDTLLLPSIAVVGSRAATSAGLQSAYQLAGELGSIGFSVSSGMAAGVDGAAHQACID
FT                   NSAKTIAVLGTGVEVIYPRRHKKLYEKIQCHGAVISEFWPDVKPYAGNFPKRNRIISGL
FT                   SLGTLVVEACRRSGSLITARLALEQGREVFAVPGNILGGQSQGCHDLLRDGAKLVENAA
FT                   DIIEEVSVLCDFHLEELKSRHHIGGENASDLPFTSLLASVGYETTPIDVVVEHSGKAIE
FT                   LVLEQMLELELQGWVAVVPGGYVRLRRS"
FT   gene            44674..45147
FT                   /locus_tag="Ssed_0038"
FT   CDS_pept        44674..45147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0038"
FT                   /product="protein of unknown function DUF494"
FT                   /note="KEGG: slo:Shew_3733 protein of unknown function
FT                   DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34651"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP78"
FT                   /protein_id="ABV34651.1"
FT                   /translation="MFDILMYLFENYVHSEVEFLVDEDELTQELTRAGFHQSEIIKALS
FT                   WLENLAELQEGDTPYLCDHDQHSFRIYTQKEMDKLDVECRGFLLFLEQIKVLSVETREM
FT                   VIDRVMELDETALILEDLKWVVLMVLFNAPGNESAYEQMEDLIFEQPDGRLHS"
FT   gene            complement(45367..47139)
FT                   /locus_tag="Ssed_0039"
FT   CDS_pept        complement(45367..47139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0039"
FT                   /product="Microbial collagenase"
FT                   /EC_number="3.4.24.3"
FT                   /note="KEGG: slo:Shew_3732 microbial collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34652"
FT                   /db_xref="GOA:A8FP79"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP79"
FT                   /protein_id="ABV34652.1"
FT                   /translation="MFRRSLIAITLISPTLMTLNGCSSSPNLIVDQTLISQINLANKDS
FT                   FFDASNPQLNKNAFEQISLALATTSDQQQADNLLYYLRAFSYFGPIDELDDTSYESLTF
FT                   GLKQLANNELLSHSSRLQEQYAVTLYRYYANSERATQLATLLPQLDSQLSSLGQSASNT
FT                   DNDYALWETLRAYGLLFNTARKEADGDLNKLLVEQDLARPLLEFAASTTSIRSDNDWPK
FT                   ANAYWALGLYRLALPASENDEPTPSEQKIDDAVADIAKQDIKLRGDKAKDTYTLGYHVN
FT                   AFAGKEACENNSELCRIPELEDVLPINHSCSDSLFILAQDLNEQELATSCTKLTSQEAN
FT                   FHQVLETRYQPTANDFNNALRVVAFKNWSQYNAYGQLLFDIDTDNGGMYIEGTPSKPGN
FT                   QATFFAYRQFWIEPEFAIWNLNHEYVHYLDGHFVKYGGFGHFPEKMVWWSEGLAEYISK
FT                   GNDNPNTLKVIKKDIDKAPSLEEIFATEYKDGQDRTYKWSYMAVRFLVENHHSDFVQLS
FT                   HYLKTDYFEGYAELMAELTDHQAQFSDWLNVQVEQFDDSEEKAKPRLNKQNRYSYRDYL
FT                   RPAHLVKDDAHRHY"
FT   sig_peptide     complement(47068..47139)
FT                   /locus_tag="Ssed_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.537 at
FT                   residue 24"
FT   gene            47275..47838
FT                   /locus_tag="Ssed_0040"
FT   CDS_pept        47275..47838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0040"
FT                   /product="DNA topoisomerase, type IA, Zn finger domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3731 DNA topoisomerase, type IA, Zn
FT                   finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34653"
FT                   /db_xref="GOA:A8FP80"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP80"
FT                   /protein_id="ABV34653.1"
FT                   /translation="MSKIDQQLFSSHEHALEKEFELCPKCGCELSIKNSKHGGFIGCNN
FT                   YPTCDYTRPLVQHESIETQVIEGSQCPECGHELAVKSGRFGIFIGCTQYPECKHIEKQD
FT                   QEVGGEEIPCPICTKGHIEHRTNRFGKSFYACSGYPKCKFLVNYPPVHETCPDCGFGIL
FT                   VERKGAAGARLECPKKQCKYKRAL"
FT   gene            47939..48496
FT                   /locus_tag="Ssed_0041"
FT   CDS_pept        47939..48496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0041"
FT                   /product="SUA5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: slo:Shew_3730 SUA5/YciO/YrdC/YwlC family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34654"
FT                   /db_xref="GOA:A8FP81"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP81"
FT                   /protein_id="ABV34654.1"
FT                   /translation="MLEQAPDEVQEIIEQGGVVAYPTEAVYGLGCDPDNDEAITRLLAL
FT                   KKRPWQKGLILVASDYQQLLPYIDESRLTNEQLNKVFVKWPGPFTFIMPIKPGLSNLLC
FT                   GSFNSLAVRVSSHPTIQAICQRLGKPLVSTSANHAGEPPAMSCEEIIAKFDGEIDALIS
FT                   GSLGAERKPSTIVDAISGKVLR"
FT   gene            48531..49451
FT                   /locus_tag="Ssed_0042"
FT   CDS_pept        48531..49451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0042"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="KEGG: shm:Shewmr7_0033 coproporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34655"
FT                   /db_xref="GOA:A8FP82"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FP82"
FT                   /protein_id="ABV34655.1"
FT                   /translation="MSVPDTSAVKAFLLDLQQRICEGLEQLDGKGTFEADSWKREEGGG
FT                   GTSRVLTNGKVFEQAGVNFSHVTGAAMPASATANRSELEGRSFEAMGVSLVIHPKNPFL
FT                   PTTHANVRFFIAKKEGADPVWWFGGGFDLTPYYPFEEDVIEWHQNAHDLCQPFGESVYP
FT                   KYKKWCDEYFFLPHRNETRGVGGLFFDDLNQDGFEKSFEFMQAVGNGFLTSYAPIVERR
FT                   KDTEYGEKEREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWQYAYT
FT                   PEENSAEALLYTDFLKPKDWLNLDE"
FT   gene            49687..50502
FT                   /locus_tag="Ssed_0043"
FT   CDS_pept        49687..50502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0043"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="KEGG: slo:Shew_3727 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34656"
FT                   /db_xref="GOA:A8FP83"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP83"
FT                   /protein_id="ABV34656.1"
FT                   /translation="MTDKYAVFGNPIAHSKSPLIHGLFAKETAQVLEYEAILAPVDEFA
FT                   SCLDEFWKGEGKGANVTVPFKEQAFNLCDELSEEAKLAGAVNTLTVQANGVIRGDNTDG
FT                   LGLVADLKRHMGELNGLSVLLVGAGGAARGSILPLLQSGISKLTIVNRTQGKAERLVDI
FT                   FSEYGEVCALPMEHEDKSYDIIINSTSSSLTGEVPNLSTQVIDTSTVCYDMMYGKEPTS
FT                   FNVWAKEQGAKLTLDGLGMLVGQAAQSFAIWRKVKPSVEPVLAELRTLL"
FT   gene            50517..50795
FT                   /locus_tag="Ssed_0044"
FT   CDS_pept        50517..50795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VP3032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34657"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP84"
FT                   /protein_id="ABV34657.1"
FT                   /translation="MNQNILFPDLQDWDEKTQSVVFPAQVQGANIECRIGLSKLSEMAL
FT                   TLLKSTDSDIKEKALNLFEEYRFDIEEEVETLIELESFDEQGRLVVK"
FT   gene            complement(50829..51383)
FT                   /locus_tag="Ssed_0045"
FT   CDS_pept        complement(50829..51383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0045"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: slo:Shew_3725 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34658"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP85"
FT                   /protein_id="ABV34658.1"
FT                   /translation="MTILKNTQSLRSYKGMTPELKNNVYVDEACVLVGDIFLDEDASIW
FT                   PLVAARGDVNHIRIGKRSNVQDGTVLHVTRKSNAKPDGNPLLIGDDVTIGHKAMLHGCT
FT                   VGNRILVGMGAIILDGAILEDDVILGAGSLVPPGKVLKSGHLYVGSPAKQVRELTQAEL
FT                   AFLPQSADNYVKLKNEYLEEA"
FT   gene            51967..53501
FT                   /locus_tag="Ssed_R0001"
FT   rRNA            51967..53501
FT                   /locus_tag="Ssed_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            53841..56736
FT                   /locus_tag="Ssed_R0002"
FT   rRNA            53841..56736
FT                   /locus_tag="Ssed_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            56874..56989
FT                   /locus_tag="Ssed_R0003"
FT   rRNA            56874..56989
FT                   /locus_tag="Ssed_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            58078..60588
FT                   /locus_tag="Ssed_0046"
FT   CDS_pept        58078..60588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0046"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: slo:Shew_3724 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34659"
FT                   /db_xref="GOA:A8FP86"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP86"
FT                   /protein_id="ABV34659.1"
FT                   /translation="MLLLKLSRPSLVFVVPIFALTLYCCLTCVDFFYERSEMQREAIAS
FT                   EVTRIEQHLIKMQHIVESALVIQDSARIEQEIALAATDFNIMVYTILNQASNIRFANHI
FT                   VWRNSKAVDVIDGYDPVTHKQVSSLNRPYIAINLERLAVQAYYPLDIKFQENSSDLHDL
FT                   IYLEYDIAPLINSVNKDVQRSAIRSSAIHLLGLMIFLVLLHFYLVRPLKALSLQASAVT
FT                   NRARSEELEDSNKPIVSLFSEVAAIQSHLSGFYEKLQLSEKQLNDSQQRWLFAVEVSRN
FT                   GIWDWNLITDEVFLSDRWKEMLGYHSDELKDELKTWQAMLHPEDKAEALNTLHKYLNGE
FT                   VEEFESVHRLKHKSGHYIWVLDRGMIVDWDSKGRPVRMIGTHTDVSDDVRNQQAIMHQI
FT                   NHDLLTDLANRRALLDELYRIKEQKQSGSVALFVIDLDNFKMINDALGHHHGDRLLIQV
FT                   AARLSSYFSNNALIARLSADEFVILAQGLSDDQSVAKRRTMALASQIRQMIGRSFHINN
FT                   QTLNISASVGICVLDKLSDIDPEQVLQHADLAMHQAKEQGRDAHVVYSADMERVAQNSL
FT                   LIKSELKNAIELNQLSLVYQPIVDREGEIICAEALLRWQHPEKGNIPPSSFIPVAEGSE
FT                   LIQDIGHWVLSETCQYIKRLQGEDVELGSIAINVSARQFNHDDFVESLLGVIRQQGLGA
FT                   GSIELELTEYALLTNLDIIRQRMEVLKEAGISIAIDDFGTGYSSLSYLQSLPLSRLKLD
FT                   AAFVSQIGVNDASNSIVIAIINMAHSLNLQVVAEGVETQQQYEFLLQHDCDTFQGYLFN
FT                   RPLTADNFIRAVKSGKDLSLQSAG"
FT   gene            complement(60833..61006)
FT                   /locus_tag="Ssed_0047"
FT   CDS_pept        complement(60833..61006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34660"
FT                   /db_xref="GOA:A8FP87"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP87"
FT                   /protein_id="ABV34660.1"
FT                   /translation="MTFRHGVLASFMLTVFNLILMNLCFRRARRSGDTYLLYPVIAGAL
FT                   LSFILMSYFFFF"
FT   gene            complement(61185..61601)
FT                   /locus_tag="Ssed_0048"
FT   CDS_pept        complement(61185..61601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0048"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="KEGG: shw:Sputw3181_0493 type IV pilus assembly
FT                   PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34661"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP88"
FT                   /protein_id="ABV34661.1"
FT                   /translation="MSQFDEFIPTENHRQLKEENHENRQHVRLSLRKRENENLALACDG
FT                   VTVTLLHKNWLQSHKLGIANIKDIGFGGVGLITAISLDKGQEVYIDIDGYRMLVKISRT
FT                   KTINSKLNFLGARWISTDEEKIISMINKIQPALI"
FT   gene            complement(61598..62608)
FT                   /locus_tag="Ssed_0049"
FT   CDS_pept        complement(61598..62608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0049"
FT                   /product="OmpA/MotB"
FT                   /note="KEGG: sdn:Sden_3631 OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34662"
FT                   /db_xref="GOA:A8FP89"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP89"
FT                   /protein_id="ABV34662.1"
FT                   /translation="MAIKNEPLIIKRRKRQKRSATHGGAWKVAFADFTLAMMALFMVLW
FT                   ILQIADQQERTMIVQYLNGDMFASGSINPFDLSQSPSMIDLQGSIALQQAIIPATGTGV
FT                   EKAGPAIHNHIPVGEDNAKAGRGPELNSLVPGKFETQAQLEFLAREVDSVITEVNLSAN
FT                   VEIKVVPQGVRILIHDNVHQFMFTRGSSNMKPYFEDLLMALGPLLGGVENKISISGHTD
FT                   STPYAGKTFTNWELSSKRALLARRVLEYGGVKRHQIIQVTGMADQSPYIQNDPAAAANR
FT                   RIEMLVLTTSAEKQIREMTGLPKDETPSSPKLKHAQQTAEANQPRTRYPQQWVTE"
FT   gene            complement(62608..63465)
FT                   /locus_tag="Ssed_0050"
FT   CDS_pept        complement(62608..63465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0050"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="KEGG: sdn:Sden_3632 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34663"
FT                   /db_xref="GOA:A8FP90"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP90"
FT                   /protein_id="ABV34663.1"
FT                   /translation="MSKLLGLLIILLSVFGGYVWAGGNLSSLWQPAEILIIFGAGVGSL
FT                   IIANPKAVLADMYAQLRELLSVEKEDPELYPQLFGLMGMLMSQIQSQGLRVLDEHVEKP
FT                   RESSLFLMYPTVLEHPNVLQFLIDNLRLQSIGKISPHDLEHILEEEIYRIEEDRLRPAH
FT                   ALGRIAEAMPGFGILAAVMGIIITMSNIDGPITMIGVKVAAALVGTFIGIFACYCLFEP
FT                   TSKALEHLVERKSAQLRCVAAMLTAFAKGKPPMIAIDAGRKQIQSENRPTFIELERWMV
FT                   EQKS"
FT   sig_peptide     complement(63400..63465)
FT                   /locus_tag="Ssed_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(63481..64203)
FT                   /locus_tag="Ssed_0051"
FT   CDS_pept        complement(63481..64203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0051"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   family"
FT                   /note="KEGG: shw:Sputw3181_0490 RNA polymerase, sigma 28
FT                   subunit, FliA/WhiG family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34664"
FT                   /db_xref="GOA:A8FP91"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP91"
FT                   /protein_id="ABV34664.1"
FT                   /translation="MNSGQLAYQEASDEQVPNRLSENQVMSQYLPLVKRSISQLRSHCG
FT                   TVLAIEDMEQIGMMALLESSRRYPGEYDNGFISYAGQRIRGAILDELRRQDWRPRPVRQ
FT                   QAHELNDTVRKLTRLLGREPSDIEVAEAMGLNREEYRERLYASQSESMKSLDDMLSVGA
FT                   HFPDKTNVIEQFSVQKTLIKAISKLSKREQLILSLYYQHELNLKEIAGTLGLTETRICQ
FT                   LHKQAVKHLQEIYQQWER"
FT   gene            complement(64214..64672)
FT                   /locus_tag="Ssed_0052"
FT   CDS_pept        complement(64214..64672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0052"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="KEGG: sdn:Sden_3634 flagellar basal body-associated
FT                   protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34665"
FT                   /db_xref="GOA:A8FP92"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP92"
FT                   /protein_id="ABV34665.1"
FT                   /translation="MAFGNSSVSKKFSFTFVILLWSAGIFWVGWQSPSIIGGPFVTQEK
FT                   ESNTAKFYPLDRFVISVPGDKYPHYLLLEMALKSSSPNVSRTLKEADPLVRNSLMKMFS
FT                   RKHFNQLNDSHQLEALQKEALVLLSGVLSDNHYSIELEDVLFTRMVIQ"
FT   gene            complement(64688..65839)
FT                   /locus_tag="Ssed_0053"
FT   CDS_pept        complement(64688..65839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_3952 flagellar hook-length control
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34666"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP93"
FT                   /protein_id="ABV34666.1"
FT                   /translation="MISNVIDLSSGIGGTKDSLTGTKIANSQQEEPGTQASYSACSASS
FT                   IAERIPEQEAAIVSDLPPVGTLNLLISPAQTQVSTTQSGQTSPGQFMISGEYQASLNPS
FT                   GVETLNRFLHLSNDQNQTAPPFVTSPPLQGGTYSASDASKTSAHNTAQVSQLQTLTGKA
FT                   NETPLSLNQTQTSSLPLPEQPGGKHPFSSQFSASLSGERNANLHLPLTLAESRLSDVNE
FT                   AAVQVLAGGHRTQAPVSQWGPVPVTSAAPLAHQAQEMLSPLREQIRFQVDQQIKQAELR
FT                   LDPPELGKVELSIRLDGDRLHIQMHAANASVRDSLLIGLERLRAELAMDHGGQIDVDIN
FT                   QGKQEQRESSPEASSISLARGDEPDNHSTKHDSQQSNQIDLLA"
FT   gene            complement(65829..66155)
FT                   /locus_tag="Ssed_0054"
FT   CDS_pept        complement(65829..66155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0487 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34667"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP94"
FT                   /protein_id="ABV34667.1"
FT                   /translation="MSEKAGPTSIELWKRFETALQEYANAEDWDKVVKVNALMVLALKK
FT                   AGKPATKSQLVARKALATTHANILQNLHQKKDKLQQDIHQFKGQQDGLAAYQLTRLSGE
FT                   INDI"
FT   gene            complement(66124..66504)
FT                   /locus_tag="Ssed_0055"
FT   CDS_pept        complement(66124..66504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0055"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: shw:Sputw3181_0486 flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34668"
FT                   /db_xref="GOA:A8FP95"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP95"
FT                   /protein_id="ABV34668.1"
FT                   /translation="MLNEHDPFNAYKQTSLDARAAAANPHEMVRMLLDGLLDEIERASG
FT                   FMQRRSFEDKGKSINKCLNIVHGLGSMLDLENGGEVASGLNRLYDYCSRQLVTASVENN
FT                   TQALEPITKVISNVREGWANLN"
FT   gene            complement(66518..67894)
FT                   /locus_tag="Ssed_0056"
FT   CDS_pept        complement(66518..67894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0056"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="KEGG: shw:Sputw3181_0485 flagellar hook-associated 2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34669"
FT                   /db_xref="GOA:A8FP96"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP96"
FT                   /protein_id="ABV34669.1"
FT                   /translation="MISGMSGSQFAEQLIGAERMGKDQLYQSNMTKHQTQLDAYEILEK
FT                   SLNQMTKNLEKLDGDAFDSKTSTVSDDNASITVESGAATGSYDLYVKQLAQAHQISKSF
FT                   SGEDAALPTSGVLTIQVGPDVADTLTLDMAVYNPGGNATVSDLTGMINSHPDNPGVQAS
FT                   LVRTGGQVELMLSSTETGADSTIDVKMDGADWGMTERRAAQDAELTLNGIDIKSSSNYL
FT                   NNVIDGVSIELNKAHGVGESSTIKIESDTDASEQAVKDFVDSFNELMDQINQLTRSMGS
FT                   SVLDDINDDNDKDKDEDDDDDDDDSPSSVTEDQLGALKGDSSVRMLQNSMRSAIFDPAS
FT                   NGMRLSDIGIEMTREGKLEIDEDKLAKALKDDPGAIEAMFTGSDNYVDRMDGIIDPFTK
FT                   SNGYLDLKQENLDKQITRVEDNMARHDYQMEQRYQIYLAQFTAMEATINQLNSASALFY
FT                   "
FT   gene            complement(68291..69085)
FT                   /locus_tag="Ssed_0057"
FT   CDS_pept        complement(68291..69085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0057"
FT                   /product="flagellin domain protein"
FT                   /note="KEGG: shw:Sputw3181_0483 flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34670"
FT                   /db_xref="GOA:A8FP97"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP97"
FT                   /protein_id="ABV34670.1"
FT                   /translation="MLSVQTNNASNIAQNSVNKSNDLLSNAMERLSTGLRINSAADDAA
FT                   GLQIATRMNANVVGMETANRNVSDATSMLQTADGALDELTTIANRQKELATQAANGVNS
FT                   TEDLAALDAEFQELSKEVTRIVTDTEYSGNKLFAELEAGVTFQIGASSGETLDVTTNAI
FT                   TAVAGDLKAGANAAIDLVDTFIDEVGAERSTLGANINRLGHTASNLTNVTENTKAAAGR
FT                   IMDTDFAVETANMTKNQLLVQAGTNILSSANQNTGLVMSLLG"
FT   gene            complement(69675..70700)
FT                   /locus_tag="Ssed_0058"
FT   CDS_pept        complement(69675..70700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34671"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP98"
FT                   /protein_id="ABV34671.1"
FT                   /translation="MVNGISDSLNVQQRSQPLVAATNDRHQSKAPKPAQLTAIPSHRLE
FT                   TYARWARVTQGQHKISAFQVAEQGLKQIFHLLKQLKRLAQSAISLSGESRNAQIKAATS
FT                   LQQRLSQLRVEYQNRPLLDHQLNLISKKRPPAPRQFILKSIELAQPKPRDERIQIQSDK
FT                   DSISIFLPANASKAALTGHLSEAMHNLEITIPAPHSETTVFNCNDERWQKIKAGIMMTG
FT                   KGQRLPAGEARTIKVDEILSWQDPREWRLGSNEDLKQTVVKIHKSLFKLEQQLRELTQT
FT                   ADKIQRQLHKANKENDFDDELKKTLNSLERLMQATPFTLQMTSVMAQANVTRSQVSSLL
FT                   L"
FT   gene            complement(70710..71627)
FT                   /locus_tag="Ssed_0059"
FT   CDS_pept        complement(70710..71627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0059"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: spc:Sputcn32_3458 flagellar hook-associated
FT                   protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34672"
FT                   /db_xref="GOA:A8FP99"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A8FP99"
FT                   /protein_id="ABV34672.1"
FT                   /translation="MRVSTQNMYSSNLYNLQNTTSDLARLNEMMSTGKSLLRPSDDPIG
FT                   SVKVIGSERDMAATNQYLKNIESLSTSFGRAESNLSSMTELQSRMREITVAANNGSLSA
FT                   EDRAAYAAEMNELLDALTDTINAKDEGGNYLFSGNLTDTPPISIDASGNYIYQGDASQR
FT                   EVQVSSSSWMPANVTAQEFIFSNGSTDILNQTKEFIAMLEDPTLSPGDPAFDNVAESML
FT                   TTLDDTLTSISSAMTDIGGKQNSLTLIQGSHEEMVLFNKEVIGETEGLDYAQATAEFNV
FT                   KLTTLKVTQQTFVQVSQLSLFGQM"
FT   gene            complement(71640..73013)
FT                   /locus_tag="Ssed_0060"
FT   CDS_pept        complement(71640..73013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0060"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: spc:Sputcn32_3459 flagellar hook-associated
FT                   protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34673"
FT                   /db_xref="GOA:A8FPA0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA0"
FT                   /protein_id="ABV34673.1"
FT                   /translation="MSMLNIGMSGLNASMAALNTTSNNVANAMVPGYSRQQVMMSSVGS
FT                   GTYGGGAGVMVDGVRRISDQYEVAQLWNTTSDVGFSKVQASYYGQVEQIFGSDGNNISQ
FT                   GLDLLFASLNSAMEQPNEIAYRQGVLNEARALTHRFNSISEGVNAQLSQIEGQLGASVK
FT                   EVNAQLQTIASFNAEIQASGNNGNVPSSLLDARDAAVDDLAAIVDINVVEDSNGMLNIS
FT                   LAQGQPLLAGTTASTLSVSPDPGNPGMSKISIQFGQSSFPVDESAGGSLGALLDYRDNS
FT                   LMDSIAFIDELAMTIADEFNAVLAGGTDLNGNTPTQDLFTYDPNSPAGSLKLTSGFTAE
FT                   MLAFGQDGTPGDNSNLKELVELANKSFTFNSIGADTTMGDAFASKIGELGSASRQAQVN
FT                   ADTSVKLQMEAQSQWASTSGVNMDEEAVNLIIYQQSYQANAKVISTADQLFQTILNSI"
FT   sig_peptide     complement(72927..73013)
FT                   /locus_tag="Ssed_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.560 at
FT                   residue 29"
FT   gene            complement(73080..73517)
FT                   /locus_tag="Ssed_0061"
FT   CDS_pept        complement(73080..73517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34674"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA1"
FT                   /protein_id="ABV34674.1"
FT                   /translation="MKLDNVQNSHGYLKQMNAGDLIKANGEYGALELVSQQFEAQFLQT
FT                   VLKQMRSASDVMADKDNPLSSQNDGMYRDWHDAELAGRLSQMQSTGLASVMTKQLAGAL
FT                   KSAPQPVASTNQVAEEMSVNPSNTTAMQPALIVPMMAKPSE"
FT   gene            complement(73517..74644)
FT                   /locus_tag="Ssed_0062"
FT   CDS_pept        complement(73517..74644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0062"
FT                   /product="flagellar P-ring protein"
FT                   /note="KEGG: spc:Sputcn32_3461 flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34675"
FT                   /db_xref="GOA:A8FPA2"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA2"
FT                   /protein_id="ABV34675.1"
FT                   /translation="MKKPLILIMSLLLIFTVDSVSAQSQTRYLMDIVDVQGIRENQLVG
FT                   YGLVVGLDGTGDRTQVRFTSQSVVNMLKQFGVQIDDKTDPKLKNVAAVAVHGNVPALAS
FT                   PGQSIDITVSSLGDAKSLRGGTLLMTPLRAVDGEIYAVAQGNLVVGGVSAQGRNGTSVT
FT                   INVPTVGNIPNGALLEAPMHSNFTESETIVLNLRAPSFMTARNIERTVNALFGPDVAQA
FT                   DSNAKVTVRAPESKRERVTFMSMLEELQIEQGRKSPRVVFNSRTGTVVMGGDVVVRKAA
FT                   VSHGNLTVTIIEKESVSQPNGALWGQAQGETVVTTDSQVDIDTGNGHMFVWPEGIALEE
FT                   VVRAVNSLGASPMDLMAILQALDEAGALEAELVVI"
FT   sig_peptide     complement(74570..74644)
FT                   /locus_tag="Ssed_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.522 at
FT                   residue 25"
FT   gene            complement(74739..75401)
FT                   /locus_tag="Ssed_0063"
FT   CDS_pept        complement(74739..75401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0063"
FT                   /product="flagellar L-ring protein"
FT                   /note="KEGG: spc:Sputcn32_3462 flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34676"
FT                   /db_xref="GOA:A8FPA3"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA3"
FT                   /protein_id="ABV34676.1"
FT                   /translation="MRHLWIGMLLLLSGCAANFPEADTKPGQPEWAPPEIDYSLPDAKD
FT                   GSAYRQGYMLTLFKDKRAFREGDILTVALDEKTYSSKRADTKANKEQDLSIGAQASAGD
FT                   SSYSGAGDGSLARGFKGSGSSTQQNQLSGSITVTVAKVLPNGALLIRGEKWLRLNQGDE
FT                   YLRLLGLIRTDDIGNDNTISSQRIADARIIYGGQGAIADSNAMGWASRYFNSPWFPL"
FT   sig_peptide     complement(75333..75401)
FT                   /locus_tag="Ssed_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.943 at
FT                   residue 23"
FT   gene            complement(75446..76231)
FT                   /locus_tag="Ssed_0064"
FT   CDS_pept        complement(75446..76231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0064"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="KEGG: spc:Sputcn32_3463 flagellar basal-body rod
FT                   protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34677"
FT                   /db_xref="GOA:A8FPA4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA4"
FT                   /protein_id="ABV34677.1"
FT                   /translation="MQSALWVSKTGLTAQDVKMTTIANNLANVNTTGFKRDRVAFNDLF
FT                   YQTQRQPGGQVDELNELPSGLQLGTGTRVVGTQKIFTSGDMLTTNQQLDLAIEGQGFFQ
FT                   IEEANGDLAYSRDGQFYRNSDGLMVTSQGLPLVPNIEIPEDALTITIATDGIVTAQISG
FT                   QAEAQELGQITLVNFTNPTGLEARGDNLYRETGASGAAIEGVAGDQAIGQLRQGALEGA
FT                   NVNVVEEMVEMISTQRAYEMNAKVVSASDDMLKFLNQSL"
FT   gene            complement(76302..77036)
FT                   /locus_tag="Ssed_0065"
FT   CDS_pept        complement(76302..77036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0065"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="KEGG: shw:Sputw3181_0475 flagellar basal-body rod
FT                   protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34678"
FT                   /db_xref="GOA:A8FPA5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA5"
FT                   /protein_id="ABV34678.1"
FT                   /translation="MDKMLYTAAAGAARVMEAQAIRANNLANAETTGFKADLERVNATV
FT                   IPAMGNTLQTRVMAQTQSSGFSHQSGALNPTGRTLDLAIREQGLFSVMTEQGEAYTRSG
FT                   TLVPDTNGQLTIDGRPVAGIDGPIVLPEYRELFVGDDGRISVLAAEGGITEEVGQLKLV
FT                   NPELDTMEKGLDGLFYSRDGQPLQANEQVKVDSGFLESSNVKAVSELIASMDLSRQFEV
FT                   QVKLMKSAEKLAEAGNRLLRNA"
FT   gene            complement(77047..78243)
FT                   /locus_tag="Ssed_0066"
FT   CDS_pept        complement(77047..78243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0066"
FT                   /product="flagellar basal body FlaE"
FT                   /note="KEGG: sdn:Sden_3648 flagellar basal body FlaE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34679"
FT                   /db_xref="GOA:A8FPA6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA6"
FT                   /protein_id="ABV34679.1"
FT                   /translation="MSFNIALSGLQATTQDLNTISNNIANSSTVGYRGGRSEFSAVYNG
FT                   GQAGGVNVMSTSQNFSMGGSLVYTGRELDMGIQGDGFFVLSGQDGSTLYSRAGMFSQDA
FT                   DGYITDPAGNRLQGYPVGAGGQLQTGNVSDLQVQSGSLPAKATTDVGVVSNLDASMEPI
FT                   DQTTTPFDPDDISSYHSSGTVAVYDSLGNEHALTQYYVKTNDSPSEWNVHYMMDGKDVG
FT                   TNKLEFDDKGALTGGENVTLNLGTPGGAAPMSLDLSYKNSTQYASDYSNSSLTQNGYTS
FT                   GELNGVRLDDNGMVYGTYTNGQEQIQGQVVLADFNNPNGLTPVSNNAWAATNAAGQPIV
FT                   GAPTTGTLGSVSGGYLEGSNVDTTAEMVSLMTAQRNYQSNAKVLDANSTMQQALLNAI"
FT   gene            complement(78272..78937)
FT                   /locus_tag="Ssed_0067"
FT   CDS_pept        complement(78272..78937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0067"
FT                   /product="flagellar hook capping protein"
FT                   /note="KEGG: shw:Sputw3181_0473 flagellar hook capping
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34680"
FT                   /db_xref="GOA:A8FPA7"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA7"
FT                   /protein_id="ABV34680.1"
FT                   /translation="MNVNSTTNSSGNDNTSDVMNSPGNDAASIKNEFMTLMIAQIQNQD
FT                   PTNPIDSTEYVTQLAQFSQVESLEQMRLNQSTQMVMMENLGIVQSAQLIGKDAMVPASE
FT                   VTLDTETVHGKVYTGNAVEELSIDIMDESGEVVSTLKLGPQEVGDIEFSIDPEALGLPP
FT                   GKYSIEAQATSGEETLTADTFIQAPIEKIHFVSASGMMMAELGYGLGTVSVLDISEVS"
FT   gene            complement(79003..79422)
FT                   /locus_tag="Ssed_0068"
FT   CDS_pept        complement(79003..79422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0068"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="KEGG: shw:Sputw3181_0472 flagellar basal-body rod
FT                   protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34681"
FT                   /db_xref="GOA:A8FPA8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA8"
FT                   /protein_id="ABV34681.1"
FT                   /translation="MSFGEIYQIAGAGMHAQSIRLNTVASNLANAGAAAETQDSAYRAL
FT                   KPVFSTIYNQTQAGEVSGAQVEVAAIVETDAPLDMRYEPDHPFADEQGYVAYSNVNTVE
FT                   EMADMMAASRSFETSVEVMNQARSMQQGLLQLGTK"
FT   gene            complement(79521..79871)
FT                   /locus_tag="Ssed_0069"
FT   CDS_pept        complement(79521..79871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0069"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="KEGG: shw:Sputw3181_0471 flagellar basal-body rod
FT                   protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34682"
FT                   /db_xref="GOA:A8FPA9"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPA9"
FT                   /protein_id="ABV34682.1"
FT                   /translation="MAINLDAALGIHPQTLDFRVERTKILAGNLANAETPGYKAKDLNF
FT                   QALMSGINAGMPASNQYEVGYRVPYQTSADQNTVELGKEQARYSQNAMDYQTSLTFLNM
FT                   KISGLKSAIEGQ"
FT   gene            79958..80704
FT                   /locus_tag="Ssed_0070"
FT   CDS_pept        79958..80704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0070"
FT                   /product="SAF domain"
FT                   /note="KEGG: shw:Sputw3181_0470 SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34683"
FT                   /db_xref="GOA:A8FPB0"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB0"
FT                   /protein_id="ABV34683.1"
FT                   /translation="MGYVFIVRWRGIAASCFLMLLSCLLPLRAGAEESLDVKLQIENQL
FT                   TRLLSQEIAQWQRQAGLKSVEHNIEVRVPSGAAKLKLCPEPLLIDTGSGLVFGNVQRKV
FT                   LCASQAWSLFVRAKVKVTARLPVANRAMKRGEFIGAQDIEWHPIVLGASDRDLLTKTDD
FT                   IIGRQVNRKLRRHRAIQLHHLNAPQWVNIGDRVIIEARSQGFYANMAGEALESGGEGEA
FT                   IRVKNLSSGKVITAFPTAKGRVTTVF"
FT   sig_peptide     79958..80053
FT                   /locus_tag="Ssed_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.973 at
FT                   residue 32"
FT   gene            80780..81064
FT                   /locus_tag="Ssed_0071"
FT   CDS_pept        80780..81064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34684"
FT                   /db_xref="GOA:A8FPB1"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB1"
FT                   /protein_id="ABV34684.1"
FT                   /translation="MEINKVNSAISAEISTKKESVTLPELTDKKPVSQGSTPKAVSDDW
FT                   HLLARSQPQLQQLEDLDRTKMAEIRQSLRDGSFELNITAISEAMLQQHG"
FT   gene            81067..81504
FT                   /locus_tag="Ssed_0072"
FT   CDS_pept        81067..81504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34685"
FT                   /db_xref="GOA:A8FPB2"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB2"
FT                   /protein_id="ABV34685.1"
FT                   /translation="MSNKREIVQSIIRGIRQDIEGYKQLKSMLKRQRDLMQRRDNHGLK
FT                   YHNGHQTTLCEHLQQRAKLRSEGLISLGFAGDASGMAQLIAKLPAQASTQMKLLWENLL
FT                   ILVKESQRVNEANGKLLVGQQEVITNLLNRDVPQNIDYGAP"
FT   gene            complement(81517..81951)
FT                   /locus_tag="Ssed_0073"
FT   CDS_pept        complement(81517..81951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34686"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB3"
FT                   /protein_id="ABV34686.1"
FT                   /translation="MKQLLRLCQQEEKKLSQLGRQRGEAQQRIEAITQQQHNLNRMLHE
FT                   YQQHTPKIANSLLLQNSTNLQLALRPMQARLTRQEILLQQEHRRVDGLWRQQLGRQQGI
FT                   KWLYQKRKQDKIELNNRQEQKQLDDLASRARTNRSQSDES"
FT   gene            complement(81966..83309)
FT                   /locus_tag="Ssed_0074"
FT   CDS_pept        complement(81966..83309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0074"
FT                   /product="ATPase, FliI/YscN family"
FT                   /note="KEGG: sbl:Sbal_3976 ATPase, FliI/YscN family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34687"
FT                   /db_xref="GOA:A8FPB4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR020005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB4"
FT                   /protein_id="ABV34687.1"
FT                   /translation="MLHNLQPSENTITEAPDWPRVPVAQVYGRLTRVNGLLLEAVGCQL
FT                   GMGDRCHIECRDGRLIEAEVVGFNRETLCLMPIEHTSGLMPGSRVMPLAEQVKIPVGTS
FT                   LLGRVLDGLGQPLDALGPLKNLQSVPLSNNTTNPLLRKPIREPLDVGIRAINALLPIGR
FT                   GQRLGLFAGSGVGKSVLLGMMTRFTEADVVVVGLIGERGREVREFIEESLGEEGRERAV
FT                   VIAAPADTTPLMRMRAMRLCHHVAAAFRDQGKQVLLLVDSLTRYAQAQREIALSLGEPP
FT                   ATKGYPPSAFAQLPSLVELAGNGQDPVGTLTAFYTVLTEGDDQQDPIADAARAILDGHL
FT                   VLSRKLAEQGHFPAIDISASVSRLATQVADQTQLSQGHHFRHLNSRYNEVRELLPLGGY
FT                   QAGHDPQMDLAVRSYPMMAQFLQQNTEEKFDRQQSLEQLSDLVERTGK"
FT   gene            complement(83299..84057)
FT                   /locus_tag="Ssed_0075"
FT   CDS_pept        complement(83299..84057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0075"
FT                   /product="flagellar assembly protein FliH"
FT                   /note="KEGG: sbl:Sbal_3977 flagellar assembly protein FliH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34688"
FT                   /db_xref="GOA:A8FPB5"
FT                   /db_xref="InterPro:IPR000563"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB5"
FT                   /protein_id="ABV34688.1"
FT                   /translation="MTFPVDKMDPKWRLKKELARRHRFAPLVQQPPMEGEAGTGWQDYQ
FT                   EAFDKGYEEGVAKGHLEGFESGSEEGRRSGHASGFNQGRIEGNLKGKEAIDEQLNQLIA
FT                   PLGALKSILEEGHTHQVSQQQTMLLDLIRRVAQQVIRCELTLQPQQILSLVEETLTALP
FT                   DTRSEIKIHLEPNAVNKLKELASDKIQDWTLVADPSISAGGCRIVSDKSDADASVETRL
FT                   NVCMDQVSAKLKEPETSNTNSEAELPIDVA"
FT   gene            complement(84057..85070)
FT                   /locus_tag="Ssed_0076"
FT   CDS_pept        complement(84057..85070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0076"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="KEGG: sbl:Sbal_3978 flagellar motor switch protein
FT                   FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34689"
FT                   /db_xref="GOA:A8FPB6"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB6"
FT                   /protein_id="ABV34689.1"
FT                   /translation="MNKSELGIKMDNLEQAAMLLLSMGEKGAAQVMAHLDRNDVQHLSH
FT                   KMARLSSITQQEAEAVLGRFFMRYQEQSGIARASRSYLQKTLDLALGDRVAKSLIDSIY
FT                   GDEIKTLVKRLEWVDPQLLAREITNEHSQLQAVLLGLLPPESAAQVLLSLPAEGQDEVL
FT                   VRIAQLGELDRDVVDELRQLVERCMLIAMEKSHTQVAGIRQVADILNRFEGDREQLMDM
FT                   IKLHDTKLASDVADNMFDFIILGRQKPETLQEIMAIVPPEMLALALKGIDSELKSTLLL
FT                   ALPKRMSSAIETQVEAIGAVPLSQATSARKEIMELAKQMMDDGEIELQLFEEQVVE"
FT   gene            complement(85129..86841)
FT                   /locus_tag="Ssed_0077"
FT   CDS_pept        complement(85129..86841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0077"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="KEGG: sbl:Sbal_3979 flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34690"
FT                   /db_xref="GOA:A8FPB7"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB7"
FT                   /protein_id="ABV34690.1"
FT                   /translation="MSTTLAQPSPNMTDVRDKSEIVSSLKTKWQQFNRGDRQVLVLAIL
FT                   ASVVACVIVLLLWTASQGYRPLYGQQEKVETSQIIEVLEAEGINYRLEANSGLVLVQED
FT                   KLGKARMLLAARGVKAKVPSGMESLDNSGIGTSQFMEQAKYRHSLEGELSRTIMALKAV
FT                   RTARVHLAIPKRTLFIRQQPELPSASVMLDLYAGSKIQPGQIEAIANLVAGSVTGMTPE
FT                   RVQIVDQEGNHLSSGIAINQDITQARDRQLKYTQELEQSLINRASSMLAPVLGKENFQV
FT                   QIAAQVNFNQVEETRESLDPQSVVTQEKQSINDTNSDIAMGIPGALTNQAPKAQANKTE
FT                   ENTRRNLNQQESRQYEVGRSVRHTRFQQMQLENLSVSVLLNNQAAGENGWNEAQVSQLG
FT                   TMVKDSIGYSMQRGDQFSINSFDFAPVQIAQFEPMPWWQTEGYQAYLRYFIGGILGFGL
FT                   IFFVLRPLVSHLTRTAEHSLKEELPQVEPALEAPSSSSISGVQSGDGQALADQLMGLEQ
FT                   DKSDTDWLSNQGLPAPGSPLTVKMEHLSLLANQEPARVAEVIAHWIGDNENER"
FT   gene            complement(86938..87276)
FT                   /locus_tag="Ssed_0078"
FT   CDS_pept        complement(86938..87276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0078"
FT                   /product="flagellar hook-basal body complex subunit FliE"
FT                   /note="KEGG: shw:Sputw3181_0462 flagellar hook-basal body
FT                   complex subunit FliE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34691"
FT                   /db_xref="GOA:A8FPB8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB8"
FT                   /protein_id="ABV34691.1"
FT                   /translation="MSNSTLVNPQSMMDTLSIHSEMAKGAIKITPNPKDHGLQPASFTE
FT                   LMESKVAAVNLDQNTSSALMRAVDSGESDDLVGAMVASQKASLSFSTMIQIRNRLVQAF
FT                   DEVMKMPL"
FT   gene            complement(87319..88620)
FT                   /locus_tag="Ssed_0079"
FT   CDS_pept        complement(87319..88620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0079"
FT                   /product="sigma54 specific transcriptional regulator, fis
FT                   family"
FT                   /note="KEGG: shw:Sputw3181_0461 sigma54 specific
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34692"
FT                   /db_xref="GOA:A8FPB9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPB9"
FT                   /protein_id="ABV34692.1"
FT                   /translation="MPLSNFRLVDAALAEQCVEQLSLQGFELWQPGSDTPWISMIDLSS
FT                   CTCDELVKKLSLYPGKNQIALLDPEQTELATRAMQLGVQDYLLLPLDGDQVISLLQRLR
FT                   RLEQPDTDLVVSSTVSRQLLMLAHRAATTEASVLLTGESGTGKEPIARYIHQNSNRANQ
FT                   PFIAVNCAAIPESILESILFGHVKGAFTGASSDQPGKFELANGGTLLLDEIGEMPFILQ
FT                   SKLLRVLQEREVERLGGHRSIPLNIRVIASTNKDLRKAVKSGEFREDLFYRLDVLPLKI
FT                   SPLRERREDILPLAEHFLQRYKQLSDNQACYFSEAAQQRLLSHDWPGNVRELENTIQRA
FT                   LVMRRGQALQAAELGIESKEHHAKVRVESSEQGLKASKRQAEFQYILDTLKRFNGHRSQ
FT                   SAQSLGMTTRALRYKLVQMREEGIDIEQALGHAA"
FT   gene            complement(88607..89521)
FT                   /locus_tag="Ssed_0080"
FT   CDS_pept        complement(88607..89521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA0019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34693"
FT                   /db_xref="GOA:A8FPC0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR041544"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC0"
FT                   /protein_id="ABV34693.1"
FT                   /translation="MKISAHIKLYSLSFFLLISNIATASSTRYQTPLEQAKWDFTGNRF
FT                   ICQIEHKVNGFGEFKLIARPGTSLSLQLDADWLSFEQTTSQAKVVSPSWSQTDSLSSGA
FT                   THLKWHGRTAISDDTTSKFLEALEQGLAWQVLILARDGISYKVETSPINTQAIANKFKL
FT                   CRQELLPKPFSYVRRVDIQFESGTSKLTAAHEVDLEAIAQYVQADATVKEILVDAHADA
FT                   SGEHLANLVLSKERADEVASRLFELGIQKQKIQVRHHGARSPIVSNNSPEGREINRRVT
FT                   IRLIKSHTKTANSNPTGVNNASL"
FT   sig_peptide     complement(89447..89521)
FT                   /locus_tag="Ssed_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            90188..91054
FT                   /locus_tag="Ssed_0081"
FT   CDS_pept        90188..91054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34694"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC1"
FT                   /protein_id="ABV34694.1"
FT                   /translation="MKTTAKACLLKASRCERVRPVALIQEKLARSRLLIQVDACQRSFL
FT                   EAANGVLNPIIRQGHHALSSISLTDSDQSVVPDINNGWFLLRYQRLPLAWWRIDKCTLD
FT                   QLASGYYGSLATLLKSPLRAPSQSEFRLAKKLMLAALKVLPTAELDENALELELVVNST
FT                   PIDSPVIWEIAFPVEHKVAPMLFCMTEHLLGLMSEQPSQYMATPDLAEKLSYRLRQIPI
FT                   KILFELGRQSTPVTSLHGLEVGDILPMNLHSRCPVTVGKRPLFYAAIHTHDGQMVAKLA
FT                   QDIYQQG"
FT   gene            91135..91491
FT                   /locus_tag="Ssed_0082"
FT   CDS_pept        91135..91491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0082"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="KEGG: shw:Sputw3181_0459 flagellar motor switch
FT                   protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34695"
FT                   /db_xref="GOA:A8FPC2"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC2"
FT                   /protein_id="ABV34695.1"
FT                   /translation="MTEHTMLQDDDFLLDDNLFGEEEAVQEMSSPKPVKDISFFHQLPV
FT                   QVTLELASAEMSLGELTRMGEGDVVALDRMVGEPLDIRVNGALLGRGEVVEVNGRYGVR
FT                   LLEVEAISLTGAND"
FT   gene            91494..92222
FT                   /locus_tag="Ssed_0083"
FT   CDS_pept        91494..92222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0083"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: sdn:Sden_3664 flagellar biosynthetic protein
FT                   FliP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34696"
FT                   /db_xref="GOA:A8FPC3"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC3"
FT                   /protein_id="ABV34696.1"
FT                   /translation="MLRALLLLFCLLAPSAFANDGFTLFTLDDGQQSQSVNIKLEILAL
FT                   MTVLSFLPALLMMLTSFTRIIVVLAILRQALGLQQSPPNKVLLGIALVLTLFVMRPVGQ
FT                   VMYDEAYLPYDQGLIELPEAVNIGVVPLRKFMLAQTRETDLEQMLKIADEPVTLTADEI
FT                   PFFVLMPAFVLSELKTAFQIGFLLFLPFLVIDLVVASVLMSMGMMMLSPLIISLPFKLM
FT                   VFVLVDGWSMTVSTLVASFG"
FT   sig_peptide     91494..91550
FT                   /locus_tag="Ssed_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            92434..92703
FT                   /locus_tag="Ssed_0084"
FT   CDS_pept        92434..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0084"
FT                   /product="export protein FliQ, family 3"
FT                   /note="KEGG: sbl:Sbal_3985 export protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34697"
FT                   /db_xref="GOA:A8FPC4"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC4"
FT                   /protein_id="ABV34697.1"
FT                   /translation="MEVNELTSIFSDAIYLVVAMVGVLVVPSLLVGLIIAVFQAATQVN
FT                   EQTLSFLPRLVLTLLMVLFSGQWLLQQISDLFDRLFMNIPHIIG"
FT   gene            92706..93479
FT                   /locus_tag="Ssed_0085"
FT   CDS_pept        92706..93479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0085"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="KEGG: sbl:Sbal_3986 flagellar biosynthetic protein
FT                   FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34698"
FT                   /db_xref="GOA:A8FPC5"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC5"
FT                   /protein_id="ABV34698.1"
FT                   /translation="MLSLTSAQLSSFIGIFWWPFFRIMGAFMVMPFLSSSYIPVTVRVL
FT                   LALTISTLLAPMLPPLPSVDAISIGALFLAIEQLLVGFMLGLFLTIMIHVMTLLGAMMS
FT                   MQMGLAMAVMNDPANGSSNPILGQWFLLYGTLLFLALDGHLVAIGVLVDSFRLWPIGSG
FT                   VLDLPLMGLVSRFAWIFASALMLALPSILAMLMVNITFGVLSRAAPSLNVFALGFPMSM
FT                   LMGLLCVMLSFSGLPTRYSDICLDALEAMYQFIGG"
FT   gene            93496..94626
FT                   /locus_tag="Ssed_0086"
FT   CDS_pept        93496..94626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0086"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="KEGG: sdn:Sden_3667 flagellar biosynthetic protein
FT                   FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34699"
FT                   /db_xref="GOA:A8FPC6"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC6"
FT                   /protein_id="ABV34699.1"
FT                   /translation="MSKDTGQSKTEKATPQKLKKAQDQGQVPRSKDLAATALIIGCSLM
FT                   LTASADWFATRVARVAQYNMSLTKAELDEPGMMMSHLGTSLVEILNILGPIIVLIAVLA
FT                   MVAGSMPGGPVFNFKNAAFKYSRIDPIAGIGRMFSMKSLVELVKSILKIVLLIGIMFTF
FT                   LEHNLQSLLGYSQLPIDEAVRKGIDILSLGMLYLGIGMLVITFIDVPYQYWHHHNELKM
FT                   SRQDVKDEHKQQEGKPEIKAKIRQLQQRIGRSRADVAIPQADVLLVNPNHYAVALKYDV
FT                   EKADAPYVLTKGTDELALYMRQIAKHHDVEVIELPPLARAIYYSTQVEQQIPAALFIAI
FT                   AHVLSYVLQIKAARQGKQQRPDPLPNFFIPPHLRRD"
FT   sig_peptide     93496..93648
FT                   /locus_tag="Ssed_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.842 at
FT                   residue 51"
FT   gene            94830..96911
FT                   /locus_tag="Ssed_0087"
FT   CDS_pept        94830..96911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0087"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /note="KEGG: shw:Sputw3181_0454 flagellar biosynthesis
FT                   protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34700"
FT                   /db_xref="GOA:A8FPC7"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC7"
FT                   /protein_id="ABV34700.1"
FT                   /translation="MNWLSRTFAGNRSYIGIPIMLLAILAMVILPLPPWLLDILFTFNI
FT                   VLAVMVLLVSVSIRRPIDFSVFPTVLLLATLMRLTLNVASTRVVLIEGHQGGDAAGRVI
FT                   QAFGEVVINGNYVVGGVIFLILMIINFVVITKGGERISEVSARFTLDALPGKQMAIDAD
FT                   LNAGVLSQEQARVRRQDVAREADFYGSMDGASKFVRGDAIAGLMILAINILGGIAIGVF
FT                   MHGLSAGEAFRTYALLTIGDGLVAQIPSLLLATAAAIIVTRVSDAEEMPTQLSKQLLAN
FT                   PKTLATAAAVMTILGLVPGMPAFVFLSFAALLGFAAWKQSQGRSVQPETEVEEQLEKSL
FT                   SEPSAPSWDALPFTDLIEVRLGYRLVHLVERSKGAELQKRLTGIRRTLSEQAGFLLAEV
FT                   RVRDNLALAPNAYQINLMGNPVVTAELEPERMMAIKSGPVFGDIDGVITKEPAYNMDAT
FT                   WIEPELKAKALNLGYSVVDNATVIATHVSKLIRESLPDMLQHDDVIALSDRLAKQSPKL
FT                   AESLSTALTPIQQLKVYRLLLKEQVSLKDIRTIATTLLDCSENSKDPVLLAADVRCALR
FT                   NSILHSIAGSAPQINVLTLAPELEQTLMTALNQSQQQGKVALDSFPVEPQLLAQLQQKM
FT                   PQILADAKEQGHSPMLLVSPQLRPILARYALAFARGLHVLSYNEIPETRELMVAGQLG"
FT   gene            complement(97042..98034)
FT                   /locus_tag="Ssed_0088"
FT   CDS_pept        complement(97042..98034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0088"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="KEGG: shn:Shewana3_4119 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34701"
FT                   /db_xref="GOA:A8FPC8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC8"
FT                   /protein_id="ABV34701.1"
FT                   /translation="MSIALEPQANIQNDAPGMSFSSERNLDSTEQQTMWSQVTESVIKI
FT                   DDISLAYSFIEHPKSQKAIVISSGRIESYIKYRELIFDLYRQGYSIYALDHRGQGLSSR
FT                   TTNNPQQGHIDRFETYIDDFTHFIDVVVKKKNYKDLFLVGHSMGGTIGTLYMEKHPDTF
FT                   RAAAFSAPMYGIKLPISRRFIRWLAQLLDTTDSDKGPNYVLGGGDYEAVEFAKNDLTNC
FT                   QLRYDNYKKLYLQHPQVQVGSPTNRWLHESIDAAERAISAARNSQMPILILQADEDTVV
FT                   DNFAQYHAVGGLCQLINIPHARHEVFMEQDESRNMALTELVNFLQAHAS"
FT   gene            complement(98169..99968)
FT                   /locus_tag="Ssed_0089"
FT   CDS_pept        complement(98169..99968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0089"
FT                   /product="protein of unknown function DUF885"
FT                   /note="KEGG: sbl:Sbal_0045 protein of unknown function
FT                   DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34702"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPC9"
FT                   /protein_id="ABV34702.1"
FT                   /translation="MYKILVPSLLAFSLSACQLNLVNTDQPQAPDIPVETQASTQLQGL
FT                   IEKSWLITLDASPDFAYSQGNLDKAGQLTDLSPLALANLNKRRQVILYSLMALDRGPLT
FT                   KEEKINAQILQDQLQNNVDLYRYKDHYLPISSESGFHAYIASIAKARFATERDYGNYIA
FT                   KLKALPTYFAQQTHWLQQGLDSGITPPKITLKGFEESISAFIVPVEQSGYFKPFTQYPK
FT                   HFTDSQKTALTQEGHDLVQNTVLPLYRQFYDFMTLSYIPGARTSIATASLPDGEAFYEN
FT                   RVRYYTTLNMNSDQVHQLGLKEVKRIRAEMETIINEVGFKGSFADFLHFLRTDPQFYPT
FT                   TAEELLKEAAYIAKKADAMLPKYFGKLPRTPYGIQEVPAEIAPKYTTGRYSGSNRDDEP
FT                   GYYWVNTYALDKRPLYEMEALTLHEAVPGHHLQISLNTELTSLPNFRRYSYISAFGEGW
FT                   GLYSEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAKGWSRQQALDFMASNTA
FT                   LSMHNVTTEIDRYISWPGQALSYKIGELTIKRLRAKAEDALGEEFDIRAFHDAVLENGS
FT                   VPMQVLEQQIDDFISAQKAIKGS"
FT   sig_peptide     complement(99918..99968)
FT                   /locus_tag="Ssed_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.332 at
FT                   residue 17"
FT   gene            complement(100160..101500)
FT                   /locus_tag="Ssed_0090"
FT   CDS_pept        complement(100160..101500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0090"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.98.3"
FT                   /note="KEGG: shw:Sputw3181_0039 oxygen-independent
FT                   coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34703"
FT                   /db_xref="GOA:A8FPD0"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD0"
FT                   /protein_id="ABV34703.1"
FT                   /translation="MIEKYNYSGPRYTSYPTALEFDDSFTEEKLLTSIENSKSDKLSLY
FT                   VHIPFCAKLCYYCGCNKVITRHQHKADQYIEYLAAEIVKRAPLFKNYLVTQIHWGGGTP
FT                   TFLSPDQILKLSALIKSSFNVADEGEYSIEVDPREIELSMLDTLKEAGFNRISIGVQDF
FT                   NKKVQIAVNREQDEQFIFDLMAKAKELGFVSTNIDLIYGLPHQTPETFAETMQRVLDLN
FT                   PDRLSVFNYAHLPARFAAQRKIKDEDLASPQQKLDMLHQTIETLTGAGYQYIGMDHFAK
FT                   PDDELSILQNEGRLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQNQKDIRPYYESVD
FT                   KSGHALWKGCSLNRDDEIRRVVIKQLICHFELDMAQIDEKLGINFEEYFVEDLKLLQTF
FT                   IDDKLVDITDRKITISPTGRLLIRNICICFDVYYREKARQQQFSRVI"
FT   gene            complement(101794..102273)
FT                   /locus_tag="Ssed_0091"
FT   CDS_pept        complement(101794..102273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34704"
FT                   /db_xref="GOA:A8FPD1"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD1"
FT                   /protein_id="ABV34704.1"
FT                   /translation="MTTALLILGFIIVMTLAAYATALLLKLRKQTAQRLKRQQELDEIN
FT                   RARVDEHLDSIRYIATAMLEERCELSEGVMRIAKLFGILSMSEQVAPQFPAIFKHFEII
FT                   EEHPIMAERKQLEKKQRMKLDFARMRSEAELETAILEEAKQLVTYSQTEIPTHLH"
FT   sig_peptide     complement(102211..102273)
FT                   /locus_tag="Ssed_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.933 at
FT                   residue 21"
FT   gene            complement(102406..102942)
FT                   /locus_tag="Ssed_0092"
FT   CDS_pept        complement(102406..102942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34705"
FT                   /db_xref="GOA:A8FPD2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD2"
FT                   /protein_id="ABV34705.1"
FT                   /translation="MAHSKKSRKTDQNAPKLAPRSKKNERVLAGKKKETGNKAGSRHNS
FT                   NLVGGTQGSAAQKKDPRHGSKTAVKLDLPGQTIAPKKEKGPKLTDEQRLFKLEEDPRLN
FT                   QLLDMLEEGKDLNEEDQKWLNKQLNTIESLMERLGITEQDDLDHAMKSAVASSDDDLLD
FT                   KFESGADLLKDYQDK"
FT   gene            complement(102991..103689)
FT                   /locus_tag="Ssed_0093"
FT   CDS_pept        complement(102991..103689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34706"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD3"
FT                   /protein_id="ABV34706.1"
FT                   /translation="MVNRSITMRRCPLCHNQHSSVFHQDRKRNMYLCDRCQLVFSDANS
FT                   HLPPPVEKRRYQQQVAKNQKPLKQFLMSLILQCEQQSTDPLIGLNFGRVAEPDTVLSVE
FT                   SHRHTLYQYDPYFAANHDLLKRQYDFICCYRVFEHFRFPFKEWSLLGKLLKPGAWLAIS
FT                   TKLLTELSAFDRWHHKNNLTHVSFYQHSTFEFLAQQAGFKLLFAANDLILVQKPSGSDI
FT                   KRDQSSLDDV"
FT   gene            complement(104402..105022)
FT                   /locus_tag="Ssed_0094"
FT   CDS_pept        complement(104402..105022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0094"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: slo:Shew_3716 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34707"
FT                   /db_xref="GOA:A8FPD4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD4"
FT                   /protein_id="ABV34707.1"
FT                   /translation="MKKLALALSVLASISTPAVAEGDAEAGKTKAIVCSACHGVDGNSL
FT                   IDMYPKLAGQQATYLKKQLHDFRSAAQTGGKEGRNDPIMGGMAMMLNDQDIEDVAAFYA
FT                   SQTLAVTEVQNIPASGEQLYKGGDMVRGITACIACHGPDGSGSELAGFPAIGGQHANYL
FT                   KIQLNKFHDANRNNDINGMMQDISGKLTSEDVEALSQYISSLK"
FT   sig_peptide     complement(104960..105022)
FT                   /locus_tag="Ssed_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            105192..105854
FT                   /locus_tag="Ssed_0095"
FT   CDS_pept        105192..105854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0095"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="KEGG: slo:Shew_3715 GTP-binding protein,
FT                   HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34708"
FT                   /db_xref="GOA:A8FPD5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPD5"
FT                   /protein_id="ABV34708.1"
FT                   /translation="MSESCIDFRKAKFLISAPDIAHLNEHLPGDAGVEIAFAGRSNAGK
FT                   SSALNLLTDQKSLARTSRTPGRTQLINIFELDENRRLVDLPGYGFAQVPLALKKKWQES
FT                   LGEYLQERQCLGGMVVLMDIRHPLKDLDMQMIAWALESEIPVLALLTKADKLKQSERMK
FT                   MVNEVRKHLGDFDDRVKVEPFSSLKGIGKAKVLGILNEWCHPQWLTDAIADAETEEE"
FT   gene            complement(106612..109413)
FT                   /locus_tag="Ssed_0096"
FT   CDS_pept        complement(106612..109413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0096"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: slo:Shew_3714 DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34709"
FT                   /db_xref="GOA:A8FPD6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD6"
FT                   /protein_id="ABV34709.1"
FT                   /translation="MLAASSKIKNRILIMPKIAENPLVLVDGSSYLYRAYYAPPHLTNS
FT                   KGEATGAVYGVINMLRSLLNQYKPSQMAVVFDAKGKTFRNDMYEEYKAHRPAMPDDLRS
FT                   QIEPLHRIIRALGLPLVCIPGVEADDVIGTISTQASKEGRAVLISTGDKDMAQLVDENV
FT                   TLINTMTNTIMGPSEVTEKFGVGPELIIDLLALQGDKADNIPGLPGVGEKTALAMLTGA
FT                   GSIDKILAAPEKMPELGFRGSKTMPAKLAEHGDMLKLSYELATIKLDVELEQDWKDLTI
FT                   APADKDELIKCYGEMEFKRWLAEVLDNRSGSSASTQTSTEEDELPKQDIKTEYSTILTH
FT                   DELDEWIDKLSKAELFAVDTETTSLNYMEAKLVGLSFAVEAGKAAYLPLAHDYLDAPQQ
FT                   LNQAEALAKLKPLLENPEIKKVGQNLKYDMSILANVGIKLQGIAFDTMLESYVFNSVAS
FT                   KHNMDDLALKYLGHKNISFEEIAGKGAKQLTFNQISLEVAAPYAAEDADITLRLHQHLW
FT                   PRLQKEPELASIFTEIELPLVQVLSDMERQGVLIDSMLLGQQSEELARTIDELEQKAYE
FT                   IAGESFNLSSPKQLQVLFFEKLGYPIIKKTPKGAPSTAEEVLVELALDYPLPKIILQHR
FT                   SLAKLKSTYTDKLPLMVNAQTGRVHTSYHQANAATGRLSSSEPNLQNIPIRTEEGRRIR
FT                   HAFIAREGRKVLAADYSQIELRIMAHLSQDKGLLTAFAEGKDIHKATAAEVFDVDFTEV
FT                   TTEQRRRAKAVNFGLIYGMSAFGLARQLDIPRGEAQKYIDTYFKRYPGVLNYMEETRAI
FT                   AADLGYVSTLYGRRLYLPAIKDRNAMRRQAAERAAINAPMQGTAADIIKKAMINVADWI
FT                   ANETDGEITLIMQVHDELVFEVDSDKAEALQEKVCQLMAEAADLDVELLAEAGLGDNWE
FT                   QAH"
FT   gene            109761..110414
FT                   /locus_tag="Ssed_0097"
FT   CDS_pept        109761..110414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0097"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: shn:Shewana3_4108 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34710"
FT                   /db_xref="GOA:A8FPD7"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD7"
FT                   /protein_id="ABV34710.1"
FT                   /translation="MKKIAVLLSGAGVFDGSEIHEAVLTMLALTKLGASYQCFAPDIEQ
FT                   MHVVNHLTGEVSAEESRNVLVESARIARGEIMATDRLDIEAFDALVIPGGFGAAKNLCN
FT                   FATNGSDCEISLEVSDFISEFADAKKPVGFICIAPIMIPLLYGEGVTGTIGNDVDTAQA
FT                   FNLMGGHHQEAVVQDIIVDEANKVVSTPAYMLAGNIAEANEGIEKLVKKVLEMV"
FT   gene            complement(110846..111682)
FT                   /locus_tag="Ssed_0098"
FT   CDS_pept        complement(110846..111682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0098"
FT                   /product="rhomboid family protein"
FT                   /note="KEGG: slo:Shew_3712 rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34711"
FT                   /db_xref="GOA:A8FPD8"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD8"
FT                   /protein_id="ABV34711.1"
FT                   /translation="MIEIGRLPNERAAQALVDYLKGQNIDCKVIAAEQGVSLIVIHDQD
FT                   SVRAGIEFQRFIQNPYDEKYLQASWDNGDTNAKFDYGAPTLQLLTQFITGAGPLTLSIF
FT                   GVCILIFAGFNLGFANPIYEYLSFFNAVPGTELTDFWRVFTPSLLHFSALHIIFNLLWW
FT                   WYLGGKIENKIGISPLLTLLLVAGTLPNILQYFIGGPHFGGLSGVVYGVVGYTWIMGVK
FT                   RPEKGIGLPPALMGFLMLWLVFGFTDLFGLSIANGAHTGGLVVGLLQGLIDSKRRT"
FT   gene            complement(111747..112055)
FT                   /locus_tag="Ssed_0099"
FT   CDS_pept        complement(111747..112055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0099"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: slo:Shew_3711 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34712"
FT                   /db_xref="GOA:A8FPD9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPD9"
FT                   /protein_id="ABV34712.1"
FT                   /translation="MSSFQHFSVNQLIQLSESNPDIQIADIRDAASFESGHVEGAINLS
FT                   NENLANFIAEADMDLPLIVICYHGISSQSAAQYLVEQGFDHVYSLDGGYQAWREAHT"
FT   gene            complement(112132..113157)
FT                   /locus_tag="Ssed_0100"
FT   CDS_pept        complement(112132..113157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0100"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /note="KEGG: slo:Shew_3710 L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34713"
FT                   /db_xref="GOA:A8FPE0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPE0"
FT                   /protein_id="ABV34713.1"
FT                   /translation="MKALSKLKPEEGIWMVDAPKPEMGHNDLLIKIRKTAICGTDIHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVIDMGIEVRGFDVGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELANKMGATRAVNVAKESLEG
FT                   VMEELGMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKIAMLGIPGGEMAIDWSKVIFKGL
FT                   ILKGIYGREMFETWYKMASLIQSGLDISPIITHHFKIDDFQQGFDAMRSGQSGKVILNW
FT                   D"
FT   gene            complement(113194..114387)
FT                   /locus_tag="Ssed_0101"
FT   CDS_pept        complement(113194..114387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0101"
FT                   /product="Glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: slo:Shew_3709 2-amino-3-ketobutyrate coenzyme
FT                   A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34714"
FT                   /db_xref="GOA:A8FPE1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE1"
FT                   /protein_id="ABV34714.1"
FT                   /translation="MTTTSFYNQINQQLADVKAEGLYKSERVIVSPQQTEIRVNGTEVM
FT                   NFCANNYLGLANHPELIKAAQAGLNDHGFGMASVRFICGTQDIHKQLESSLSEFLGMED
FT                   TILYSSCFDANAGLFETLLSAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMADLEA
FT                   QLKAAKEAGARNIMIATDGVFSMDGVIANLKGVCDLADKYGALVMVDDSHAVGFIGANG
FT                   RGTHEYCEVMDRVDIITGTLGKALGGASGGFTSAKKEVVDWLRQRSRPYLFSNSLAPSI
FT                   VTASIHVLEMLKSGQALREAVWENSRYFREKMTEAGFTLGGADHAIIPVMIGDAKLAGD
FT                   FANRLLEENIYVVGFSFPVVPKGQARIRTQMSAAHTKAQIDRAIEAFTRIAKEMGII"
FT   gene            complement(115044..115700)
FT                   /locus_tag="Ssed_0102"
FT   CDS_pept        complement(115044..115700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0102"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: sbl:Sbal_0059 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34715"
FT                   /db_xref="GOA:A8FPE2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE2"
FT                   /protein_id="ABV34715.1"
FT                   /translation="MKTRDKIIYTSLELFNEHGERNITTNHIAAHLGISPGNLYYHFRN
FT                   KEDIIRSIFALYHDHLESGFQPYEGEPISIELLINYFDAMFYAMWEFRFMYANLSDILS
FT                   RDEELKKLYLAAQKQVLTRSSQILIKLNQDGVLSIEQDEIIPLTETMKMIVSFWIGYKQ
FT                   IHSIDTRITKTSLYEGLLRLLMIAKAYSTPDSRATFVRLEQHYRRLAASPTAQSV"
FT   gene            complement(116061..116738)
FT                   /locus_tag="Ssed_0103"
FT   CDS_pept        complement(116061..116738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0103"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: spc:Sputcn32_3900 transcriptional regulator,
FT                   TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34716"
FT                   /db_xref="GOA:A8FPE3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE3"
FT                   /protein_id="ABV34716.1"
FT                   /translation="MKTRDKIIHASLKLFNERGERNITTNHIAAYLNISPGNLYYHFRN
FT                   KEDIISSIFLLYEAHLDSGFQPYMGQEVNLELLVGYFDTMFETLWEFRFMYDNLTDILT
FT                   RDEAVLKRYQHTQQQALTRSSHILSKLRQDGVLAIEQEQITPLADTMRMIACFWIGYKQ
FT                   THSINATITKASLYEGLLRVLMIFKAHATPESQGTFTRLEQHYQAMANTCFMPNLDVHS
FT                   LAS"
FT   gene            116896..118164
FT                   /locus_tag="Ssed_0104"
FT   CDS_pept        116896..118164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0104"
FT                   /product="three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="KEGG: slo:Shew_3707
FT                   three-deoxy-D-manno-octulosonic-acid transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34717"
FT                   /db_xref="GOA:A8FPE4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE4"
FT                   /protein_id="ABV34717.1"
FT                   /translation="MNRFIYSILLYLLFPLLVIYLAVRAIKSPDYRGRWGERFGLTSLK
FT                   GSDLLIHSVSMGETLAAIPLIKAIQQAHPQLSITVTTTSPTGSAEVTKAFGDSVQHCYL
FT                   PFDLPFSVRRFLKQVDPQYCIIMETELWPNLIHQASRCGIKLMLANARLSEKSAGKYQK
FT                   QITLSQPMLQSLDSIAAQSQQAADRFIALGVNADRVEVCGSLKFDLTIADDKREQAKAL
FT                   RQQWRAVTCPVWIAGSVHPGEFDAILAAHRHLLTIYPDALLIMVPRHPEKFDAAASKIS
FT                   ESGFTLARRSLKESVDDETQVLLGDTMGELLTFYGAADQAFVGGTIVENGGHNPLEPAA
FT                   LGLPVFVGPHHWDFAEITGLLNEAGALQLVSSAEELGTALVRNFEDKSAYQVASEAGLS
FT                   VVDANKGALQHQFDLANRLIAFE"
FT   gene            complement(119268..119990)
FT                   /locus_tag="Ssed_0105"
FT   CDS_pept        complement(119268..119990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0105"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="KEGG: slo:Shew_3706 lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34718"
FT                   /db_xref="GOA:A8FPE5"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE5"
FT                   /protein_id="ABV34718.1"
FT                   /translation="MQIKQTSSGAIAYCDATPETISVPWFTFDYWQSQGAITGSSKGRY
FT                   TTWFVKPNMAETDKSEWVLRHYYRGGLMEKISKDSYFYTGLKNTRAVAELSLLELLYSE
FT                   GFEVPRPIAANVERNGLYYRADIIIERVEGAQDLVAQLSKSPMSDLQWQQLGACIAKFH
FT                   QRGVYHADLNAKNILITPDKFYLIDFDRGEIRTPNPKWQGANLERLLRSFRKELAKLPT
FT                   LAFNETNWQSLMQGYSNP"
FT   gene            complement(120074..120943)
FT                   /locus_tag="Ssed_0106"
FT   CDS_pept        complement(120074..120943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0106"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: pat:Patl_2129 dTDP-4-dehydrorhamnose
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34719"
FT                   /db_xref="GOA:A8FPE6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE6"
FT                   /protein_id="ABV34719.1"
FT                   /translation="MTNSRLKVLILGKSGQLAQALIANKPTPIECVALGHLDINLAVTG
FT                   EIESAITTNRADIIINTAAYTQVDLAESEPSLAFEINALAVENIAKAARNTNVHLIHLS
FT                   TDYVFDGKQSTPYTIFDTPHPINIYGASKLTGEKALRQCMPVGSTTVRTSSVYSQYGNN
FT                   FVKTMLRLMREKSEIKVISDQISSPTSAKELARFLWMLTEQESLSPLYHWCDSGKTSWY
FT                   QFAVTIQQLALKYGKLEKAISIIPISSQEYGAAALRPPFSQLDIGQSQALLHSKPWQEN
FT                   LESLIKRL"
FT   gene            complement(120940..122043)
FT                   /locus_tag="Ssed_0107"
FT   CDS_pept        complement(120940..122043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0107"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: abo:ABO_0910 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34720"
FT                   /db_xref="GOA:A8FPE7"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE7"
FT                   /protein_id="ABV34720.1"
FT                   /translation="MSMHKDKTVLVTGGAGFIGSALVRFLINETSHRVINLDKLTYAGN
FT                   LESLTSIESNERYHFILGDICDRPLVDDILKRYQPDIIMHLAAESHVDRSIDGPDEFIQ
FT                   TNILGTYTLLEASRSYLAELEGCKQQDFRFHHISTDEVYGDLGETGLFTEQSPYNPSSP
FT                   YSASKAASDHLVRAWCRTFQLPVVITNCSNNYGPFQFPEKLIPLVILNALEGKPLPVYG
FT                   DGKQVRDWLYVDDHARALYKVATDGKPGSTYNIGGYNEKQNIDVITTICDQLNSLIESK
FT                   PSGIEEFNQLITYVKDRPGHDLRYAIDATKIKNELGWKPVETFESGIVKTIQWYLDNLE
FT                   WCRHIRDGSYRKISANDNNQMDETPNG"
FT   gene            complement(122040..122612)
FT                   /locus_tag="Ssed_0108"
FT   CDS_pept        complement(122040..122612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0108"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: shn:Shewana3_1382 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34721"
FT                   /db_xref="GOA:A8FPE8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE8"
FT                   /protein_id="ABV34721.1"
FT                   /translation="MKVIDTPIADLKIIEPNLFGDERGFFFESFRDSWFREHVSDVHFV
FT                   QENHSRSKRGILRGLHYQSSQTQGKLVRVISGEVFDVAVDLRRESTTYGQWFGTYLSEE
FT                   NRRQLWIPAGFAHGFYVISESADCIYKCTDYYAPEFEKTIIWNDTELSVDWPLSRVNRS
FT                   KTDDIAQPILSAKDSAGLAFNSREHWL"
FT   gene            122793..123821
FT                   /locus_tag="Ssed_0109"
FT   CDS_pept        122793..123821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0109"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="KEGG: slo:Shew_3702 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34722"
FT                   /db_xref="GOA:A8FPE9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPE9"
FT                   /protein_id="ABV34722.1"
FT                   /translation="MSLKLNKINSLCLLRLSAIGDVCHAVAMVQAIQRKYPALKITWVI
FT                   GKVEYQLLKHLEGVEFVIFDKSQGWRSYFNLRKALAGQRFDVLLHMQVALRATIASLAI
FT                   SAKVRIGFDRFRAKEGQWLVTNHKVEPQETPHVLEGFMGFAKALGVTDLSPKWNIPVPS
FT                   ADTEFAQKMIPDGDKTLVICAAASKAERNWLPERYAAVAEHAISRGCRVMLCGGPVPLE
FT                   IELAEAIERACSQPLENQVGKTSLTQLLAILKQAAIVLAPDTGPAHMAVTQGTPVIGLY
FT                   AHSNSGRTGPYFSLDTVVSVYDEVIAEQVDSPVWGTRAKGEHLMAKIEVTPVISQLDKL
FT                   LS"
FT   sig_peptide     122793..122876
FT                   /locus_tag="Ssed_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.680) with cleavage site probability 0.493 at
FT                   residue 28"
FT   gene            123931..124686
FT                   /locus_tag="Ssed_0110"
FT   CDS_pept        123931..124686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0110"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="KEGG: sdn:Sden_0205 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34723"
FT                   /db_xref="GOA:A8FPF0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF0"
FT                   /protein_id="ABV34723.1"
FT                   /translation="MENRSVALVLTSCNRFDLLEKTLVSFFKFNTYPIAQHIIIEDSHN
FT                   LDKLNKVLVKFPGVDFTVLNNEPQLGQMKSIDRAYSKVTSEYIFHCEDDWEFYREGFIE
FT                   DSFKVLDSDDKVVTIWLREQNDTNEHSVEPEVFKCKDPSGRDYQIMMRNYRRKADSDVW
FT                   HGFTFNPGLRRLKDYQLVAPIGELGREWNMSELYHGKGFKGAIFETGYVRHIGDHRGIR
FT                   YKIGESQFAKDVSVGCKRIKAGICKLFGV"
FT   gene            125110..125868
FT                   /locus_tag="Ssed_0111"
FT   CDS_pept        125110..125868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0111"
FT                   /product="glycosyl transferase, family 25"
FT                   /note="KEGG: sdn:Sden_0207 glycosyl transferase, family 25"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34724"
FT                   /db_xref="GOA:A8FPF1"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF1"
FT                   /protein_id="ABV34724.1"
FT                   /translation="MKFKVYIINLDSSVDRWEQLSSQCDQMGIEYERVSAVRGSELTEQ
FT                   ERAKVYDLPTNLEKYDKRLNDGEIGCYLSHIKCWEKIIEEELDFALILEDDVSLRENIK
FT                   ECIAQFFSMDSSDWDYIKLFHRKRLKMKVASLNLDEGVQLHKVAKLPASTCSQFVSQVG
FT                   AKKLLKHSFPIARPVDVDIQYWFERELRCFVVSPPVAVPAGFDSEIDIIGQHRDYVQRR
FT                   AFKRIWLRVIYEINVLLNTFKLSPFPKMKG"
FT   gene            complement(125937..127007)
FT                   /locus_tag="Ssed_0112"
FT   CDS_pept        complement(125937..127007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0112"
FT                   /product="Glycerol dehydrogenase-like protein"
FT                   /note="KEGG: chy:CHY_2583 putative glycerol-1-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34725"
FT                   /db_xref="GOA:A8FPF2"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF2"
FT                   /protein_id="ABV34725.1"
FT                   /translation="MSDFTRKLNTRHLEFPAQLLVEKNAIANTPLLSNLPLSQGVLLAI
FT                   DDGVKTLAEQVLPHLWASKSCTTHVIEKADFTNVSQIDAICAERQIETVVAFGGGKVLD
FT                   VCKRLASLRHIELIVIPTALSSDCVSSPIAVIFDESGKKLSLPAAIPNVIIVDTKLCSQ
FT                   APRRLTQAGIGDLLSNYCALLDMNYAKDRADVDGFSYLLAKSAANEIVGMQHLSLTDQA
FT                   VITQLAEGLILSGLAMGFSGDSRPCSGAEHLISHALDFLNLGDGLHGEQVALGMKFCHH
FT                   LRLLLNLPALNPSVLACIDGFNIRSTPDSLNISKNEFFEALAISPEMRKGRMTFLEKQN
FT                   SIPKAQLEKAYINAFE"
FT   gene            complement(127008..127427)
FT                   /locus_tag="Ssed_0113"
FT   CDS_pept        complement(127008..127427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0113"
FT                   /product="cytidyltransferase-related domain"
FT                   /note="KEGG: sfr:Sfri_3930 cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34726"
FT                   /db_xref="GOA:A8FPF3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF3"
FT                   /protein_id="ABV34726.1"
FT                   /translation="MSKKVLVVGVFDLFHRGHVEFLQKASEFGDELIILINGDEMTEKY
FT                   KRRPIYSEDDRATILNALSCVSQVEVTNSFDIKPIIEKYNIDVIVHGDDWEHESYLAQI
FT                   RCTQSYLDEQGVSLAYTEYHKSVSTSTLLKQIKEA"
FT   gene            127714..128772
FT                   /locus_tag="Ssed_0114"
FT   CDS_pept        127714..128772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0114"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="KEGG: sfr:Sfri_3931
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34727"
FT                   /db_xref="GOA:A8FPF4"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF4"
FT                   /protein_id="ABV34727.1"
FT                   /translation="MICFDVLHPYYLPQYLPVKDELIKRGETAHFIVYRNPEQQAALDA
FT                   LVSQHQLNVQWVNNAEEALAFYLENKPKWVIFGNSFDASSKLKGISKTALMQHGIGPKA
FT                   CYYTVSESDMDVRFVEGEYRLNRLQQLFPSKTFIDTGYAKLDPILQGHEKGLDLKAIGL
FT                   DPSKPTLLYAPTFYPSSIEKMAKQWPEHFAEYNILLKPHYFSLSKAGYKKQKQLLEFWA
FT                   SFDNVYLAPVEETNLVPFMASADLLISDASSALFEFAALDKPVVWCDFYHLRWSYRGIF
FT                   KFRFNKRMDNDLYRYAGVAAHAETYGNLKAVVDEQLINPDLFAPQRAKYTQELAGRVDG
FT                   LASKRIVNYLLG"
FT   gene            128826..129302
FT                   /locus_tag="Ssed_0115"
FT   CDS_pept        128826..129302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0115"
FT                   /product="Pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: shn:Shewana3_4091 pantetheine-phosphate
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34728"
FT                   /db_xref="GOA:A8FPF5"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPF5"
FT                   /protein_id="ABV34728.1"
FT                   /translation="MHTRAIYPGTFDPVTNGHADLIERAAKLFKHVVIGIAANPSKKPR
FT                   FTLEERVALLQLVTSHLDNVEVVGFSGLLVDFAKEQKASVLVRGLRAVSDFEYEFQLAN
FT                   MNRRLSSDLESVFLTPAEENSFISSTLVKEVAHHGGDVSQFVHPEVAKALMTNV"
FT   gene            129317..130810
FT                   /locus_tag="Ssed_0116"
FT   CDS_pept        129317..130810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34729"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF6"
FT                   /protein_id="ABV34729.1"
FT                   /translation="MMENLKSFGVRAFAILSLFTSFISVSAPWVDTSDIYLRADIQALA
FT                   DEGVITVPVNTYPLMWAGIGADLSKVEPSVLPPSVAQAFARVNYYYRNAVENRGNTRIK
FT                   AAAATDAARFQHFGSDYSEQGELQASYEYMGDRFAFKASASANYDPSDEKEFRYDDSYM
FT                   AVILGNWIFTAGAVEQWWGPGFDSSMHRSNNARPLPSVMISRNNAAAFETPWLSWLGPW
FT                   TLTAGVSRLEEERAVANPLLWNFRSSLRPFRQLEVGFSWTTQFCGEGEECSWESALKSI
FT                   TGQRDCRGAGEAGCTNYGNQMAGYDIRFSDTWFDIPFGVYYEKTCEDAKGSTPWDIVDC
FT                   GHAAGVDTRFNFDNAQYKLFFEYTDTMVACGEDDNVFNCMYEHSIYKSGSRYYDKAYGS
FT                   TYDSDAKVYVLGLIGQFADSRGITSLLRYAQLNKDGSSPAHGWAPQPAKEDLLMLELSY
FT                   RMPIWKGMMSVGGTVSQSEFEVEDKQTDATLFGTYEYRF"
FT   sig_peptide     129317..129397
FT                   /locus_tag="Ssed_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.828 at
FT                   residue 27"
FT   gene            complement(130893..131714)
FT                   /locus_tag="Ssed_0117"
FT   CDS_pept        complement(130893..131714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0117"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: slo:Shew_3690 formamidopyrimidine-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34730"
FT                   /db_xref="GOA:A8FPF7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF7"
FT                   /protein_id="ABV34730.1"
FT                   /translation="MNMPELPEVEVTRQGITPHLVDQQATALTVRNASLRWPVPDIAQQ
FT                   IVGETIRNVRRRAKYLLIDTDAGTTIVHLGMSGSLRIVSRNTPVEKHDHIDLELASGKI
FT                   LRFNDPRRFGAWLWCELPEEAHPLLSKLGPEPLKDGFNPTYLEQILKNKKKAIKLCLMD
FT                   NHIVVGVGNIYANEALFAAGIHPETQAGNVDTERLTILVTEVKQILANAIKQGGTTLKD
FT                   FTNAEGKPGYFAQKLHVYGRGGETCTQCGNLLSEIKLGQRATVFCGLCQTK"
FT   gene            complement(131773..132255)
FT                   /locus_tag="Ssed_0118"
FT   CDS_pept        complement(131773..132255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34731"
FT                   /db_xref="GOA:A8FPF8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF8"
FT                   /protein_id="ABV34731.1"
FT                   /translation="MALSRKKWNNVIIIASLLMITILTLLDDKTSQLPDDAHPLFDNTS
FT                   PLAQLQVNELWLNKGSSNWQCHPKILNCQVWAKAWSEIQLSPLVDQQELFKHSSADTPK
FT                   EVIIVIANSEQAQPWSWYEKLGLLKSPANNWYLIPPSQREGLSPIIKISAASNTDS"
FT   sig_peptide     complement(132175..132255)
FT                   /locus_tag="Ssed_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.607 at
FT                   residue 27"
FT   gene            complement(132415..133401)
FT                   /locus_tag="Ssed_0119"
FT   CDS_pept        complement(132415..133401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0119"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: slo:Shew_3688 molybdenum cofactor biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34732"
FT                   /db_xref="GOA:A8FPF9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPF9"
FT                   /protein_id="ABV34732.1"
FT                   /translation="MSLIVDTFGRKVEYLRLSVTDRCDFRCVYCMSEDPCFLNREQVLS
FT                   LEELAWVGQAFTELGVRKIRLTGGEPLVRTDCDQLVKLLGDLPGLSELSMTTNGSRLTK
FT                   FAEKMRGSGLGRLNISLDTLKPELFTELTRNGKLERVIEGIDAAKAAGFTRIKINAVIL
FT                   RGQNDDEVLDLIEFCRGRELDIAFIEEMPLGIIDERKKSRHCSSEEVKSIISKRYELSV
FT                   SNKRTGGPARYYTMPGSSIHVGFISPHSNNFCHECNRVRVTVEGRLLLCLGNEHSVDLK
FT                   AILREFPGDIEKLKTAILDAIKLKPKEHVFGPEGDVQILRFMNATGG"
FT   gene            complement(133479..135284)
FT                   /locus_tag="Ssed_0120"
FT   CDS_pept        complement(133479..135284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0120"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="KEGG: slo:Shew_3687 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34733"
FT                   /db_xref="GOA:A8FPG0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG0"
FT                   /protein_id="ABV34733.1"
FT                   /translation="MSIPFTNPLTIPVLGFCAYSGTGKTTLLKKLIPELNRRGVKLAVI
FT                   KHAHHNFDVDIPGKDSYEMRKAGARQMLVASHVRWALMTEDAVGDDPKLPHLLQQIEQD
FT                   SVDIVLVEGFKKLELPKIELHRAAHDKPFIHTHDKNIQAIACCDETELPGDLRRLDIND
FT                   VAQIADFVIEYANNWQPASVNLPLSPAPECGCEVDTSKTLSVRQGIDKILSYVNPITAG
FT                   EVLPLDELNSRVLAEDAISPVDVPQQTNSAMDGYAFKHSSPMLASYKIVADVMAGHQYS
FT                   KVLQTGEAVRIMTGATVPAGADTVQMKELATELEGQVSFQGDITLGQHIRLAGEDIAKG
FT                   HTALAANARLQAPEQGLLASLGFGQLPVFKRPRVAIFSTGDEVCQPGEPLQPNCIYDSN
FT                   RFTIKSMVRKLGCEVIDLGIIHDSEDALADALSQAAVDADVVISSGGVSVGDADFIKLA
FT                   LERVGQINFWRINMRPGRPLAFGQIGDSLFFGLPGNPVAVMVSFMQFVQPALRKLAGEN
FT                   SWAPTMVPAITDTGLRSRVGRTEFTRGIYHLGTDGKLHVTTTGAQGSGMLSSMVKGNCF
FT                   IVISEKDDQLNPGDTVYIQPFADLL"
FT   gene            complement(135299..135889)
FT                   /locus_tag="Ssed_0121"
FT   CDS_pept        complement(135299..135889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0121"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="KEGG: slo:Shew_3686 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34734"
FT                   /db_xref="GOA:A8FPG1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPG1"
FT                   /protein_id="ABV34734.1"
FT                   /translation="MSLQIDAVILAGGMARRMGGNDKGLVELQAQPMIKHAIDRIKPQV
FT                   REILINANRNQTRYAEFGYQVISDEDSGYLGPLAGMITAMGQTQAKYLLVVPCDCPLLP
FT                   ADLVERMLSQLEKENADLAVASDGKREQPVVLLLKPELRDSMKAFLDAGERKIDFWYAK
FT                   HNCAVADFSDQPNAFVNVNTPEQKQQLSEAIAK"
FT   gene            complement(135873..136592)
FT                   /locus_tag="Ssed_0122"
FT   CDS_pept        complement(135873..136592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0122"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_3685 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34735"
FT                   /db_xref="GOA:A8FPG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG2"
FT                   /protein_id="ABV34735.1"
FT                   /translation="MVKLVANNLEMKFGERHIFSVDRLQLSQGQTIHLQGDNGCGKTTL
FT                   MKLLAGLISPSRGAITTEGFEPLPWWRSNALLGKAVYLHQHPYLFDGSVEYNLSYPHPF
FT                   CNMTKQQLSDRTQTAIEMAELTHLKNQAASSLSGGEKQRLAIARAWIMQPKLLMLDEPT
FT                   SNMDRFSQDLVLAMISDLQQLGTGMLISSHQSCVLTSLCNQTWVIENQHIMSSSTADNI
FT                   PASAPINLQEPRYVIAN"
FT   gene            complement(136595..137302)
FT                   /locus_tag="Ssed_0123"
FT   CDS_pept        complement(136595..137302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0123"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="KEGG: slo:Shew_3684 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34736"
FT                   /db_xref="GOA:A8FPG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG3"
FT                   /protein_id="ABV34736.1"
FT                   /translation="MNEGWLALLQQALGLLFSLDPDVWSIVSVSFSVSFAALGITLLPS
FT                   MILGFMLAFGRFPGRWFVTNLIQTLQSIPTVVIGLLVYLMLTRMGPLGDLRWLFTQKGM
FT                   ILGQMMICAPVLVAMSQAAFTSVDRRAWETSRTLGASWFRGILTVCRELKVPLLMAIVA
FT                   GFSRILTEVGCSMMVGGNIADVTRNIPTAIALETSKGDFAQAIALGLVLLILSLVLNFT
FT                   LGALRGKAEPRSH"
FT   gene            complement(137397..138209)
FT                   /locus_tag="Ssed_0124"
FT   CDS_pept        complement(137397..138209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0124"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="KEGG: slo:Shew_3683 extracellular solute-binding
FT                   protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34737"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG4"
FT                   /protein_id="ABV34737.1"
FT                   /translation="MLNLKSIFSFALAATLVTGMPAQAEEIIKLATTTSTENSGLLKNL
FT                   LPKFEAESGYKVQVIATGTGKALKLARQGDVDVIMTHAPAAEAKFVDEGFGLLPRGIME
FT                   NDFVILGPKNDPAKIRNSKTVEEAFAKIAESGAIFVSRGDNSGTNMKEMIIWNNAKVDA
FT                   SFAGYKSVGQGMGKTLLMANELQGYTLSDRGTFVAYKAKLDMAIDFDGGQALANPYQIM
FT                   LINPAKYPDLNHKGARAFSDWLIGAEAQGMINSYKVQGEQLFKATYSE"
FT   sig_peptide     complement(138135..138209)
FT                   /locus_tag="Ssed_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            138433..139866
FT                   /locus_tag="Ssed_0125"
FT   CDS_pept        138433..139866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0125"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, fis family"
FT                   /note="KEGG: slo:Shew_3682 two component, sigma54 specific,
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34738"
FT                   /db_xref="GOA:A8FPG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG5"
FT                   /protein_id="ABV34738.1"
FT                   /translation="MMLESPLNESKCPKEDNMSQNKKDLKPLPSAVSVLIVDDEPGMRS
FT                   FLKKALSKKFALVETASSVEDAEQLRSRCHFDLLVVDIRLPGRSGIEWHEALNDQERRS
FT                   DIIFMTGYADMDVAIKALRAGASDFIMKPFHLEQMMKAVDRCIERRLLKRENLMLRREV
FT                   SIGQSSTIIGSSDAMQEVKHVIERVAPTNAVILIEGESGTGKELVARQLHLLSGRQGPF
FT                   VPVNCGAIAPELLESELFGHAAGAFTGAKGNREGLFSFASGGTIFLDEIGEMPLKMQTA
FT                   LLRVLEQRTIRPVGSEKETNIDVRVLAATNRKLAEEVEEGNFRRDLYYRLNVLDIVIPP
FT                   LRDRPEDVVELTHHFTRQLASELGVKEVVWSHEDMLKLQQHEWPGNIRELRNMIERCIL
FT                   LGKPPAEYWKQQPKSDMPNESGYPLDWGLKEVEKHHVTQVVDLHNGNKSAAARDLGVSR
FT                   KTLDRKYKEWFDTDKQEES"
FT   gene            139868..141985
FT                   /locus_tag="Ssed_0126"
FT   CDS_pept        139868..141985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0126"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: slo:Shew_3681 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34739"
FT                   /db_xref="GOA:A8FPG6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG6"
FT                   /protein_id="ABV34739.1"
FT                   /translation="MSFFPRIFGINWQQMQAKVRYRILILTLLPILLTLVSLVFITIYW
FT                   NISYTGKQLFMKVKADLTVANNTLISVQKSQEKQLELVMESWEFQNDFRLFDGNKNSYR
FT                   KQIDHLLDSKKQLLNLDFLRLVSVSEAAADPDLRVMLQKVKGDSAYSGLMVLEPKRLAL
FT                   IDPEMVKTASIPLVETPRSQKPTKKVEDRGLLSRSLLPVPDAEGNVAWYLDGGILFNRD
FT                   IRIVDHIRDLVYDKGTLPERSIGTVTIFLDNTRISTNVPLHFFPQGGEVEGRALGSLVS
FT                   EEVKQKVFSQGMLWVDRAFVFNDWFISAYAPLEDVQGKRIGMIYTGFSESPFIHNYLLN
FT                   IIELGTILMLVLLVSGLLVYRGAYSLLQPIERIHHVVKAVQSGRNLRIGSLGLERDNEL
FT                   SNLAEQFDRMLDLLQRRNSQIQAAAEQLEVKVEERTRSLQEKTEELQNNVALLNETRQQ
FT                   LVTNEKLTALGELTAGIAHEINNPTAVILGNMELMKYELGDRAEDVEEEIDLVIQQVGR
FT                   ISTIIRSLLQYSRPGEFNAPLEMHQLTPIIEEMLVLVRHSIQEQKVILNQELNASYPIE
FT                   VNRPQLLQVLINLVVNAAHAMDEEGRIWIRTYDWVQRGEPIGVKIEIEDEGKGIPQEQL
FT                   SRIFDPFYTTRADGTGLGLSLSYGIIKRIGGTIEVSSTVGKGTLFTIGLYHKAKEEQVD
FT                   TPYEGLHFNGH"
FT   gene            complement(142251..142721)
FT                   /locus_tag="Ssed_0127"
FT   CDS_pept        complement(142251..142721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0127"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="KEGG: saz:Sama_0127 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34740"
FT                   /db_xref="GOA:A8FPG7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG7"
FT                   /protein_id="ABV34740.1"
FT                   /translation="MYNVEIETTTELTPDLLNCLLDIHRQIPEFDKPYPESEYQVRLNH
FT                   KPILIMFIRVEGELAGFKLGYELNGSTFYSWLGGVIPEYRNLGLAQHLLQAQESWARES
FT                   GYQQIEVKTLNRFSSMLAMLTASRYQITNMTQATDKVENNKIKLQKSLIEAV"
FT   gene            complement(142834..143499)
FT                   /locus_tag="Ssed_0128"
FT   CDS_pept        complement(142834..143499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34741"
FT                   /db_xref="GOA:A8FPG8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG8"
FT                   /protein_id="ABV34741.1"
FT                   /translation="MLTLTNAQIRRALLVLVGFHILIICASNYLVQLPFQIFELHTTWG
FT                   AFSFPFVYLATDLTVRIFGQSAARRIILKAMIPALLISYLMGVIFHQGSFQGFTALSEF
FT                   NNFVFRIAFASFAAYLIGQLMDITVFAKLRNTQSWWVAPAASTLIGNLVDTLVFFSLAF
FT                   YASSDSFMAAHWPEIASVDYGFKLIVSLGLFLPAYGVLLKVLERKIVKLPTQQELATN"
FT   gene            143796..144581
FT                   /locus_tag="Ssed_0129"
FT   CDS_pept        143796..144581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34742"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPG9"
FT                   /protein_id="ABV34742.1"
FT                   /translation="MVISMKRLTLTTLLICLILLPSHLLANPTPLIEGPRVVTIATDSW
FT                   LGYTNRDGSGYYFDILKRVFPEKEWLLQIDIVPFSRVRYLVNHNRIDMALGFYSGDTTR
FT                   ALYSKNPVEVDSVDAAITPELAVIWKGAESLSQKKVQALLAYRYDEFISVPMYYEESSN
FT                   LLEMLNRVNRGQVDAVLDYKPVMLTMVPKLNQPRQFVIIENVFRTEIYFVFSDNDRGAK
FT                   LKRHFDRELKKLIDSGELDELFRHYVGPDAQRLDPGREQ"
FT   sig_peptide     143796..143876
FT                   /locus_tag="Ssed_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(144687..145931)
FT                   /locus_tag="Ssed_0130"
FT   CDS_pept        complement(144687..145931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0130"
FT                   /product="isochorismate synthase"
FT                   /note="KEGG: slo:Shew_3677 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34743"
FT                   /db_xref="GOA:A8FPH0"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH0"
FT                   /protein_id="ABV34743.1"
FT                   /translation="MPAIAWLAAQPIYPRIYWKGRDTEEEVAAVGSCKDFAYEEAVDDN
FT                   QLSLEYQKQRALSNNQDIRYYGGVAFDRTTECWPEFGRAHFVLPRIELRRSGEEYKLLI
FT                   NLNCESNDTETERTKAIEDLAKLVFPSPLSPPNKINLLSRSDRPDHYHWTELVKKVTHE
FT                   KFIQDTPKVVLSRLTQLEVDEEVDPWTLLACWQGRNQNSFQFGFQFSPERAFISCTPER
FT                   LYRRRQRELFTEALAGTTTRGLNQEEDRVLAQQLLEDSKNSHENQLVKEHIVDALTPLS
FT                   NYVGAEETPRVFKLSHIQHLHRSIRAELKPGIDDFQLLQALHPTPAVGGLPKEPAMSFI
FT                   RQREGYARGWYAGACGYFNKYESEFAVAIRSALIEPGRINLFAGAGIVSGSEPEAEWVE
FT                   LENKLTTILSILTEL"
FT   gene            146463..148496
FT                   /locus_tag="Ssed_0131"
FT   CDS_pept        146463..148496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0131"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="KEGG: sbl:Sbal_0089 TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34744"
FT                   /db_xref="GOA:A8FPH1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH1"
FT                   /protein_id="ABV34744.1"
FT                   /translation="MKVQQKIIKMSAIALAIGSSGAVFADDIDRDPILNVNEVIVVHGE
FT                   RPTATEVATTHWSIDEDEIKALGAQSLEQVLKNVPGVYVRTGGQGTPRVDIRGFKTRHV
FT                   TLLINGVPANGAEDGQFDPSVIPTSQIASVEVSVGPTSVLYGPGGAGGVINIITKQGDD
FT                   ASTLSGRLEASGEDTFNGDISAAGSGDNWQGLVSVSHQQTNGFPLSGDYPHNDVQLDDV
FT                   RANSDKEIDNIYAQGSYWLSDNTQVTANMSLRSGQWGKPSRDGSGSGTVKFERADDYDA
FT                   KTFQLGMAHKFSEMFTLRGFGYHNQSDVLETQYTDSSYTKVKQSQDGRSKVQGGNLQFI
FT                   TNFGDVGLLTSSLIAENQSWESTTSKPSTGDKSSQKQSRVLDGYSGGSGGGNGGGSSNF
FT                   DDSAWLYTLAAEYQYQDDGYYGFTIGGALHDQDRVKESENDYSGQLSGFWQAFEQTRFN
FT                   AGIARKVRFPSMKNLYSQSSGNADLVAETSKHFELGVEQELGASTALSVAGYYTDAENY
FT                   IAKDMSGVYQNMGRYQFKGVDVSLNNQFIDDLSLTFVYSFLDTEDKDAFDGMGTLEYRP
FT                   RHQLRFQADYELPFAMRINMNIERIMGQVYYEQEKVNGNKVWTEQSLKDYTLLDLNLVQ
FT                   PVLDDKLELYIRATNLLDENYYQSDAIPQAGRQVFVGISWQI"
FT   sig_peptide     146463..146540
FT                   /locus_tag="Ssed_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            148659..150035
FT                   /locus_tag="Ssed_0132"
FT   CDS_pept        148659..150035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0132"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: sbl:Sbal_0090 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34745"
FT                   /db_xref="GOA:A8FPH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH2"
FT                   /protein_id="ABV34745.1"
FT                   /translation="MDMVCSDMNLLELDRVSFRYHSDSPLVLNEASLAIRKGECHCISG
FT                   PTGSGKSSLLNLIVGCLSRPFEGELHIADGVVLGLVMQDPNVQFIRQSVGAEVAFALEN
FT                   LAVPYDLMVGKVQAALRKVGLYVSLDMPIEQLSLGQKYRLMIAAQLVYEPDILLLDEPW
FT                   AQLDDMGVDELMSVLRLLKSDNVAIVLVEHNPAAFSDLVDHFWQLKDGKMTSGCFQSAP
FT                   ISFTRPGYIPVGESVLAFEPFEFCFEDQSPLFVCHDHLELFEGEIVALVGDNGAGKSSL
FT                   LKSIAGIQSNVRALPLAVLGKQPKLGIFGGELGLLLQRPNRQLFENTVLEEMQFSLKRF
FT                   GLPLENADRLLREMGLEDLKSHSPHTLSYGQQHLVALASLASLKPKVLLLDDPLAGLDQ
FT                   AFYCRVWQVLVSLSQQGTAILFSSHRQMNHMPVTRSWQLSDGLLYDDLSLAGVESVSAG
FT                   "
FT   gene            150025..150717
FT                   /locus_tag="Ssed_0133"
FT   CDS_pept        150025..150717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0133"
FT                   /product="cobalt transport protein"
FT                   /note="KEGG: sbl:Sbal_0091 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34746"
FT                   /db_xref="GOA:A8FPH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH3"
FT                   /protein_id="ABV34746.1"
FT                   /translation="MRAKGRHKATEYRGAAGFDHHRLERAAARKSGYITATSLILVLLL
FT                   SSGAFFLPDRYIPGLIACEICLVIHGVYRRGSLGVIARVFFVQLTITMSLYYLIHGQSQ
FT                   LAQGAVAVLRILLAFIPGWWLSITCAPERIGEVLTWVLPVKWAFVIAASISLLPYMTVE
FT                   LREIYHIQCLRGARINPKALRDPRNWSELINCVIFPVLIQLLKLSRQIAVAAQLRYFGK
FT                   SNQPTHWR"
FT   gene            150785..151330
FT                   /locus_tag="Ssed_0134"
FT   CDS_pept        150785..151330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34747"
FT                   /db_xref="GOA:A8FPH4"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH4"
FT                   /protein_id="ABV34747.1"
FT                   /translation="MSKSFNFSLQDALFIGFCATLLVALKSMLRLKLGISGHSMFLMTF
FT                   FYLICYGVVGRVGCISACGVLSGLVAMILSVGKGGPLILIKFALPAIAMDLSLLVFAGL
FT                   FTLRWRCVIVGLIGCLAWATKGWIEDLLVGMTMQVALVQFALSMLKGGMFTLFAALMVP
FT                   PVLERLKSHDLLYKESAK"
FT   gene            151331..152086
FT                   /locus_tag="Ssed_0135"
FT   CDS_pept        151331..152086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34748"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH5"
FT                   /protein_id="ABV34748.1"
FT                   /translation="MNNKQLKSWLICIDDTDDIGTKGTGEIAQEIAEILSGDEHESCSF
FT                   ITRHQLYVHPDIPYTSHNSAMCFYLETNKSLAMIEQLAIAHLLEESAPASDPGLAILAC
FT                   DSGFDREALIHFGLEAKGQVKTKQDAYDLAMRLGVSLSEHGGTGQGVIGALAGIGLRLY
FT                   GQDGRVKGQIDLGQELYEEGVELTVEEVLTRSGLDIVVDLSGQQLKSTEVIHLTKKVKA
FT                   VYCQHQFALLVYRHEGRWCNALKRQLKEY"
FT   gene            152092..152310
FT                   /locus_tag="Ssed_0136"
FT   CDS_pept        152092..152310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34749"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH6"
FT                   /protein_id="ABV34749.1"
FT                   /translation="MMQLKPWYQLEGKVFRFRFGTENSEASREAAQTCKQFSPDDEDEQ
FT                   IDDTLVSCYNCMNRRWLIDGVECIQFK"
FT   gene            152571..153749
FT                   /locus_tag="Ssed_0137"
FT   CDS_pept        152571..153749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0137"
FT                   /product="HD domain protein"
FT                   /note="KEGG: son:SO4711 HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34750"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH7"
FT                   /protein_id="ABV34750.1"
FT                   /translation="MADSVESKALVKFPVSKLTVGMFVTAIDRQGLVKISNAGQIRHRD
FT                   AIAKLVKNGIKHVWVDAERSAEHCGLKRAPSPKPVGKKPQQSREKSQKQAKKLIVEAKD
FT                   LVKKVLSETFEGKAIEVAPFGALADNMIESALLDADALKCVSALRTKDAYLLEHSINVA
FT                   FLLVTFGKYLKLEKDTLRQMAIGGMLHDIGKIKVDDKVLNKPGRLTPEEFEHIKLHQVF
FT                   AIDIMKETKGLSSISKDVCLMHHEKLDGNGYPKGLKGDELPLHGRMSCIVDIFDALTAT
FT                   RCYKEAMSPAAAFKVLLSLTPSHLDRALVYEFIRCVGVYPVGSLVELSDGRIGIVWQAS
FT                   NRDALHPILKCFYSIKHKRYTEVAMVDLLKSDLHIERGVSPSSLDVDPSPFY"
FT   gene            153896..154564
FT                   /locus_tag="Ssed_0138"
FT   CDS_pept        153896..154564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0138"
FT                   /product="paraquat-inducible protein A"
FT                   /note="KEGG: sbl:Sbal_0097 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34751"
FT                   /db_xref="GOA:A8FPH8"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH8"
FT                   /protein_id="ABV34751.1"
FT                   /translation="MHRVLPIIVIFISLALLVPGVTQPILSLSGTIDKSELTLAGVDHL
FT                   ANSFSDDSAGSGSARGMISMITGMLGLNEIEGEVEVFQKTRSILGTIEELFQSGNAPVS
FT                   ALVMLFSIVIPALKLSVMLFLQFSVPEKVERHLNRFIALISKWSMADVFVVALMVSFMA
FT                   GNASAGMGELLRTTAKFEVGFYYFTAYCIFSILSTYLVTRRRRANTTGVEREAVLTSPQ
FT                   "
FT   gene            complement(154595..157789)
FT                   /locus_tag="Ssed_0139"
FT   CDS_pept        complement(154595..157789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0139"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: neu:NE0049 sensory transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34752"
FT                   /db_xref="GOA:A8FPH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPH9"
FT                   /protein_id="ABV34752.1"
FT                   /translation="MPFRLLTQWLSLTSIGSKVILSMAGISLLVLMLSASNFIMNTRVK
FT                   EDTTEVSTHEIPKAIAAINMLDEIGDMNSNILEYVLGEVDERDDFDQNQITFLQYLATL
FT                   KSALKAHDRRIDEIEELFNDFHTSARANVFNRYNPNNEAWAKQRVDGLTNVTGHKLEVL
FT                   LDSLKESEIKDVGSQPDLNEVIHDDLPGVRYYLELVDEAGDMTANLTEYISGIYEAKNA
FT                   FIENAQDFEEYLTKLQPLEQKPEEIALLAEVEALYKVLRDGGFEVFQRYNSSNKLEAIT
FT                   AIDELEHQTFARLERLLDDVSIDAERNTNLELLGLRQMTISNQYVLIVSLFLVLSLCIS
FT                   IIYFSYRIITRPITKLSSTMKQLADGDTEVDVVYRDRQDEVGNMAQAVEVFKTNMIARN
FT                   AAEQELVMAKDNAEAASKAKASFLATMSHEIRTPMNGIIGMIDLLLTSSLNRDQRSMTN
FT                   TIRDSSFSLLNIINDILDFSKIEAGKLELESLNFSISELLESVIDTITPNADEKRVTLE
FT                   LYTDPNIPHHIQGDPVRIRQVLFNLVGNAVKFSAVQDSRGEVRITLKKKELSNQLVFLT
FT                   IEIQDNGIGIEAKQLERLFQPFTQAESSTTRQFGGTGLGLAICQNLVNLMGGKIDVSST
FT                   VGKGSIFKVNLSFPYIERPSPLTHDYPKVIVIDDIHSEPLSVRVKEYLSSREVNLVSMP
FT                   YMNTSDHLRDNVETWAQVVIATDQLEQSRQQVEQNLTDAERKNIRFLVLKPTSRGDGII
FT                   DDNTFSIAASPLKISTLFYGLHVALGRESPLDSSAHEADTLSHTPLSITDAEKAGRLIL
FT                   VAEDNQTNQEVIKRQLSKLGYSCIVADDGVHAEELYPTYKFAMVLTDCHMPRRDGYELT
FT                   RVLRSMQKKSGIKVPIIAITANALVGESEKCIAAGMDDYLSKPVELVKLNKMLKKWLSS
FT                   SFKNSNDADKEQTDTERRYLDQGVISLVFADDREDYIAALSDFMEIILPQMKSMVKERN
FT                   FNISAIGELAHKLKSSAKTIGLLSIGDHCETIEAIAKEPDNQQARVSITERLDSIEDLL
FT                   PQIEKEITDVISSACR"
FT   sig_peptide     complement(157682..157789)
FT                   /locus_tag="Ssed_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.569 at
FT                   residue 36"
FT   gene            158116..158796
FT                   /locus_tag="Ssed_0140"
FT   CDS_pept        158116..158796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0140"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: slo:Shew_3669 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34753"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI0"
FT                   /protein_id="ABV34753.1"
FT                   /translation="MKRRDFLAAGTLAMATAMVSPQLFAATEDKPLQILALVFDDYETL
FT                   DLHGPVEMLGHMKNVQIKLVGDKSIIRSYQGPKVVTDISMDSVTPCDLFIVPGGLGTRK
FT                   LVEDEELMAWLRKQVSVSGKVFSICTGSALLAKAGILDGVNATTNKMAYQWVTGLAGQV
FT                   NWQPSARWVDDGKFLTSSGVSAGTDAALFYVSQLRGEVEARRIERLTEYHWNHDAKNDP
FT                   YAVS"
FT   sig_peptide     158116..158193
FT                   /locus_tag="Ssed_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(159371..160315)
FT                   /locus_tag="Ssed_0141"
FT   CDS_pept        complement(159371..160315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3868 conserved hypothetical
FT                   protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34754"
FT                   /db_xref="GOA:A8FPI1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI1"
FT                   /protein_id="ABV34754.1"
FT                   /translation="MKLGTISFQTVKRHLPFFLIAVLCLLPVISSPIALVLGFTLASLG
FT                   LIPDEIDLGKSTKRLLSYSIIGLGFGIQLQTAISASMQNLPLILGSIIFTLLLGFILTK
FT                   ALKFDTKTGHLISAGTAICGGSAIAAVAPAINAKSEQSAIALATVFILNSVALFLFPAL
FT                   GHLFSMSQYDFGVWSAIAIHDTSSVVGAASAYGEEALTTATTIKLARALWIIPIALLSA
FT                   MAFGGDKKRITIPYFIGFYCLAIAIAHYFPQGQAVYEVLFELSKRVLVLCLFLIGAGIT
FT                   VRKMRAAGPKPLLLGVLLWLSIGTSSLLYILYL"
FT   sig_peptide     complement(160205..160315)
FT                   /locus_tag="Ssed_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.524 at
FT                   residue 37"
FT   gene            complement(160490..161845)
FT                   /locus_tag="Ssed_0142"
FT   CDS_pept        complement(160490..161845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0142"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="KEGG: slo:Shew_3660 glutathione-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34755"
FT                   /db_xref="GOA:A8FPI2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI2"
FT                   /protein_id="ABV34755.1"
FT                   /translation="MAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGTCVNV
FT                   GCVPKKVMWYGAQVAEALHLYAKDYGFDVTVNKFDWNTLVASRDAYIERIHGSYDRGLE
FT                   NNKVTLVRGYGRFVNERTIEVDGQEYTADHILIATGGSPSIPNIPGAEHGIDSDGFFEL
FT                   RAQPKRVAVIGAGYIAVELAGVLHSLGSETHLFVRKHAPLRSFDPMLSEALMESMATDG
FT                   PTLHTHSTPESVIKNSDGSLTLKLENGESFEVDTLIWAIGRKPSTGNIGLENTQVKLND
FT                   KGYVVVDEQQNTTNPGIYCVGDIIEGGVELTPVAVKAGRLLSERLFNGMTDAKMDYTLI
FT                   PTVVFSHPAIGTMGLSEPEAIAQYGTDQVKCYNSGFTSMYTAVTAHRQACKMKLVCAGP
FT                   DEKVVGIHGIGFGMDEILQGFGVAMKMGATKKQFDSVVAIHPTGAEEFVTMR"
FT   gene            complement(162024..162545)
FT                   /locus_tag="Ssed_0143"
FT   CDS_pept        complement(162024..162545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34756"
FT                   /db_xref="GOA:A8FPI3"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI3"
FT                   /protein_id="ABV34756.1"
FT                   /translation="MSLLTQYTWFIKLATVASFSIIISVSTVSYSRADTKEPLPLGVVL
FT                   DSEGNPISLPSRNQSALEFHSPTITKPHHNPGVNPVPNKRTSKKKARSKKLSRKQQLTS
FT                   RAQIANDPSCRWLNSRMNKLEESLTSVGNRSANSYHKKELAVRNKEWKCMKCGAEGPEQ
FT                   KDYDRCQYRR"
FT   sig_peptide     complement(162444..162545)
FT                   /locus_tag="Ssed_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.830 at
FT                   residue 34"
FT   gene            complement(162665..163441)
FT                   /locus_tag="Ssed_0144"
FT   CDS_pept        complement(162665..163441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34757"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI4"
FT                   /protein_id="ABV34757.1"
FT                   /translation="MNNKFKFSLLTSLLITASTVYADTSANIDDSHSRNILPANEAVDT
FT                   NYLLDLGWDSKYVSEGRNNLDKGGIFWGTAAVQHGNLNVYATLGRADDQDYTEWNFGLE
FT                   YAIALSDTLEATVGYQRLEFYGDERANDNEFFSSLTYSGIKWLTPSIAYTYATEAGGYF
FT                   VEASLHSSWELLENFTVTPYVTQAFDFQYATEDHDGPNHFQFGLEAEYLVNDQIVLSGH
FT                   VSHTIAQEDIKAEAKADGIEGSLDQTYAGVHLTWNF"
FT   sig_peptide     complement(163373..163441)
FT                   /locus_tag="Ssed_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            163745..165784
FT                   /locus_tag="Ssed_0145"
FT   CDS_pept        163745..165784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0145"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="KEGG: slo:Shew_3657 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34758"
FT                   /db_xref="GOA:A8FPI5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI5"
FT                   /protein_id="ABV34758.1"
FT                   /translation="MSNPLLTSAVLPPFSKIKPEHIQDAVEQGIANCRSQIEKVLAQPQ
FT                   PFTWNNLIAPLEEVDDELSKIWSPISHMNSVVSSEEWRQAHDACLPLLSEYGTFVGQHQ
FT                   PLYQAYKSIKASDEFEQLTQAQKMVIEHSLRDFELSGIGLNDADKLRYGELVKRMSELT
FT                   SGFSNQLLDATQAWTKLITDEDELAGLPESAIAAAKAMAAAKEQEGWLFTLDFPSYLPV
FT                   MTYSENRNLREECYRAFVTRASDQGPFAGKYDNGPLMDEIVALRHELALLLGFDSYAHK
FT                   SLATKMAQTPQQVLEFLNELASRSKDQGKTELAELTEFAGKEFGATDLSPWDLSFYAEK
FT                   LKHHRYEISQELLRPYFPEDKVLSGLFYTVNRLFGLKITEQKEFDSWHKDVRFFSIEDS
FT                   EGEHRGSFYFDLYAREGKRGGAWMDDCRVRRQTISGMQNPVAYLTCNFNAPVDGKPALF
FT                   THDEVTTLFHEFGHGIHHMLTKIDVAGVSGINGVPWDAVELPSQFMENWCFEEEALAEI
FT                   SGHFETGEPLPKVMLDKMLAAKNFQSGMGMLRQLEFSLFDFRMHLEYSPEKGANIQAKL
FT                   DEVRSQVAVITAADFNRFQHSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGIFNS
FT                   ETGLSFLNNILEMGGSEEPMELFKRFRGREPRIDALLRHSGING"
FT   gene            complement(165926..166345)
FT                   /locus_tag="Ssed_0146"
FT   CDS_pept        complement(165926..166345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34759"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI6"
FT                   /protein_id="ABV34759.1"
FT                   /translation="MKSIFSIFVLFISLSTLTACATSRPTSITVDDSDRLVEIKVSGNF
FT                   LEDELRFKSAKYDIRIQNLGDNLFHIDAKVISKRIDHLTGDELIASNQIVTQVKAEPEE
FT                   KVTIGGLDSWSESIQEDGSVIETRAEKRYVLQIMN"
FT   sig_peptide     complement(166280..166345)
FT                   /locus_tag="Ssed_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.908 at
FT                   residue 22"
FT   gene            166663..167193
FT                   /locus_tag="Ssed_0147"
FT   CDS_pept        166663..167193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34760"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI7"
FT                   /protein_id="ABV34760.1"
FT                   /translation="MNLYFRLFWLFIWRVRHCNSIDFLGTSRISYRALPLDCDINCHVT
FT                   NSRYPALMDLARTYMLAEMGLLKRFIKLKWLPIVNAAEFTYIRDIKPLTKFEIESKLVG
FT                   WDDKYFYIEQRFVSDNILHCIVHVRGVFVCKGKQVPIDTMVKEVNFEGPRPELPPEVVK
FT                   WKAFLQLKKERNI"
FT   gene            complement(167248..167898)
FT                   /locus_tag="Ssed_0148"
FT   CDS_pept        complement(167248..167898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0148"
FT                   /product="glutathione S-transferase, N-terminal domain"
FT                   /note="KEGG: slo:Shew_0027 glutathione S-transferase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34761"
FT                   /db_xref="GOA:A8FPI8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI8"
FT                   /protein_id="ABV34761.1"
FT                   /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRVIELSDPLSRREFCDF
FT                   YPPGKLPLLKSKSGELIPESSIIIEFIDSEFSTGTRLFPIDRRIALDTRLQDRLIDNDF
FT                   SNVLFELEHQKLEDGDQNHIMIKQLENDISQFLGYLDKKLEKNHWLCSDGLTLADCALF
FT                   PCLHCAQDYFKLFQYDNLNRYWHQAQLRGSYLQVKEEVELAAGDVLSGRRPIP"
FT   gene            complement(168072..168977)
FT                   /locus_tag="Ssed_0149"
FT   CDS_pept        complement(168072..168977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0149"
FT                   /product="transcriptional regulator, LyrR family"
FT                   /note="KEGG: saz:Sama_3549 transcriptional regulator, LyrR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34762"
FT                   /db_xref="GOA:A8FPI9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPI9"
FT                   /protein_id="ABV34762.1"
FT                   /translation="MLMDAAQLYRMLVFANVVEQGSLTAAANELGISRSMVSQHLKKLE
FT                   LRCATQLIHRTTRKMALTEDGQSFYHYCAELLQLAKQAENSTKPQDRELQGSIKISAPV
FT                   CLGEQNLIQHIGDFNKRYPKIRITLRLEDRRLNLLENNIDIAIQTEQATEFTSIRLGQF
FT                   DEYLIASPEYVEQHGSPLHPDMLAKHQWIMQSSNYLPKSCLLQNSFGDKFKIKINPFIS
FT                   CNSNHGIVKLAKQGLGIAILPSYLVQAQIESGKFVHILPDYHLREGVIYAVHPFDDVTP
FT                   PRVRAFLNFIEKRLIPDNQR"
FT   gene            169192..169881
FT                   /locus_tag="Ssed_0150"
FT   CDS_pept        169192..169881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0150"
FT                   /product="conserved hypothetical 3-methyladenine DNA
FT                   glycosylase"
FT                   /note="KEGG: sbl:Sbal_0127 conserved hypothetical
FT                   3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34763"
FT                   /db_xref="GOA:A8FPJ0"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ0"
FT                   /protein_id="ABV34763.1"
FT                   /translation="MSQLESFSSIYQRASDRKGGSSELESLLSVSLSADEIGQYRDAEL
FT                   LSEMSKKVFQSGFVWRIVENKWPAYEAAFFNFEAHKILMLSPEQLHQRATDPNLIRHMK
FT                   KTMAIYDNAMMTHDIAKERGSLAEYIANWPSEEITGLWSVLKRRGTRLGGNTGPYFLRA
FT                   IGKDTFLLTGDVQGYLKAHNLVDFGFSSKSGLNQVQAVFNQWQQESGRSLADISRILAC
FT                   SVGDNRI"
FT   gene            complement(170152..170910)
FT                   /locus_tag="Ssed_0151"
FT   CDS_pept        complement(170152..170910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34764"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ1"
FT                   /protein_id="ABV34764.1"
FT                   /translation="MRTMTIQMKLQHKILLGGLLLSAASFAQAENEGEVLGGTISGNLT
FT                   FASDYVFRGESETMDGDVPVVQGTLGWGNDDGWYGGVFASNIKFADPNLEIVTAPYIGK
FT                   AGEFGDSGITYDVMVFSYLYPGASYSNYTELWMKVGKQFGQANIQLEVTPTIDDWFGVD
FT                   GWQGVNYSIHPSYAFKNGLKVSGSVGYQDLDGDNAEGWGHWNLGVSKAFYGLNFDLRYH
FT                   GSTVDETHKVYGTQTEIFDDRVVIGINKSF"
FT   sig_peptide     complement(170821..170910)
FT                   /locus_tag="Ssed_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 30"
FT   gene            171346..172503
FT                   /locus_tag="Ssed_0152"
FT   CDS_pept        171346..172503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0152"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: slo:Shew_0031 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34765"
FT                   /db_xref="GOA:A8FPJ2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ2"
FT                   /protein_id="ABV34765.1"
FT                   /translation="MRQIVKIASVLSVALWITACGQKPEQGPQERGPMEVGVIKVEAQP
FT                   QSILVELPGRSKAYLEAEVRPQVSGIIMTRGFVEGRDVEKGQSLYQIDSSTYTAALISA
FT                   KADLQSAKANLVSAKAKALRFEKLVKLNSISEQDYDEADAAYKAALARVTVAEAAINTA
FT                   KINLEYTEVRAPIAGRVGKSSVTAGALVTANQTQTLATIQQLDPINIEIAQSSAQMLRL
FT                   KSKLKQGQLKAADNAGVQLILEDGTTYKHDGVLQFAEVSVNEDTGSVILRAEFPNPDGV
FT                   LMPGMYVRAVLNTGTDPEAILVPQRAITRNTKGEAVAMIIDAEGKVAARVVTTAEVIDH
FT                   QWRITDGLTVGDQLIVEGLQKIRPGAAVKAGPLVADKKSQAQQQK"
FT   sig_peptide     171346..171411
FT                   /locus_tag="Ssed_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.440 at
FT                   residue 22"
FT   gene            172513..175665
FT                   /locus_tag="Ssed_0153"
FT   CDS_pept        172513..175665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0153"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="KEGG: slo:Shew_0032 transporter,
FT                   hydrophobe/amphiphile efflux-1 (HAE1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34766"
FT                   /db_xref="GOA:A8FPJ3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ3"
FT                   /protein_id="ABV34766.1"
FT                   /translation="MARFFIDRPIFAWVIAIIVMLAGVLSILGLPVSQYPSIAPPSVEI
FT                   RAVYPGASAKTMEDSVTQVIEQRMTGIDHLRYISSTSDSFGNATITLTFNAEADPDIAQ
FT                   VQVQNKLQLAMPLLPQEVQAQGVNVAKSSAGFLMVVGFVSQDGSLDKNDIADYVGSNVQ
FT                   DPMSRVPGVGTIQLFGAQYAMRIWLDPLKLTQYNLTSQDIIASIREQNAQVSAGQLGGA
FT                   PSVSGQQLNATVSAQSRLQTAEQFKKIIIKADSTGAKVFLEDVARVELGAENYDVESYY
FT                   NGKPAAGIGIQLATGANALATAEGVRAKIAELQPFFPQGLEVVYPYDTTPFVEKSIEGV
FT                   VHTLLEAVVLVFLIMYLFLQNFRATLIPTIAVPVVLLGTFAILSAAGFSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPIEATKKSMDQITGALVGIGLTLSAVFVPMAF
FT                   MSGSTGVIYRQFSITIVSAMALSVMVAIILTPALCATMLKPIAKGHHAVDTGFFGWFNR
FT                   KFDALTSRYEASVAAMIKRAGRTMMVYLAITVAVGWIFMRMPTAFLPDEDQGILFTQAI
FT                   LPVNSTQEETKKVLSDVSDFYLEQEGDNVKSVFSVSGFSFAGNGQNMGIAFVGLKDWSE
FT                   RTDPGQDVQSVAGRAMGMFMQMKEAFVFAFVPPAVIELGTANGFDFYLQDRNGQGHDKL
FT                   VEARNMLLGMAAQNPNLVGVRPNGQEDAPMYQIHIDHGKLRALSVDIDAVNSVLGTAWG
FT                   GNYVNDFIDRGRVKKVYVQGEADYRMQPEDIDSWYVRNTKGDMVPFSAFATGSWEYGSP
FT                   RLERFNGLPAMNIQGGVAPGFSTGEAMNIIEDMVKQLPPGFGVEWNGLSYEERLSGNQA
FT                   PMLYALSIVVVFLVLAALYESWSVPFSVILVVPLGIIGALIAMNGRGLPNDVFFQVGLL
FT                   TTVGLATKNAILIVEFAKEYYEKGAGLVEATLHAVRVRLRPILMTSLAFGLGVVPLAIS
FT                   SGVGSGSQNAIGTAVLGGMMSSTFMGIFFIPIFFVIVERIFSKREKKGAKLETKAETPA
FT                   AE"
FT   gene            complement(175802..176479)
FT                   /locus_tag="Ssed_0154"
FT   CDS_pept        complement(175802..176479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0154"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="KEGG: sfr:Sfri_2500 glutathione S-transferase,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34767"
FT                   /db_xref="GOA:A8FPJ4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ4"
FT                   /protein_id="ABV34767.1"
FT                   /translation="MNKPSALPVLYSLRNCPYAIRARMAIYVSGQAVQLRDIVLSDKPA
FT                   HMLQVSPKGTVPVLVLQNDKVLEQSLEIMMWAFGQSDPNNYLMSDSPNTRAEMLSLVDL
FT                   FDTEFKLRLEKYRSAKRYHDESVLEHRLACEQYLKMLELKLSQHTYLMSDSPSLADLAI
FT                   LPFIRQLARVERQWYLQSPYPNIRKWLNDYLQSRMFSKVMSKYPMWLTEKSLIVFSADK
FT                   PLS"
FT   gene            176652..177554
FT                   /locus_tag="Ssed_0155"
FT   CDS_pept        176652..177554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0155"
FT                   /product="MscS mechanosensitive ion channel"
FT                   /note="KEGG: sfr:Sfri_2100 MscS mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34768"
FT                   /db_xref="GOA:A8FPJ5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ5"
FT                   /protein_id="ABV34768.1"
FT                   /translation="MVVYSFLLHHFFSVKEDFVDKLNIAVDFLLTHKLLLTVLVIVFIS
FT                   LVKRFIISKIRGDIPFLTEVQRKWMSRTKNGTFILIMVILFMLWQTEINKFALSVTAIA
FT                   IAIVVASKEIILCFTGSIQRASSRSFVIGDWIEVGQLCGEVIEHNLMATVIQEIDLHHG
FT                   QYHYTGKTATLPNSMFFTYAVKNLNFMKRYVYHNFHITIVEFVNLYPLFPELREQIEAH
FT                   CEDFHEVATRYNSVIEKHAGVDLPGSEPHIHINSGPNGEQNIHIMIFCPTERAAHLEQL
FT                   IREDFMIAYHEAFGKEALQ"
FT   gene            complement(177647..179263)
FT                   /locus_tag="Ssed_0156"
FT   CDS_pept        complement(177647..179263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0156"
FT                   /product="AbgT putative transporter"
FT                   /note="KEGG: slo:Shew_3654 AbgT putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34769"
FT                   /db_xref="GOA:A8FPJ6"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ6"
FT                   /protein_id="ABV34769.1"
FT                   /translation="MGLNKEEGIELPLNSPGASGPQSGAFVRFLNIVERLGNLLPHPIS
FT                   LFAMFCLAVIAISGIAGYFELTVVDPRPIGSSGRSEDGLIHVVSLMNGEGLRMIVSNLV
FT                   TNFTGFTPLGTVLVALLGVGIAERSGLLSAAMRLLVIGASKRLVTLTIVFAGIVSNTAS
FT                   ELGYVVLVPMAAMIFHSLGRHPLAGLAAAFAGVSGGYSANLLLGTVDPLLSGITEAAAQ
FT                   MIDPEYMVGPEVNWYFMFVSTFLITILGAIVTEKIVEPKLGKYDPDEAAVDLASQKMDG
FT                   VSSDEKRGLKAAGIAVLILSSLVALTVVPENGPLRDPETGLVAGSPFLKGIVAFIFICF
FT                   AIPGLVYGKVVGTMKKDKDVIDAMSHSMSSMGMYIVLVFFASQFVAFFKWTNLGAVLAV
FT                   SGADALSAIGLTGPLVFVLFIMLCGFINLMLGSASAQWAVTAPIFVPMLMLVGYAPETI
FT                   QAAYRIGDSVTNLITPMMSYFGLILAVASQYKKNLGIGTLIATMLPYSIVFFIGWTCFF
FT                   FIWVFVLGLPVGPGAETYYTP"
FT   gene            180321..180890
FT                   /locus_tag="Ssed_0157"
FT   CDS_pept        180321..180890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0157"
FT                   /product="LemA family protein"
FT                   /note="KEGG: slo:Shew_3652 LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34770"
FT                   /db_xref="GOA:A8FPJ7"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ7"
FT                   /protein_id="ABV34770.1"
FT                   /translation="MEGLLLGLGLLVIIAYLWYVSLVKKRNSVREALSGIDVQLKKRSN
FT                   LVPNILKIAQKFMDHEKSLLTEITELRAQVEKSYDIGDASAVKEHLVKAELLNGKMGQL
FT                   MVSVENYPELKSDNTMLQAMQTYNEVEAHISAARRFYNASVTELNNAVEIFPGSIIASM
FT                   ANIKVMPFYEADEASKAPVDASDYLN"
FT   gene            180949..181959
FT                   /locus_tag="Ssed_0158"
FT   CDS_pept        180949..181959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34771"
FT                   /db_xref="GOA:A8FPJ8"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ8"
FT                   /protein_id="ABV34771.1"
FT                   /translation="MNIISFLFGARIKPKRQAKPLSAVGDELESLQAHYDEHIEPLTRK
FT                   FENRRVACLKALRLRIYMSIGIFAAVLFICLLFDSTQRIVIPWPFYLLPLVPLCWWCSR
FT                   PVTHYQSDVKLQVFPKIFRYFGDDFIFSPTHSMSMSTLKRSKLLPGYDKAHFDDYVQGT
FT                   HRGIEIAINELALTKEVRRDKRNETKTVFNGVMVQLGCHKKFNGHTVVVRNRGSLMNFL
FT                   SDSFKRLSRVKLEDPRFEKLFDVFSSDQIEARYLLTVSFMERLQELADCFSGQFQCAFY
FT                   EDKLLIMLASRENRFELGSIFHGATFEYEFSQINREMRQLFAMIEVLKLDEYTGL"
FT   gene            181968..182705
FT                   /locus_tag="Ssed_0159"
FT   CDS_pept        181968..182705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0159"
FT                   /product="lytic transglycosylase, catalytic"
FT                   /note="KEGG: slo:Shew_3650 lytic transglycosylase,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34772"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPJ9"
FT                   /protein_id="ABV34772.1"
FT                   /translation="MHAICCGGIVSSLLWLAGVTHSYAQVTIERDAKPHYKASYSKEGI
FT                   LGKSSTAHPASFSPSKEAENQLKVYQYRQENGVMAFSDHAPGSAQYQVLLYDCYACQPD
FT                   SSLDWKKIPLFYRDYDELINQAANTHNLDPALIRAVIHAESAFKVFALSRSGAMGLMQL
FT                   MPETAKELGVKNAFKPEQNIDGGAKYLAQMLRRFDGDIDLACAAYNAGPMNVTHYKGIP
FT                   PYPETQAYVKRVKILLERYRKPG"
FT   sig_peptide     181968..182042
FT                   /locus_tag="Ssed_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.717 at
FT                   residue 25"
FT   gene            complement(182868..184274)
FT                   /locus_tag="Ssed_0160"
FT   CDS_pept        complement(182868..184274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0160"
FT                   /product="putative Na+-driven multidrug efflux pump"
FT                   /note="KEGG: ppr:PBPRB1940 putative Na+-driven multidrug
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34773"
FT                   /db_xref="GOA:A8FPK0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK0"
FT                   /protein_id="ABV34773.1"
FT                   /translation="MQANIQDITSDRSIQRTFWRYAIPSIAAMLVSGLYQIIDGMFIGH
FT                   YLGYQGLAGINVAWPIIYVIAGVGLMIGMGAGSLISGSRGRSSTSQRGPIEAGNADKGV
FT                   ATILYTAMGLSIGFGAIFSYLLFLNGTDLLLAQGAEDQALVLAQQYISPFVWTAVITIL
FT                   ASALPMLVRNDESPNIATALMVTGACMNIVLDYLLIVQFDMGLKGAALATVSAQLSVCV
FT                   GGFAYFLSTKTQLKLSEYRPSFHTKLAGKILLLGSSSFVMYIYTSFVFALHNRLFMEYG
FT                   TSLTVAAFTIVGYLMVLYYFIAEGIGEGMQPPVSFFLGAAQPHNIKKMVLLAATVSLTI
FT                   GISWTAILNLFPETMIGLFNSDDPELIRETITGIHLHLFGMFLDGLVVLAIMYFMAVDQ
FT                   GGKSLAISLGNMLIQLPFLYILPKWLGIYGVWIAMPLSNVVMFIIVAPMVWRHMNAATS
FT                   HKQIASLATA"
FT   gene            184437..185330
FT                   /locus_tag="Ssed_0161"
FT   CDS_pept        184437..185330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0161"
FT                   /product="conserved hypothetical transcriptional regulator"
FT                   /note="KEGG: ppr:PBPRB1939 hypothetical transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34774"
FT                   /db_xref="GOA:A8FPK1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK1"
FT                   /protein_id="ABV34774.1"
FT                   /translation="MNWTLAQLEAFVLSVKCGSFSAAARKLGRAQSRVSTAISNLEADL
FT                   GFELFDRTAKLPVLTQHGEDMFVEAQAVLEQCQRLQSRALTVTTGEEIALTIAMDEAVP
FT                   INTFESLIERVAQRFPLLKLTIINGSQDDIAQWVDEGKADMGILFYVKSFSDSLEFMSI
FT                   GQFYHSLIVSPKHPLSKIESPTIDELNQYRQLVIRDRVGKNQAKALSANHWYIDSYYYI
FT                   TALVIRGLGWALVPDHLANSEWYTDEVIELSTENIPDPLLVEMGVVNRRDRAYGPVMEW
FT                   IFLEIESMFKNRLKNE"
FT   gene            185416..185787
FT                   /locus_tag="Ssed_0162"
FT   CDS_pept        185416..185787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34775"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK2"
FT                   /protein_id="ABV34775.1"
FT                   /translation="MHTSLKKKLVELELYLLKADVRVSVQDLDQLIHDDFLEFGGSGIS
FT                   FGKKEVLKQLPREKCPEFSATAFELRHLSCDVAQLVYRATMKKPGEFITRYSLRSSLWR
FT                   KSQGRWQMIFHQGTPCEPF"
FT   gene            complement(185896..186738)
FT                   /locus_tag="Ssed_0163"
FT   CDS_pept        complement(185896..186738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0163"
FT                   /product="protein of unknown function DUF519"
FT                   /note="KEGG: slo:Shew_3648 protein of unknown function
FT                   DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34776"
FT                   /db_xref="GOA:A8FPK3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK3"
FT                   /protein_id="ABV34776.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHSVLLQVLKLMHKKPTPFVYIDTHAGA
FT                   GGYALSDEFAQKTGEYLEGVAKLWGKEDLPEPLAEYIADVTHFNQGKPELSFYPGSPAF
FT                   VDMNSYEKERMVLHELHGADHAQLEEQFAGDRYIRIVKDDGLKGLIAAVPPRERRGVIL
FT                   VDPSYEMKTDYQDVPNAIIKAHKKFATGVYMLWYPVVNRAQTEGMLKILAQSGIKNQLR
FT                   IEQSVRADSDEFGMTAAGLWIINPPWQLDSKADEILEYLSPLLNQGGGKVTMKLEVGE"
FT   gene            186935..187711
FT                   /locus_tag="Ssed_0164"
FT   CDS_pept        186935..187711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0164"
FT                   /product="protein of unknown function DUF548"
FT                   /note="KEGG: slo:Shew_3647 protein of unknown function
FT                   DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34777"
FT                   /db_xref="GOA:A8FPK4"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPK4"
FT                   /protein_id="ABV34777.1"
FT                   /translation="MTELKQSIQPIGIFFNAQYPSLEAICQRWGLVFDKEAAFELVFEN
FT                   NCLVLNKRDEPKLKGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQGVNPSVVDGTAG
FT                   LGRDAFVLASLGCNVTMVERNPVVAALLEDGLRRAYESEEIGDWMRERMRLVHGSSLES
FT                   VAELGEEIDVVYLDPMYPHREKSALVKKEMRVFQSLVGADLDADGLLAPATALATKRVV
FT                   VKRPDYAEDLDGVKPSMVISTKKNRFDVYVKAAMKA"
FT   gene            complement(187715..188101)
FT                   /locus_tag="Ssed_0165"
FT   CDS_pept        complement(187715..188101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34778"
FT                   /db_xref="GOA:A8FPK5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK5"
FT                   /protein_id="ABV34778.1"
FT                   /translation="MNRLVVSLALVFFAFILWVIYLANTGSTSVFFELVGVLPYGDKLG
FT                   HFCLFGMLTFLFNLASRCKSFPIGRFRLYYGTAVVTIFVLAEEISQGFIPSRTFDLMDL
FT                   TADALGILSFTYVTYLSSKTPMKA"
FT   sig_peptide     complement(188030..188101)
FT                   /locus_tag="Ssed_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.827) with cleavage site probability 0.625 at
FT                   residue 24"
FT   gene            complement(188256..189107)
FT                   /locus_tag="Ssed_0166"
FT   CDS_pept        complement(188256..189107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34779"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK6"
FT                   /protein_id="ABV34779.1"
FT                   /translation="MNKLTLGATIAVLGLSLNVNAEETSSPLAMSIISGMEAYEDSPGS
FT                   SLSKGAGISLIWDDLRYDKTYKLDTNYFRARGTYYYEKDSEKYDEDRYRDSMDLKLHYQ
FT                   RPFMSINNDDDYTLSVIGHYEGHYNSQQLEEFEQLAVGGLALNRRFGDTHHYDLGVTLG
FT                   LAFSEEEKDDDWPRESQGITEEELNRRGFGYYFELKNKYTFSHTGVQLSLNYSRYDGLW
FT                   KYEDNKSYTFNKVNFGVVIPLANKNNLLHFATEYIDRTSEQDLIGFDDVLYRVHAEYVH
FT                   YF"
FT   sig_peptide     complement(189042..189107)
FT                   /locus_tag="Ssed_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(189301..190611)
FT                   /locus_tag="Ssed_0167"
FT   CDS_pept        complement(189301..190611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0167"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: slo:Shew_3638 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34780"
FT                   /db_xref="GOA:A8FPK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK7"
FT                   /protein_id="ABV34780.1"
FT                   /translation="MKWLKKFLPRSAFSQTVMLIGCLLLINQLVSYLSVATYFIQPTYQ
FT                   QINQLIARQVKLLFVDGVDIGREHLTMVDALNAKVRDDGMEIYNQKQAREAGIDQAVYY
FT                   GFLSSQMSEHLGGKAEVKIAQGDDFEIWIRPPQAPSIWIKVPLTGFNESDLSPLTLYLM
FT                   VIGALSVAGGWWFARQQNRPLKKLQKAAISVSMGDYPEPLPLTGSTEIVEVTNAFNQMS
FT                   HSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVEEDEYLKDGIVHDIEDMDAIINQ
FT                   FISYIRQDQESTREQGQLNDLIEDVVQAESNREAKIEVELNECPEIPMQSIAIKRILSN
FT                   LVENAFRYGRGWVKLSSHFDGKRVGFSVEDDGPGIPEDQIPKLFQPFTQGDTARGSVGS
FT                   GLGLAIIKRITDRHQGEVVLTNRAEGGLRAQVWLPME"
FT   sig_peptide     complement(190516..190611)
FT                   /locus_tag="Ssed_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.335 at
FT                   residue 32"
FT   gene            complement(190672..191397)
FT                   /locus_tag="Ssed_0168"
FT   CDS_pept        complement(190672..191397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0168"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: slo:Shew_3637 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34781"
FT                   /db_xref="GOA:A8FPK8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK8"
FT                   /protein_id="ABV34781.1"
FT                   /translation="MGQETSKILVVDDDMRLRALLERYLMEQGYQVRSAANSEQMDRLL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQTGNPIPIVMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVMRRQSQDVPGAPTQQEEEITFGEFALNLATREMYHGEEAISLT
FT                   SGEFAVLKVLVSHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRLIEKDPANPRY
FT                   IQTVWGLGYVFVPDGAARR"
FT   gene            complement(191748..191966)
FT                   /locus_tag="Ssed_0169"
FT   CDS_pept        complement(191748..191966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1885 protein of unknown function
FT                   UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34782"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPK9"
FT                   /protein_id="ABV34782.1"
FT                   /translation="MIEFTPIGLSIVEIERVEANRIFVRGIDLLDGTPILDIKPYIQSF
FT                   DNIKDTKDGSYERGFDPLTVRSDKRFA"
FT   gene            192343..192834
FT                   /locus_tag="Ssed_0170"
FT   CDS_pept        192343..192834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0170"
FT                   /product="transcription elongation factor GreB"
FT                   /note="KEGG: slo:Shew_3636 transcription elongation factor
FT                   GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34783"
FT                   /db_xref="GOA:A8FPL0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL0"
FT                   /protein_id="ABV34783.1"
FT                   /translation="MKAMLITRKGWQALDKELKYLWKEYRPEITKKVQEAAAQGDRSEN
FT                   ADYTYNKRLLRQIDSRVRYLVKRVEELQIVDYSPQQEGKVFFGAWIELENEAGEIVQYR
FT                   IVGKDELDTKLGYITIDSPMARALIGKQVDDEVVVPTPLGPKEWYINKIQYKSFEDPQN
FT                   "
FT   gene            193063..194862
FT                   /locus_tag="Ssed_0171"
FT   CDS_pept        193063..194862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0171"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="KEGG: slo:Shew_3635 thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34784"
FT                   /db_xref="GOA:A8FPL1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL1"
FT                   /protein_id="ABV34784.1"
FT                   /translation="MSPSIKDNFGSEYYNSLPLFGDCLGELLAFFGVKRAYGVGGDFVA
FT                   NLINSLEGHIEVLPSSNEMHAGFSACAQAELNPLGMCLTTYTVGSLPCVTAAALARTEG
FT                   LPVVFISGAPGEAEVNSHALHHSVHPHTAWHTDLDAALNSFRALGVRAERLQGQRHSGQ
FT                   PNIAAEQCLELLTYAYLNRQPVFIEIPRDLINQPTQSLSLPLSLEQISQNQPLSLSGAE
FT                   LIAQDIESKLKLANKPLVFLGEKLRLNRPLLSKIISLCHQHSLPYATSWFGKGMLDESE
FT                   PLCLGSYNGAFSELEGKHYIESQADYILELGTAIFPSDTNNAFSSQTHAIDTHSHKTML
FT                   RGTARWEKDIEAVIDLLVQKLPLNEGAESTLDPDEKVTPPLESVMLGYHNLAETINQAQ
FT                   RQLAKPYIFVPEVGSSLFASFELETHGSDIGRSYLANPWYAAMGTCLPYARAIADQLAE
FT                   SNSLQPVLVMIGDGGFNFQANELINLQKQGANVTILYMRNNIFHLGKAGDAPIYSCNDQ
FT                   GFNPRLLIQAYGGDGHLCETTEQLTHCLIETAHKGGVHLIEVPTSVEAGHQSETTKKLN
FT                   TYIGFRNGDPQATERWNELCGHF"
FT   gene            195071..195442
FT                   /locus_tag="Ssed_0172"
FT   CDS_pept        195071..195442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL2"
FT                   /protein_id="ABV34785.1"
FT                   /translation="MDKTQYFYRTAIFTRKDNQVSLVDIEKPDDTTPMEDWMAIVVSLA
FT                   DGRHTVNELIAYMGSQYRSAPQELEDTLHSVLERLQEGKIVQLSEQAVELPYYLAEPIE
FT                   SLDIEKAKKLIKEDGYIHH"
FT   gene            195536..197950
FT                   /locus_tag="Ssed_0173"
FT   CDS_pept        195536..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0173"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="KEGG: slo:Shew_3634 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34786"
FT                   /db_xref="GOA:A8FPL3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL3"
FT                   /protein_id="ABV34786.1"
FT                   /translation="MLSLAPLKSFYPGTTQLLMQMTQNIAQIIAQELNVREQQVTSTIT
FT                   LLDDGATVPFVARYRKEATGGLDDTQLRTLNSRLSYLRDLNDRRAVILSSIDTQGKLTP
FT                   ELKKALVDADSKTRLEDLYLPYKPKRRTKGQIAIEAGIEPLADYLFGNRQADIELEAGK
FT                   FINAEAGFADSKSVLDGARFIIMERFAEDAALLQKVRQHLSQNSVLESKMVKGKEKEGA
FT                   KFRDYFEHTEKLSKIPSHRALAMLRGRNEGMLSLSMNADPDNESKQSSYCAVIIADHFK
FT                   LNLTDSAVDQWLKTVVTATWRIKIALQMETEFLAKMREQAESEAINVFAKNLGDLLMAA
FT                   PAGAKATLGLDPGLRSGVKVAIVNNTGKLTAHTTIFPHAPQNQWDKSVRTLANLAKMHK
FT                   VELIAVGNGTASRETDKLAGELIASVKAELPGLTKIMVSEAGASVYSASELAANEFPDL
FT                   DVSIRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQSQLSQSLEGVVEDCVNGVG
FT                   VDLNMASAPLLSQVAGLNKTLARNIVTYRDENGQFKQRKQLLKVARLGPKAYEQAAGFL
FT                   RIVDGDNPLDASSVHPEAYSLVESIAKAKDQALDTLMGNSELLRSLKAEDFITEKFGLP
FT                   TVTDILTELDKPGRDPRGEFKTATFKEGVEEVKDLKLDMILEGVVTNVTNFGAFVDVGV
FT                   HQDGLVHISSLTDKFVSDPHTVVKAGDVVKVKVMQVDVERKRIGLSMRLDEKAADMPAG
FT                   RSNQKSQTGSKPAAKSNQQGKGKPQHRSQPKQQANAAMGNAFADAFAKLKK"
FT   gene            198309..200321
FT                   /locus_tag="Ssed_0174"
FT   CDS_pept        198309..200321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0174"
FT                   /product="sulfatase"
FT                   /note="KEGG: slo:Shew_3632 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34787"
FT                   /db_xref="GOA:A8FPL4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL4"
FT                   /protein_id="ABV34787.1"
FT                   /translation="MASRFSILGPFRSILCFCLIALLIVTLSRIGLGFWQFDRVVAVGG
FT                   WSHLIIQGLRVDLATLCWLWGIAALGTAIFSGDHALGRTWNSLLRVWLTLGLWLMLFLE
FT                   ASTPSFIQEYGIRPNRLYIEYLIYPKEVLSMLWAGRKIELIFAALLSLTTLWGGWKLSG
FT                   SLLKNIRYPRWFFRPFIALLVIAVTLMGARSSLGHRPLNPAMVAFADDPLVNSLVTNSS
FT                   YSLFFAISQMKSEASAAKMYGSMDEEQVIDTVRRESGRELAAFTSEAIPSLSFNPASYQ
FT                   GKPKNLVIILQESLGARFVGNLGGLPLTPNIDELSKEGWAFENLYATGTRSVRGIEAVT
FT                   TGFTPTPARSVVKLGKSQHGFFSIAALLKQHGYETQFVYGGESHFDNMKSFFLGNGFSN
FT                   IVDENDYKNPAFTGSWGVSDEDLMRRANSEFEQFHKQGKPFFSLVFSSSNHDPFEFPDD
FT                   RIELYEQPKQTRNNAAKYADHAVGEFFKLAKQSDYWKDTLFLIVADHDSRVGGSSLVPI
FT                   SRFRIPGIIVGDGVEAKRDQRVVSQIDLAPTLLSMMGISDSYPMLGQDLTRVSDDWPGR
FT                   ALMQYDKNMAYLRGDDVVVLQPEREPSGFKYDFLAETLVAKPQSEEMKQVALAWALWGS
FT                   LAYQKGLYRPQDEVVQRDGLVSAEATLKSAEVTLK"
FT   sig_peptide     198309..198410
FT                   /locus_tag="Ssed_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.708) with cleavage site probability 0.454 at
FT                   residue 34"
FT   gene            complement(200314..200817)
FT                   /locus_tag="Ssed_0175"
FT   CDS_pept        complement(200314..200817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34788"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL5"
FT                   /protein_id="ABV34788.1"
FT                   /translation="MLVVTNYPQVPIATTNAATDSARTDNQQRPPVIPPKELTKGHEER
FT                   SFTPQHERTAEQADAQARLNERVQGKQQGTGQQHQEGKQQDQAKHAAPLLIKDLLRGKP
FT                   ALQRRDIQTSQQAVSPTPQKTDNERAIILDQPSEFYREFGQRVESFYQQQTHPHDEPAI
FT                   SALI"
FT   gene            complement(200878..201672)
FT                   /locus_tag="Ssed_0176"
FT   CDS_pept        complement(200878..201672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0176"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: shm:Shewmr7_3882 BioH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34789"
FT                   /db_xref="GOA:A8FPL6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL6"
FT                   /protein_id="ABV34789.1"
FT                   /translation="MNPSPLHIESIGQGQEIIILHGWGVNSAVFTPLHSSLSQYRVHYV
FT                   DLPGFGHSSMIEGDIDAWVDAITSRLSHKAIWVGWSLGGLVATRAALRYPERVQGLVTI
FT                   ASSPCFMAREEESWPGIPPQVLSDFSKQLGSDLSKTIDRFLAIQAMGSVTAKDDIKQLR
FT                   ELVLSRPLPETTALVQGLDMLKSVDLRPQIAQIEQPWLRIWGRLDGLIPRRVPPLMPKD
FT                   EQLYQDLILHRASHAPFISHRDEFITGLVSWIEKLVRDELLR"
FT   gene            201710..202510
FT                   /locus_tag="Ssed_0177"
FT   CDS_pept        201710..202510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0177"
FT                   /product="competence protein ComF"
FT                   /note="KEGG: shw:Sputw3181_0113 competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34790"
FT                   /db_xref="GOA:A8FPL7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL7"
FT                   /protein_id="ABV34790.1"
FT                   /translation="MIKDSIAQRALTGLVKAAQFGRRRLQALYRGVVNLLAASLPNRCL
FT                   MCHQSIELPDSGICSVCLVTGLYQVPVCLGCGRAMQVEAIYCGACTSSRPLMIIAPCSY
FT                   HQGLGEWVGQMKYQTQFSALPVLSHVLANRILYLEEIGLLQLPQVLIPVPLHSNRLRKR
FT                   GFNQAYLIADALTGRLNIPVVTEGLTRTIDTCSQAGLTGKQRRKNLSGAFSLEAHFSYQ
FT                   RIALIDDVVTTGTTAIEIAELFEKRHIHVQIWCLARAEAPGLMD"
FT   gene            complement(202523..205069)
FT                   /locus_tag="Ssed_0178"
FT   CDS_pept        complement(202523..205069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0178"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="KEGG: slo:Shew_0105 peptidase M14, carboxypeptidase
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34791"
FT                   /db_xref="GOA:A8FPL8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPL8"
FT                   /protein_id="ABV34791.1"
FT                   /translation="MLRSCLYFLATYCSLSLLLPAMAAEPHDDNAILTAKSDTSLTSPT
FT                   QFLDYPLGQWHLRHDQINFYLKQLALESAKVSIEKSGQSHEARQQLTAVISSAKNQARL
FT                   DEILQQRQKVKSGDAQQEPLVIWLAYSIHGDEASGAHAALKLSHLLASSNEQWINRLLD
FT                   EAVILITPSQNPDGLDRFSNWTNNYRGQVDVSDSNHREHRQNWPSGRSNHYFADLNRDW
FT                   LFLRHPESRGRIALFHKWQPHYVGDFHEMGRDQSYFFQPGVPSRTHPLTPKDNQALTAK
FT                   LAKFHQQALDELKQSYFSRQMFDDFYYGKGSTYPDINGSIGVLFEQASPRGQVQATRNG
FT                   ELRLQEAIDNQVATSISSLKGALALKDELLEYQSEFYQGRDKTLNKGRQQGFLIGAPAN
FT                   ANRISDLSALLDQHHIEFYYLTKPVTQGKADFAVQTSLFIPVNQPQKSLLLAMFDNRTE
FT                   FTDPTFYDVSSWNLEQAYHLQLIRNAKLDIDVLSKKRPKPTAFNVDEQAVSLLINWQQD
FT                   NAAPVLQQLLQAGIRTKFAGKPFTIRVDDIDLAFPAGSLQIPLKQSGNSAETITTKLTE
FT                   LVKGYPLNITSVNTSSSVSGIDLGSPDFHPVKPIKPLLVTGQGTDASEVGELWYYLDTK
FT                   LAVPLTLVDVGRLTRLTLSDYSHIILPGGSYSSLDEKFARKLGQFAKLGGTIIAQKGAL
FT                   TWLNKGHLLKTDLKEARFYKQLFDSTNLSFADREKLEARQSIGGAILELTLDPTHPLSF
FT                   GIRGNSLPILKNKALGLTETSTPFIVAAKYAEEPLLSGYLAEEYQRSFSMSPAILLEPR
FT                   GKGAIVILADNLMFRNIWLGSEKIYANALYFVPALD"
FT   sig_peptide     complement(204998..205069)
FT                   /locus_tag="Ssed_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            205299..205877
FT                   /locus_tag="Ssed_0179"
FT   CDS_pept        205299..205877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0179"
FT                   /product="HesB/YadR/YfhF-family protein"
FT                   /note="KEGG: shm:Shewmr7_3880 HesB/YadR/YfhF-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34792"
FT                   /db_xref="GOA:A8FPL9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPL9"
FT                   /protein_id="ABV34792.1"
FT                   /translation="MITISDAAQAHFVTLLADQPEGTHIRVFVISPGTATAECGVSYCP
FT                   PDAVEADDMEFEFNGFNAMVDEKSAPFLEEASIDFVTDQLGSQLTLKAPNAKMRKVASD
FT                   APLSERIDYVIQSEINPQLASHGGNIMLVEVTEEGTAILQFGGGCNGCSMVDVTLKDGI
FT                   ETQLLEKFPGELTGVKDVTEHQHGDHSYQ"
FT   gene            complement(206370..207707)
FT                   /locus_tag="Ssed_0180"
FT   CDS_pept        complement(206370..207707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0180"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: sbl:Sbal_0144 MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34793"
FT                   /db_xref="GOA:A8FPM0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM0"
FT                   /protein_id="ABV34793.1"
FT                   /translation="MTPVELLRNRQKNRQLLALALPMILSNITVPLLGLVDTAVVGHLS
FT                   NAYYLGGVAVGSTIITLILWMLGFLRMATTGLVAQSFGAGDTQAQYKLLLQAGSLALIL
FT                   GLSAIVLQLPILNGALMLTDATAEVERYCREYFQIRIWSTPFALLNLVLLGWLLGRQQP
FT                   KAAMWQLIVANTVNIALDLLFVLGLDWGVKGAALASVFADISGFLVALMMVYKQVQKTG
FT                   GFDLFKLSKTLSLTSYHQLLSLNADIFIRSLCLQIAFAFMTFQGAGLGDNTVAANAVLL
FT                   NLLLLISYALDGIAYYAEAEVGRAYGQRNKALMRDSVTLAWLWSGISAILFTLLFAFGG
FT                   GAIINLLTSIEAVRLVAEQYLFWIIILPLLSFGSYLFDGVYIGAAMGKVMRNSMIISTF
FT                   GVFFPIWYLLQDMGNHALWAAMSAFMLARSMTLTLHYRYRLRNKGF"
FT   gene            207731..208792
FT                   /locus_tag="Ssed_0181"
FT   CDS_pept        207731..208792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0181"
FT                   /product="polysaccharide deacetylase"
FT                   /note="KEGG: sbl:Sbal_0145 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34794"
FT                   /db_xref="GOA:A8FPM1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM1"
FT                   /protein_id="ABV34794.1"
FT                   /translation="MFKVAVIRLLILLGCSMFGFSVHSAVILQYHHVSEDTPAITSVTP
FT                   AQFSEQMQYLADNDFVVTPLSQVVDAIKSEQELPAKTVVITFDDGYQSIAKTAHPILKE
FT                   YGFPYTVFVSVEPIKARYRGMMSWDDLIGLSREGAEIANHSWGHEHLIRQLEGESQDQW
FT                   LARIEENILNTEEEISKATGQSHKMLAYPYGEYNQAIESMLSQHGFIGLGQQSGAAGPY
FT                   SPLTALPRFPVAGVYAELPSLKVKLHSLNMPVLSQTHSDPELKMGQWRPELRVTLDMSD
FT                   IYPHQMMCFIQGQGAKKPLWLSANEFSIRAEFDLPAGRSRYNCTAPSKSRSGYYWFSQP
FT                   WVRAKDDGTWIKE"
FT   sig_peptide     207731..207805
FT                   /locus_tag="Ssed_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(208820..209857)
FT                   /locus_tag="Ssed_0182"
FT   CDS_pept        complement(208820..209857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0182"
FT                   /product="Protein-glutamate methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="KEGG: slo:Shew_0109 response regulator receiver
FT                   modulated CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34795"
FT                   /db_xref="GOA:A8FPM2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM2"
FT                   /protein_id="ABV34795.1"
FT                   /translation="MIKVLIVDDSPLVRQLLTHLLSDTSDISVVGAAEDPYEARELIKR
FT                   FNPDVLTLDIEMPKMDGIAFLRNLMKLRPMPVVMISTLTEKGAAVTLEALSIGAVDFIS
FT                   KPKSDLTNKLMEYRDELIEKVRFAAKSKVRPTSPIPAPKLCTSPTGCSQNQLIAIGAST
FT                   GGTEAIQRLICQLPSDVPPIVIAQHIPAAFSASFAKRLDSHASMRVIEAQGGELLKPGT
FT                   AYIAPGSAHLIIEKRGGLLYTRLLDSEPVNRHKPSVDVLFDSVAETAGKSALGVILTGM
FT                   GKDGAKGLLNMKQSGAYTLAQDEASSVVWGMPGAAVELDANCEELHIDRIPAKLLSVMK
FT                   NASQA"
FT   gene            complement(209961..210803)
FT                   /locus_tag="Ssed_0183"
FT   CDS_pept        complement(209961..210803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0183"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="KEGG: saz:Sama_3498 protein-glutamate
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34796"
FT                   /db_xref="GOA:A8FPM3"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM3"
FT                   /protein_id="ABV34796.1"
FT                   /translation="MTQADFDFIQSLAYEKTGIVLPERKKHMVYSRLSRRLRHLNLGNF
FT                   SQYCSHIQRTPDEMINFVNALTTNLTAFFREEHHFKYLESKVIPKWKKNKNRRLRVWSS
FT                   ACSTGEEPYSIAMILEQHFSGVEWDLKVLATDLDTDVLSKASIGSYASDSVTNLPRRYA
FT                   DKYARQTDNGQKVQMRSSVQKMIHFKQLNLLGEWPMKGPFDVIFCRNVLIYFDNETKKK
FT                   IIARFRKLLSPQGYLFIGHSETLTHISEDFDLIGQTIYRPIGHGDNKLQQTKRSVANL"
FT   gene            complement(210845..213436)
FT                   /locus_tag="Ssed_0184"
FT   CDS_pept        complement(210845..213436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0184"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with PAS/Pac sensor"
FT                   /note="KEGG: slo:Shew_0111 methyl-accepting chemotaxis
FT                   sensory transducer with PAS/Pac sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34797"
FT                   /db_xref="GOA:A8FPM4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM4"
FT                   /protein_id="ABV34797.1"
FT                   /translation="MESQNSNLSNANSLPIAGLVLILISLGLLFSDQATSWVVATQIIA
FT                   IMLIASGLVKHNQSQKLSEQALNEVSRALGSREKITFSDIDIPNWELLTNKIGNLHEKQ
FT                   LQNETITKALDVCKTNVMMADVDYNITYMNDSVNEMLLENEKTLKTGLPNFDAKNLIGK
FT                   NIDIFHKNPSHQRRMLDGLNSSYEVNIEVAGLNFNLIASPIFLNGVRTGTVVEWQDVTA
FT                   KLAKEAKEQRLASETSRIKQALDVCKANVMMADVDYNIIYLNDSVNEMLGDNEKTLQQS
FT                   LPNFNVKELIGNNIDIFHKSPSHQRKVLDNLTGSYEASIKVAGLDFTLIATPVFNNGER
FT                   TGTVVEWQDVTAKLAKEAEDLRLASENARIKQALDNVSANTMVADTDLNIIYMNNAVGN
FT                   MFKAAQSDIVKDLPNFDANNLIGVNIDGFHKNPSHQRNLLGSLSTTYSSQLKVGGRTFK
FT                   VVANPIKDDNGESIGTVVEWTDRTAEVAIEHEIDTIISSATSGDLSHRVSIEGKEGFFL
FT                   NLSNGLNRLVGIADNVISDVVNMFDGLAKGDLTRQIDGEYEGQFEKLQQDANATASRLT
FT                   EVIGGINESANTVTSGAEEIAQGNADLSQRTEEQAASLEETASSMEEMTATVTQSAQNA
FT                   TLANELAQEANSKADHGGKVVEQAVTAMEAINDSSKRISDIIGVIDEIAFQTNLLALNA
FT                   AVEAARAGEQGRGFAVVAGEVRNLAQRSAGAAKEIKELIRDSVGKVTDGTQLVNQSGDT
FT                   LQDIVQAVTKVADMISQISIASEQQSSGIQEVNKAISQMDEMTQQNAALVEQVSAAGDA
FT                   MAEQARNMKSQLSFFQAKEQTSSGITSAPLALVSGDTHGNLNISSEEWNEF"
FT   sig_peptide     complement(213341..213436)
FT                   /locus_tag="Ssed_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.482 at
FT                   residue 32"
FT   gene            complement(213460..214011)
FT                   /locus_tag="Ssed_0185"
FT   CDS_pept        complement(213460..214011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0185"
FT                   /product="CheW protein"
FT                   /note="KEGG: slo:Shew_0112 CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34798"
FT                   /db_xref="GOA:A8FPM5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM5"
FT                   /protein_id="ABV34798.1"
FT                   /translation="MTELTQQEQANMDDASQQYLTFIMASEEYGVDILSVQEIRGWEAT
FT                   TVIPNSPSHVKGVINLRGTIVPIIDLRQRFGIETLEYGATTVVIVVKVAMSDEHKVIGI
FT                   VVDAVSDVFSVNDADVRDAPDFGDDTNLSFIKGLTNAADKMVILLDINMLLGSEVLPEA
FT                   SQLSNLINNIDAQQPQAVNA"
FT   gene            complement(214063..216129)
FT                   /locus_tag="Ssed_0186"
FT   CDS_pept        complement(214063..216129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0186"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: slo:Shew_0113 CheA signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34799"
FT                   /db_xref="GOA:A8FPM6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM6"
FT                   /protein_id="ABV34799.1"
FT                   /translation="MEIDLSQFSQVFFEESLEGLESMESELLKLDVNEPEDESINTIFR
FT                   AAHSIKGGSATFGFSQVANYTHLLETLLDEIRDGRRQMTSEHQDMLLLSVDLLRNMIDA
FT                   LMRKTDFDDPLLSQLEKRFTSELEGAAEDIQDEDATQADAEQAPDEQLWHIDFQAGIDI
FT                   LRCGNDPLLMFTELRQLGELTVKLAEINHPDFGDIDPEACYLSWHLELITDQKIERLKE
FT                   VFEWVEDECTIHYSSSVIDTGETRELQGTSESPQASPVPESTQASTSTSDSLPAEVVKP
FT                   KIVSQAKSPEGGSIRVSIEKIDLLINMVGELVITQAMLGQIGQQDEIDEESLLSMKQGL
FT                   EQLASHTRDLQESVMQIRMLPISFAFNRFPRLVRDIGQQLGKKVDLILNGEDTELDKTV
FT                   MEKIVDPMVHLVRNSLDHGLETPEIRVSKGKPETGSITLNAFHQGGNIIIEIIDDGAGL
FT                   DTDRILQKARDKGLVAEDEELSTEAIHQLIFKAGFSTADAVSDLSGRGVGMDVVRRNIN
FT                   ELNGTIELKSTQDKGSRFTIRLPLTLAILDGQLVRIGHHTYVVPLVSIHESLQVEPQRI
FT                   NRISENHELVRLRDEYLPVIKVFQEFDHEADAIEIKDGLVMVVDSNNEKVGLLVDELLS
FT                   QQQVVIKSLEDNYSKVPGVSGATILGDGTVALIIDISGLVSLAGITNTNEHAA"
FT   gene            complement(216175..216537)
FT                   /locus_tag="Ssed_0187"
FT   CDS_pept        complement(216175..216537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0187"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: saz:Sama_3494 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34800"
FT                   /db_xref="GOA:A8FPM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM7"
FT                   /protein_id="ABV34800.1"
FT                   /translation="MKRILAVDDSASMRQMVGFTLKTAGFDVTEASNGDEALKVAQKGE
FT                   YDLVISDVNMPVMDGLTLIRNLRTLPAYKFTPLLMLTTESGTDKKQEGRSAGATGWIVK
FT                   PFNPDQLLATVRKVLG"
FT   gene            complement(216534..216830)
FT                   /locus_tag="Ssed_0188"
FT   CDS_pept        complement(216534..216830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34801"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM8"
FT                   /protein_id="ABV34801.1"
FT                   /translation="MTDQTIKLDSELTIRNIQPIFARLSELLTHDKLLHIDVSQLSRVD
FT                   TAGAQLLYLFSQTCNARSLKVEWQGGQPELRSNLKSLGIVIPELQSDTQEKML"
FT   gene            complement(217009..217665)
FT                   /locus_tag="Ssed_0189"
FT   CDS_pept        complement(217009..217665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0189"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="KEGG: shw:Sputw3181_0125 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34802"
FT                   /db_xref="GOA:A8FPM9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPM9"
FT                   /protein_id="ABV34802.1"
FT                   /translation="MNKRLTRVVAALLAVVIVGLGSFTALQFQSMSEEVSQIELSNSFV
FT                   YPTPKRLPQFKLMEQHGTSFTNADLKGKWSLFFIGYTSCPDVCPTTMAKLTAAYPELLE
FT                   SADIQVIFLSVDPQRDTQDKLLNYMDFFNPKFIALTGDHTQLFPLTRSLGFVYAMVGDG
FT                   ENYQIDHSASMALISPEGENIAIIKPKSSTPGTLPQITSQALISDIHQIIQRKNG"
FT   sig_peptide     complement(217582..217665)
FT                   /locus_tag="Ssed_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.451 at
FT                   residue 28"
FT   gene            complement(217720..218634)
FT                   /locus_tag="Ssed_0190"
FT   CDS_pept        complement(217720..218634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0190"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="KEGG: slo:Shew_0117 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34803"
FT                   /db_xref="GOA:A8FPN0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPN0"
FT                   /protein_id="ABV34803.1"
FT                   /translation="MAKQLSIPSATSGSKSHSLAWRPYYEMTKPKVVALMLLTVLVGMC
FT                   LAVPGSVPLQPLVIGMIGIGMMAGAAAAFNHLIDRKIDGLMARTYNRPLPKGRVSIPKA
FT                   LTFAISLAALGFVLLYTLVNELTAWLTFASLIGYALVYTAYLKRATPQNIVVGGLAGAM
FT                   PPLLGWTSVTGEFHGHALLLVIIIFAWTPPHFWALAIHRKAEYAKVDIPMLPVTHGTEF
FT                   TKTCILLYTVLLAIACLLPVLVGMCGPVYLVGSTLLSCGFIYKAWELKFDDKPGLAMQV
FT                   FRFSIYHLMLLFLVLLVDHYLWV"
FT   sig_peptide     complement(218491..218634)
FT                   /locus_tag="Ssed_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.721 at
FT                   residue 48"
FT   gene            complement(218712..219698)
FT                   /locus_tag="Ssed_0191"
FT   CDS_pept        complement(218712..219698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0191"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="KEGG: slo:Shew_0118 cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34804"
FT                   /db_xref="GOA:A8FPN1"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN1"
FT                   /protein_id="ABV34804.1"
FT                   /translation="MKNLSHFLKVTIVFTLCVILMGAYTRLSDAGLGCPDWPGCYGMIK
FT                   VPSQDHELALALDSFPEHKVEQEKAWLEMIHRYIAGTLGLLVLMILFICLKNRETPKKL
FT                   PTFIALLILFQAALGMWTVTMKLMPVVVMSHLIGGFTLISLLLLLYLRTKPLRIPGGDH
FT                   SARKLAPLATAALSVLMLQIILGGWTSSNYAALACTSLPICEGDWYNKLRFIQAFTPFQ
FT                   GTHDSYEFGVLDYASRMTIHVTHRFGALVTAAVLLWLAYKLHTQSQSSQLKRSAQLLFL
FT                   LVCLQVGLGISNVVLHLPLGIAVSHNAGAVFLLMNLVFINYCLWRKA"
FT   sig_peptide     complement(219606..219698)
FT                   /locus_tag="Ssed_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.381 at
FT                   residue 31"
FT   gene            complement(219698..220243)
FT                   /locus_tag="Ssed_0192"
FT   CDS_pept        complement(219698..220243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34805"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN2"
FT                   /protein_id="ABV34805.1"
FT                   /translation="MNSPKKSGAKPLIILLLVFLLPVVAAKIVLSMNLYHGGATNKGEL
FT                   LSPETSYASLAMENPRPHEWQILYLLPSDCDALCLDRLYILKQSHIALGREQNRVHTMI
FT                   LLTESSDISALKLHSFETVKASTAMINILNDQQMVIVDPLGSLVMRYSKVSGRAKQILQ
FT                   GKSLVSDLRKMLKLSRVG"
FT   sig_peptide     complement(220166..220243)
FT                   /locus_tag="Ssed_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.630 at
FT                   residue 26"
FT   gene            complement(220444..221202)
FT                   /locus_tag="Ssed_0193"
FT   CDS_pept        complement(220444..221202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34806"
FT                   /db_xref="GOA:A8FPN3"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN3"
FT                   /protein_id="ABV34806.1"
FT                   /translation="MKTNNVFTRYPQLYLVGSRALLIIITVSLFLFLVKLGFWQLSRAE
FT                   EKELWQTQLTTRQAADSLSYAELLSLPEAESLTGYRLTVTAQPLAEQVFLLDNQVFNGR
FT                   VGYLALQLMEVTPDRPWLLVELGFIPATANRESLPAIKPITMSQSLTGRLYQKQSNPMS
FT                   SALMAEPGWPKRIQNLNVGEMRDLVNRPIAAAVLQPETIKGIDLPHPWKPIPLSAQKHR
FT                   GYALQWFSMAFAFAILVLFFIYSRKRRKNR"
FT   gene            221213..221398
FT                   /locus_tag="Ssed_0194"
FT   CDS_pept        221213..221398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34807"
FT                   /db_xref="GOA:A8FPN4"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN4"
FT                   /protein_id="ABV34807.1"
FT                   /translation="MLLLLFIVFNLAKALFLLVKGDSETPMSQFLGRRVIFSVVAVLII
FT                   LLAIGTGILSPNPRPY"
FT   gene            complement(221470..222345)
FT                   /locus_tag="Ssed_0195"
FT   CDS_pept        complement(221470..222345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0195"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="KEGG: slo:Shew_0122 cytochrome c oxidase, subunit
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34808"
FT                   /db_xref="GOA:A8FPN5"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN5"
FT                   /protein_id="ABV34808.1"
FT                   /translation="MTSKHEHYYVPAQSAWPIIGALGLFLIAFGAGSYVQQLKTDGGSG
FT                   GFILLAGIAVIIFMIFGWFRTVIAESMSGLYSKQMDRSFRQGMSWFIFSEVMFFAAFFG
FT                   ALLYARMIAVPWLGGDSNNAMTNEVLWPGFEAVWPLVMTPGGTQTEAMGWTGLPLYNTI
FT                   ILLTSSVTLHFAHVSLEKEKRSAIAIWLGITILLGMGFLVLQAEEYIHAYREMGLTLSS
FT                   GVYGNTFFLLTGFHGMHVTLGTVFLMVLFLRVLKGHFTPEKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
FT   gene            complement(222342..222911)
FT                   /locus_tag="Ssed_0196"
FT   CDS_pept        complement(222342..222911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0196"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="KEGG: slo:Shew_0123 cytochrome c oxidase assembly
FT                   protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34809"
FT                   /db_xref="GOA:A8FPN6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN6"
FT                   /protein_id="ABV34809.1"
FT                   /translation="MAKNLANANRKLISWLIAAAIGMFGFGFALVPLYDVLCEQLGING
FT                   KTQSTASSYEPVTIDKNRTITVEFMAQIQSDLPWEFKPEVKRLRVHPGELVRTNFNAKN
FT                   LSMIELVGQAIPSVSPGQGAAYFNKTECFCFNQQRLTAKASAELPLIFYVDPDLPDSIT
FT                   TLTLSYTLYNITDREYVSVVEQGAAK"
FT   sig_peptide     complement(222822..222911)
FT                   /locus_tag="Ssed_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            complement(222914..224518)
FT                   /locus_tag="Ssed_0197"
FT   CDS_pept        complement(222914..224518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0197"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: shm:Shewmr7_3865 cytochrome-c oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34810"
FT                   /db_xref="GOA:A8FPN7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN7"
FT                   /protein_id="ABV34810.1"
FT                   /translation="MSTITQDSPAAQDDHHDDHHHGAPKGIMRWLLTTNHKDIGTLYLW
FT                   FSFIMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANW
FT                   LIPMMIGAPDMALPRMNNWSFWILPFAFAILLSSLFMEGGGPNFGWTFYAPLSTTYSPD
FT                   STALFVFSVHIMGMSSIMGAINVIVTIVNMRAPGMRWMKLPLFVWTWLITAFLLIAVMP
FT                   VLAGTVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIVP
FT                   AFSRKRLFGYSSMVYATASIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTGVK
FT                   VFNWVATMWRGSISFETPMLFAVAFIILFTIGGFSGLMLAITPVDFQYHDTYFVVAHFH
FT                   YVLVTGAIFSIMAGAYYWLPKWTGNMYDEKLGRLHFWCSVISVNVLFFPMHFLGLAGMP
FT                   RRIPDYAVQFADVNQIVSIGGFAFGLSQLIFLAVVIKCIRGGEKAPAKPWDGAEGLEWT
FT                   LPSPAPYHTFSTPPEIK"
FT   gene            complement(224528..226102)
FT                   /locus_tag="Ssed_0198"
FT   CDS_pept        complement(224528..226102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0198"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: slo:Shew_0125 cytochrome c oxidase, subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34811"
FT                   /db_xref="GOA:A8FPN8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN8"
FT                   /protein_id="ABV34811.1"
FT                   /translation="MKQKLYGLPALLFSPSILAADMPLNMTQGVTEISGRVYNLHMIIL
FT                   YICCAIGILVFGVMIYSMINHRKSRGAVAANFHESTKVEIAWTLVPFIILVLMAIPATK
FT                   TLIAMEDPSDADLTIKITGSQWKWHYSYFDHDLEFYSLLSTPREQIEGTEVKGENYLLE
FT                   VDKPLVLPVNKKVRFLMTSDDVIHSWWVPAFAVKKDANPGFINEAWTRIDKPGVYRGQC
FT                   AELCGKDHGFMPIVVEALSEVDFDKWVIAQKQQANNAEAEAKAALSKTLSMEELMAKGE
FT                   QIYLARCAACHQPNGAGLPGVFPSLIGSPITIGPVAAHVDIVVNGKPGTAMQAFAKQLN
FT                   ATEIAAVVTFERNAWGNDSGDTVQAADVSSGGSSSAASNDSSTAIPATLPASQPETEQV
FT                   KTAVAETASKVVEEVEAVVLDDLTMDELMAVGEKVYMTHCVACHQAAGTGLPGAFPSLV
FT                   GSPVITGPISGHLDVVINGKPGTAMQSFSSLLTPQQLAAVVTYERNAWGNNSGDTVQAS
FT                   DVVGHGN"
FT   sig_peptide     complement(226043..226102)
FT                   /locus_tag="Ssed_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 20"
FT   gene            complement(226521..227033)
FT                   /locus_tag="Ssed_0199"
FT   CDS_pept        complement(226521..227033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34812"
FT                   /db_xref="GOA:A8FPN9"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPN9"
FT                   /protein_id="ABV34812.1"
FT                   /translation="MNSLIGNSPRHPGLWVNLEDPLSNELQGCTVSSVTTHTQGRDELQ
FT                   MLSAQLASLSHRGQWIVLISPPNIGYKQMLTDAGVRMDRVLLVHAKDEVETLWAMEKAL
FT                   TSGTSSAVISWTQSLDARDNRRLQIVAKSARAVGIVIEVANGHLHGKAHMNGVEAFNQP
FT                   SLFGSLH"
FT   gene            complement(227030..227650)
FT                   /locus_tag="Ssed_0200"
FT   CDS_pept        complement(227030..227650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0200"
FT                   /product="Repressor lexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: slo:Shew_0127 SOS-response transcriptional
FT                   repressor, LexA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34813"
FT                   /db_xref="GOA:A8FPP0"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPP0"
FT                   /protein_id="ABV34813.1"
FT                   /translation="MRPLTPRQAEILELIKRNIADTGMPPTRAEIAKRLGFKSANAAEE
FT                   HLKALAKKGCIEIIPGTSRGIRLTQANESEEELGLPLIGQVAAGEPILAQEHVEQHYQI
FT                   DPAMFRPSADFLLRVRGDSMKNIGILEGDLLAVHKAEQARNGQVVVARVEDDVTVKRFE
FT                   KKGSIVYLHAENEDYSPIVVDLTSESLSIEGLAVGVIRNGDWQ"
FT   gene            227801..230224
FT                   /locus_tag="Ssed_0201"
FT   CDS_pept        227801..230224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0201"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="KEGG: slo:Shew_3530 glycerol-3-phosphate
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34814"
FT                   /db_xref="GOA:A8FPP1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPP1"
FT                   /protein_id="ABV34814.1"
FT                   /translation="MSKQDSLWFKSLRWLQNKLVHTIVVPHEPFKDLNLDPDKPLAYVM
FT                   KTESVSDIAALSEITADLGLPSPYQPLEVGGESAPRVVCLEGAKPLMGKRESNHFFLNS
FT                   FMSLLKIHKERPELDIQLVPVSLYWGRTPGKEDDTMKAAVLERENPTWLRKCLMILFLG
FT                   RHNFVQFSSAVSLRYMADEHGTDKRIAQKLARVARVHFSRQRKVMTGPVLPKRQALFHA
FT                   LINSETLKKAIQEEAASKKITEVEARAKAMEYLDEIAADYSDSLVRIAERFLTWLWNKL
FT                   YKGINIKGAEEVRRLHHDGHEIIYVPCHRSHMDYLLLSYILYYQGMVPPHIAAGINLNF
FT                   WPAGPMFRRGGAFFIRRSFRGNKLYTTVFREYLDQLFTKGYSVEYFTEGGRSRTGRLLA
FT                   PKTGMLAMTLNSVLRGMKRPVTLVPVYLGYDHVMEVATYHKELSGKKKKKESVWQVFGA
FT                   LRKLGNFGQGYVNFGKPITLHSFLNEQKPDWKEEIAKEPEQRPKWLTPMVNTLANQVMT
FT                   NINDAAAVSSVTLTSLVLLASEQNALERSQLEKQLDLYLKLLKDLPYTSYTSVVEGDGK
FT                   SLVQQGLELKKIKLDSDPLGDIISIDESIAVAMTYYRNNIIHLMVIPSLVASCLTQHEH
FT                   ISRDEIIDIIKDFYPLLQAELFMGVEDTDKLVGQILDLFIAQGLVTEDDGFSIIETEVN
FT                   QLLLLAGTVGETLQRYAIIFNLLAVCPKMERSDLERESHKLAQRLGALHGITAPEFYDK
FT                   KLYGALSVKLKELGYLSDNGNKVDVQRIRERANGLLRSSVRQTIVDSVTAEHKD"
FT   gene            230224..231480
FT                   /locus_tag="Ssed_0202"
FT   CDS_pept        230224..231480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0202"
FT                   /product="aromatic amino acid transporter"
FT                   /note="KEGG: slo:Shew_3531 aromatic amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34815"
FT                   /db_xref="GOA:A8FPP2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP2"
FT                   /protein_id="ABV34815.1"
FT                   /translation="MANHMNAAKDGAASKSLLGGAMIIAGTAVGAGMFSLPVVGAGMWF
FT                   SYSLVMMLGVWFCMLVSGLLLLETNLHFEPGDSFDTLTRETLGNFWRIVNGLSIAFVLY
FT                   ILAYAYISGGGSIVNHSLAAAGIELPQSLAGLVFALGLAFIVFISTKAVDRITTIMLGG
FT                   MIITFFLAVGNLLIEIDTVKLFTPDGESRYLPYMLAAIPFGLVSFGYHGNVPSLVKYYG
FT                   KDASTIIKAIVTGTLIAFVIYVCWLVATMGNIPRNDFVDIIAQGGNMGVLVSALSDVMS
FT                   SGWLTTMLTVFANLAVASSFLGVTLGLFDYLADLFGFDESRSGRFKTAAVTFLPPTVLG
FT                   LLFPNGFLIAIGFAALAATIWAAIVPAMMAYKARKLYPNSESFRVPGGTFVIAIVILFG
FT                   VVTGACHLLAMAELLPVYG"
FT   sig_peptide     230224..230346
FT                   /locus_tag="Ssed_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.788 at
FT                   residue 41"
FT   gene            complement(231551..232576)
FT                   /locus_tag="Ssed_0203"
FT   CDS_pept        complement(231551..232576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0203"
FT                   /product="conserved hypothetical AraC-type transcriptional
FT                   regulator"
FT                   /note="KEGG: ppr:PBPRB1682 hypothetical AraC-type
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34816"
FT                   /db_xref="GOA:A8FPP3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP3"
FT                   /protein_id="ABV34816.1"
FT                   /translation="MLPMKFNTSFIRVCYVKPVFDGVEQVYGLNHRALSIPDALMNEPM
FT                   ALIPFTQFGEWLSELALLTQDPAYIVKLEQQLNFDRLDISGIDLLSTPDLAMSIRRINY
FT                   GIVSLQSGGSYYVSMSGKIMKWCYKNPYAFKQEKSYDSLRVAIMLLNALRHFLGGKYRP
FT                   IQVRISGSAVAQRETEHLFKCPVIWNAAQTEIWLELDDMLQPLIEPQLENSPVTMTRSL
FT                   FEKYLNMPQPHDTPKVLFEMVNYARFYGLPKIEDIAKLFNISKQQLQRRLQQQGFTFSA
FT                   LCSYIYSNQAIKYMLDGKSVAEISPLLGYANQQSFSRAFKRLRKCTPQQYLDRLNQNKP
FT                   D"
FT   gene            232705..233040
FT                   /locus_tag="Ssed_0204"
FT   CDS_pept        232705..233040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0204"
FT                   /product="putative permease of the major facilitator
FT                   superfamily"
FT                   /note="KEGG: ppr:PBPRB1681 putative permease of the major
FT                   facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34817"
FT                   /db_xref="GOA:A8FPP4"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP4"
FT                   /protein_id="ABV34817.1"
FT                   /translation="MSLIGMPFVDTSADTVLHVVALVVMVGTVTALAVGFWKIHELPIN
FT                   KAHKEEHHQLGLITALTWIGFVWHWVWVLAVFVAFIDGEKALRRLRDIWHEPAEHQQST
FT                   LEENNNA"
FT   gene            233033..234256
FT                   /locus_tag="Ssed_0205"
FT   CDS_pept        233033..234256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0205"
FT                   /product="putative multidrug resistance efflux pump"
FT                   /note="KEGG: ppr:PBPRB1680 putative multidrug resistance
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34818"
FT                   /db_xref="GOA:A8FPP5"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP5"
FT                   /protein_id="ABV34818.1"
FT                   /translation="MLEGLAVWALFIYLLRLVGMPWNKFSKGFAYIGGGGWLLFVWVGL
FT                   LNFTPMDLSGGSLVQSPHIQLRPASSQIKGQVKQIYVQPNQKIEAGQLIYELDDETYQI
FT                   ALNKALVAKESANVSLSVAKEDVKLAHKEYQTAITDIEIVKNQLAAATKDLLWKQKTLA
FT                   RYTEQNRVVPNTITASQMDEQTNGIDLAEANVHTYGSQIDKASLAEHKAKLNIEKAELA
FT                   VKSGESDYSSEVENVAQAQWNLDNTKVYAPADGYLTNYIMREGQFVGLVPRIQMYTNEK
FT                   YVLMRVNHQAIRNVKVGQNAEFASAVYPGKVFNAEVEGIIEATGESQGSLFARDDNVRQ
FT                   TTGQNLNNKHHFVRLKLNETEDYDIPVGSVGLAWISGEKPVSFLAFLDVIRGIIIRMKS
FT                   QIYYFYSI"
FT   gene            complement(234315..235505)
FT                   /locus_tag="Ssed_0206"
FT   CDS_pept        complement(234315..235505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0206"
FT                   /product="GGDEF domain"
FT                   /note="KEGG: sdn:Sden_0245 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34819"
FT                   /db_xref="GOA:A8FPP6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP6"
FT                   /protein_id="ABV34819.1"
FT                   /translation="MSAFYHRCRYFFLPLLVTAFSLGLLQFTQANWQIWQGSINQLPFW
FT                   LLVTATALALQFNRSRLAYLATLLLLFYADKQHHLLPSSLSSYTEANFLGGAMIITCFS
FT                   FFKDRGLLSPHSLVRVFSIFLCFGMAYGWLWGIEHFQAEITAKSPLSLSFQFQAALPLY
FT                   LCGLLVLTRTLWQANLVNTSILITFVIWVLYDLTPGQLPLSVLLSALAVIFLFTILIDS
FT                   YFLAYRDELTGLASRRALYNLVLSLGRKYSVAMLDIDHFKKFNDTYGHDVGDQVLKLVA
FT                   AKMARVSGGGKVFRYGGEEFTIVFPRKDTDSVIDHLEDVRESIEEYRIVLRDDKRKRST
FT                   KAKRNAANKSNKKTVSVTISIGVAERLGGETFDQTLKQADEALYRAKKKGRNQICT"
FT   sig_peptide     complement(235413..235505)
FT                   /locus_tag="Ssed_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.873 at
FT                   residue 31"
FT   gene            complement(235685..236098)
FT                   /locus_tag="Ssed_0207"
FT   CDS_pept        complement(235685..236098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0207"
FT                   /product="globin"
FT                   /note="KEGG: slo:Shew_3532 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34820"
FT                   /db_xref="GOA:A8FPP7"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP7"
FT                   /protein_id="ABV34820.1"
FT                   /translation="MSLTQKQILLVQHSFSQVEPIAEQAADIFYGALFEIDPSLKPLFR
FT                   SNIKMQGRKLMSMLKAAVDGLNDLDSLVPVLQQLAERHNGYGTKKSHFTPVGNALLYTL
FT                   KTGLGEAYTEEVRQAWITVIHLVADTMKPEITA"
FT   gene            236322..237110
FT                   /locus_tag="Ssed_0208"
FT   CDS_pept        236322..237110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0208"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="KEGG: slo:Shew_3533 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34821"
FT                   /db_xref="GOA:A8FPP8"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP8"
FT                   /protein_id="ABV34821.1"
FT                   /translation="MKVERYIQGQPCWIELASHDAKAGKQFYSELLGWGLQDMPIPDGV
FT                   YTMFNLALGEEIDEIGAAYQMHVETSEQGVPTNWTVYFAVDSVDTTIELVRTYGGELLL
FT                   GPHDVGTAGRMALLSDSEGAKFAIWQAGEHKGAGKRGEVGTLCWVELACRDSELAKQFY
FT                   PNILGWKAQPGDMPDFEYTEWLVDGQPFGSMMEMTEAWGDIAPHWMLYFTVADCDETAV
FT                   KAAKLGGKICVPPTTIPKVGRFAVINDPQGGFFSVIALNT"
FT   gene            237230..239263
FT                   /locus_tag="Ssed_0209"
FT   CDS_pept        237230..239263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0209"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: shw:Sputw3181_2790 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34822"
FT                   /db_xref="GOA:A8FPP9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPP9"
FT                   /protein_id="ABV34822.1"
FT                   /translation="MMTLQFSIRQKITFGFSAIGVLLIAGSSFFYYSLSQINLANQNVE
FT                   TLAVPVLKQSHALQLTLLKMVKLLAVANTHKERSELDRSHNQFIQLQTRYDEELSRLKG
FT                   KVLDQSKMLNSLNQAEVEFQQFLAESKNMFEAKIAIIEASSRFQEQYREFERNRFDASN
FT                   LMLDLELISAPQEARLLEEVIGTGTRIDDMLFTMGNTMSRLTRVDIASGVTAHQEDIGF
FT                   LMSNLTTNFDFLRRQAEPLNIQDIMGESSQKIDLLKQYLLQPGDLYLLQHRIIAQGQLA
FT                   LGAYTEGEKSFAASYEQLDLLANLADQRLVQLQATAKDKISAGETLAIILALVFVLMAS
FT                   FISIVTSRAMLGPLQLVNQALGRIADGDLSQRITKQTDDEFGTLTDNINKLSQDLTQLL
FT                   NEISENAHSLDGSALASSQQSQRIASVAAEQIERVENVRIRAEQLFTSSTVVKNEADRT
FT                   ADNVTQASVSSREIKGIASTNSETIQNLSNGLSESVEVMSRLSHHSQDIGGILDTIVGI
FT                   AEQTNLLALNAAIESARAGEHGRGFAVVADEVRTLAMRTQESTAEIQTTITALQQETES
FT                   VAESISLGQSKAAECVIQSQELGQAIEHMDASLNTIEQMSKHIAQVADEQLADSQNIEV
FT                   SMGETLNTANQNAQEASGVADRSAEVNELARSLTRCVKRFRL"
FT   sig_peptide     237230..237352
FT                   /locus_tag="Ssed_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.333 at
FT                   residue 41"
FT   gene            complement(239331..242468)
FT                   /locus_tag="Ssed_0210"
FT   CDS_pept        complement(239331..242468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0210"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="KEGG: slo:Shew_3534 heavy metal efflux pump, CzcA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34823"
FT                   /db_xref="GOA:A8FPQ0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ0"
FT                   /protein_id="ABV34823.1"
FT                   /translation="MLKKIIEASIKQRLMVLIITIMITVWGVQELRNTPLDALPDLSDV
FT                   QVIIKTPFPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGYSFFGDSYVYVIFEDGTDIY
FT                   WARSRVLEYLNQVSSRLPQGIQPSLGPDASGVGWIFEYALVDRSGNLDLSQLKSLQDWY
FT                   LKLELQSVAGVSEVATVGGMEQTYQIVIEPDKLAIYKLDIASIKNAIAKSNTEAGGSVI
FT                   EMAEAEYMVRAKGYRQTLDDFREIPLGITSPSGTPLLLKDVATIRKGPASRRGIAELDG
FT                   EGEVVGGIIIMRYGENALATIEAVKDKLEQLKAGLPEGVEIIPTYDRSQLIESSVENLL
FT                   HKVVEEMFVVGLVCLLFLLHARSTLVAVITLPLAILIAFIVMNKMGVNANIMSLGGIAI
FT                   AIGAVVDGAIVMIENMHKHLEHFKEKYQRPPNNKEHWKIVTEASIEVGPALFFSLLIIT
FT                   LSFVPVFALEAQEGRLFSPLAYTKTFAMAAAALLSITLVPILMGFFIRGKIPKETSNPI
FT                   SRVLIAIYKPSLTLVLRFPKITLVIAVITLLSAWYPLNNLGSEFMPELEEGDLLYMPTA
FT                   LPGISASKAAEILQQTDRLIKTVPEVKRVFGKVGRAETATDPAPLTMLETTIMLNPRDE
FT                   WREGVALQDIIDQLQQTVKVPGLTNAWVQPIKTRIDMLSTGIKTPVGIKITGADVDELQ
FT                   KIGTNIEAILSKLPNTKSAYAERVGGGRYIDITPKLDVASRYDMTLTDIQDVVRYAIGG
FT                   MEIGESVQGAERYPINLRYPRELRDNIEKLRELPVITKTGHYLPLRNLADIEITDGAPM
FT                   LKSENGRLISWVFVDIEGTSIGEYIDEAKQALDNVLTIPPRYSYGFAGQYEYMQRVDAK
FT                   LKKVIPMALGVIFILLMMTFGSTLQAGIIMLSLPFALVGSTWLLYALEYNMSVAVAVGM
FT                   IALAGVAAEFGVVMLVYLNNAIKHRKETGGYESVTDLKEALIEGAVMRIRPKAMTVATI
FT                   FFGLLPIMWGSGAGNDVMQKIAAPMIGGMVTAPLLSLFVLPALYLIIYGRKLNSTQ"
FT   gene            complement(242600..244552)
FT                   /locus_tag="Ssed_0211"
FT   CDS_pept        complement(242600..244552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0211"
FT                   /product="Membrane-fusion protein-like protein"
FT                   /note="KEGG: slo:Shew_3535 efflux transporter, RND family,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34824"
FT                   /db_xref="GOA:A8FPQ1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ1"
FT                   /protein_id="ABV34824.1"
FT                   /translation="MSHLESNNKRTKLAYLLSLFMVITPQLAHSQQLLAQENTAQHTEH
FT                   SHTDAKTATYSCPMHPDETSHEAGSRCSICNMFLVNEGVEEEEGRAKTSLSASEQKTYV
FT                   CPMHPDETSHEAGSRCSICNMFLVNEGVEEEEGGAKTNLSASEQKTYVCPMHPDETSHE
FT                   AGSRCSICNMFLVNEGVEEEEGGAKTSLTANEQKTYVCPMHPDETSHEAGSRCPICNMF
FT                   LVEEEEEEKGSVDHSSHNMSSSTPEDHSGHAHQTQEADTPADTVFNSAKPAPLDDGANI
FT                   KYVCPMHAHIISDVPGTCPICGMNLEKVELGGNSKEIQIDVSGGMQQALALKVARVEKD
FT                   TLWKFVQTVGQIDYDESKINHIHARVNGWIEKLTIESVGDKIIKGQLLYEIYSPDLINA
FT                   QDDFLLAQDTLKRSGSSENYKDLVRKAGLRLELLGFNKSQIKALAKSKKTQYRVPFYAK
FT                   SGGIVKALSVRDGMYIQPSTEVMSVVDLSKVWVIADVFENEQSWLEIGQKAEVSVPAMG
FT                   IKGIEGEIDYIYPELDAVTRSLRVRIVVKNKDLELRPNTLAKIDIFGGPNRDTLVIPQE
FT                   ALIQTGKENRVIVKLEDNSFTARKVTVGMLSQGKAEIKNGLEAGERVVTSGQFLLDSEA
FT                   SLKGSLMRLSSGHQH"
FT   sig_peptide     complement(244460..244552)
FT                   /locus_tag="Ssed_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.638 at
FT                   residue 31"
FT   gene            complement(244575..245153)
FT                   /locus_tag="Ssed_0212"
FT   CDS_pept        complement(244575..245153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34825"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ2"
FT                   /protein_id="ABV34825.1"
FT                   /translation="MKTLLSLVLSVFILVSMVPAASAHQHEHAQHESADYACPMHPEVT
FT                   GQKGDSCPKCGMNLEANKATTSKHQGKKCDSCPNHKAKAHKDMHADTHACPMHPSVTGE
FT                   KGDTCPDCGMNLTASKAASQHHGKKCDSCPNHGAKAHKDMHADTHACPMNPKITGKKGD
FT                   TCPKCGMNLEPIKTAANGAGKHPAHHKQQ"
FT   sig_peptide     complement(245082..245153)
FT                   /locus_tag="Ssed_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 24"
FT   gene            complement(245418..245819)
FT                   /locus_tag="Ssed_0213"
FT   CDS_pept        complement(245418..245819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34826"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ3"
FT                   /protein_id="ABV34826.1"
FT                   /translation="MALLAMLSQGLMTNGFSMVRNAEAHEAMMSESHDSDMMSMGDGAN
FT                   CHSEQTSNTDHCCDNEQNEVLPGTAQNCCDGDGFCQGNCSHCLVISVTGTLFYAKSWPG
FT                   FSPSQLSMATQMPYFHSISLTTDLRPPIA"
FT   gene            complement(245985..246410)
FT                   /locus_tag="Ssed_0214"
FT   CDS_pept        complement(245985..246410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34827"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ4"
FT                   /protein_id="ABV34827.1"
FT                   /translation="MKTLITAVALTLASFTSIAASVSFPDSLVVTGINGEKRFDAHQPQ
FT                   LADGENLIQLRYHDIFEVNADDSGAWVKSEPLYLLVDFQGQQEYQAATPTINTEDEAYD
FT                   FIENPIITLEDAQGKNKTVALLTHQQLMAKVLLTRKN"
FT   sig_peptide     complement(246351..246410)
FT                   /locus_tag="Ssed_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 20"
FT   gene            complement(246604..247095)
FT                   /locus_tag="Ssed_0215"
FT   CDS_pept        complement(246604..247095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34828"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ5"
FT                   /protein_id="ABV34828.1"
FT                   /translation="MVLIISLVGQFLLSPAMAMPSLLHAFSHSQMSLLSNSELSESELS
FT                   DSELMPAEAMTVVTNQTQPNNNLPANEDQAMTHGQQDCDMAMSGLSNHDGPTIDCDALC
FT                   EMMGAGNCASHCTSATGILTQPQISLISPETSGRVQSGSWSTQTVELSSSNPPPKFEQA
FT                   "
FT   sig_peptide     complement(247018..247095)
FT                   /locus_tag="Ssed_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.409 at
FT                   residue 26"
FT   gene            247524..248087
FT                   /locus_tag="Ssed_0216"
FT   CDS_pept        247524..248087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0216"
FT                   /product="tetraheme cytochrome c"
FT                   /note="KEGG: saz:Sama_3471 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34829"
FT                   /db_xref="GOA:A8FPQ6"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ6"
FT                   /protein_id="ABV34829.1"
FT                   /translation="MNLRALFRPSAKYSIFALLVVGIVVGVVGYFATQQTLHATSSDEF
FT                   CMTCHSNHSLKDEVLASAHGGGKSGIVVECQQCHLPQEPFQYLIKKIIVSKDVIGFLTI
FT                   DGFNTQEWLEANRKEQADHARDFLRSIDSSTCQNCHKRIYEDQPETMKKMAKRMHSNNF
FT                   KKAEDKRKTCIDCHKGVAHPYPKG"
FT   sig_peptide     247524..247622
FT                   /locus_tag="Ssed_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.670 at
FT                   residue 33"
FT   gene            complement(248722..249012)
FT                   /locus_tag="Ssed_0217"
FT   CDS_pept        complement(248722..249012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0217"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="KEGG: shn:Shewana3_3974 protein of unknown function
FT                   DUF1145"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34830"
FT                   /db_xref="GOA:A8FPQ7"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ7"
FT                   /protein_id="ABV34830.1"
FT                   /translation="MKFVITTGKAVTLFAWLLMTYNLIMPFEGNIAIILYILLAITTFM
FT                   HCFQVVIFHTIFKSLLSLKKGDYFSVFIFGAFSLLQYRSKVMQNLGNAETR"
FT   gene            complement(249075..249656)
FT                   /locus_tag="Ssed_0218"
FT   CDS_pept        complement(249075..249656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0218"
FT                   /product="putative methyltransferase"
FT                   /note="KEGG: shw:Sputw3181_3914 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34831"
FT                   /db_xref="GOA:A8FPQ8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ8"
FT                   /protein_id="ABV34831.1"
FT                   /translation="MAKNRPSSGQVRIIAGQWRSRRLPIQDLEGLRPTTDRVRETLFNW
FT                   LAGDLTGARILDCFGGSGALCLESLSRYASYAKVFELQASAAEQLKDNLKTLKCDSSTA
FT                   EVIKGDTLKLLATKPSEGFDIIYIDPPFRKGLAEKTIQLIAGNGWLNENAQIYVETESE
FT                   TAQLAVPSDWVQLKEKKAGQVIYRLYQYQP"
FT   gene            250086..251708
FT                   /locus_tag="Ssed_0219"
FT   CDS_pept        250086..251708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0219"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: slo:Shew_3606 signal recognition
FT                   particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34832"
FT                   /db_xref="GOA:A8FPQ9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPQ9"
FT                   /protein_id="ABV34832.1"
FT                   /translation="MAKKGFFSWFRKDKSKDEVSAPEAEVVTESQDAVEAEALSEEQAK
FT                   QAEQARIEAEALALAEEQAEQARIEAEALALAEEQAKQAELARIEAEALALAEEQAKQA
FT                   EQARIEAEAAALAEEQAKQAEQARIEAEAAALAEEQAKQAEQARIEAEAAALAEEQAKQ
FT                   AELARIEAEAAALAEEQAKQAEQARIETEAAALAEEQAKQAELDAEQVAAEQETEKQPE
FT                   PQEKPTKEGFFARLKRGLKRTSENIGSGFVSLFSGKKIDDDLFEELEEQLLIADVGVET
FT                   TTRLIDSLTEQASRKQLKDGEALYEILRDEMQKTLEPVSIPLVPESADGPFVILMVGVN
FT                   GVGKTTTIGKLAKQYQAQGKSVMLAAGDTFRAAAVEQLQVWGQRNDIPVVAQHTGADSA
FT                   SVLFDALQAARARNIDILIADTAGRLQNKAHLMDELKKVIRVMKKQDESAPHEVMLTLD
FT                   ASTGQNAISQAELFKKAVGVTGITISKLDGTAKGGVIFAIADKFGIPIRHIGVGEQIDD
FT                   LRTFDAKDFVDALFTQESDENKS"
FT   gene            251738..252430
FT                   /locus_tag="Ssed_0220"
FT   CDS_pept        251738..252430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0220"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: slo:Shew_3605 cell division ATP-binding
FT                   protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34833"
FT                   /db_xref="GOA:A8FPR0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR0"
FT                   /protein_id="ABV34833.1"
FT                   /translation="MIRFEQVSKVYPGGQKALSDVNFHLKRGEMAFLTGHSGAGKSTLL
FT                   KLITVIERANAGRVLINGHDIAKLSRSDVPFLRRDIGMIFQSHHLLMEKSVFDNVALPL
FT                   VIEGFSHGEIKKRVLAALDMVGLYGKERHSPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDSGTTVLIATHDLGLIARMKYRTLTLKQGHVLGGEELM
FT                   SSADGVKG"
FT   gene            252433..253398
FT                   /locus_tag="Ssed_0221"
FT   CDS_pept        252433..253398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0221"
FT                   /product="protein of unknown function DUF214"
FT                   /note="KEGG: slo:Shew_3604 protein of unknown function
FT                   DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34834"
FT                   /db_xref="GOA:A8FPR1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR1"
FT                   /protein_id="ABV34834.1"
FT                   /translation="MSNKPQLTRSKLPISGRIVMFFIRHIQHAMGSMGELWRNPVSSLM
FT                   TMAVLGVSLSLPAALQVLVKNAETITQSWNSAAEISLFVDEGRSERTIQSLITRIKVYP
FT                   EVSEVNYINRAQALEEFQRLSGFGEALSYLDTNPLPAVVTVTPSLKYSSPVGARELLKK
FT                   LEMEPEVSFGRLDIEWLERLQAVVRLLERTVLAIAALLVLAVVLVIGNTIRLAIMNRRT
FT                   EIEVMKLVGATEAFIQRPFLYTGIWYGIIGGVLAWIIINLLVWYLDSALAELLGLYGSQ
FT                   LEMQSLTLVELGQLVGLASFLGWLGSYLSVRQHLRAIEPS"
FT   gene            253663..254520
FT                   /locus_tag="Ssed_0222"
FT   CDS_pept        253663..254520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0222"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="KEGG: slo:Shew_3603 RNA polymerase, sigma 32
FT                   subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34835"
FT                   /db_xref="GOA:A8FPR2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR2"
FT                   /protein_id="ABV34835.1"
FT                   /translation="MTNQTQSMALTVPHGSGSLEAYVHSAHNISMLQPEQEYELAKRLQ
FT                   ETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPNVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKSKKRLGWFSDEEVGMVADN
FT                   LGVSKADVTEMESRMAAQDPAFDLASDNDDDHDFAPMHYLEDHSSDLASQVENDNLEAS
FT                   NQARLLSAIKTLDERSQHILQARWLNEDKTTLQELAATYQVSAERIRQLEKNAMNKLKG
FT                   RMEA"
FT   gene            complement(254948..256462)
FT                   /locus_tag="Ssed_0223"
FT   CDS_pept        complement(254948..256462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0223"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="KEGG: shw:Sputw3181_3901 O-succinylbenzoate-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34836"
FT                   /db_xref="GOA:A8FPR3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR3"
FT                   /protein_id="ABV34836.1"
FT                   /translation="MKALLSPLHQSARQHPNQTALTYIQDGVNRQIDYSTLSQRVIALG
FT                   EQLIAKGLAKGDRLACIDNNSVELVMLYWACIDHQILFCPLSPRFPASQVSALIESHRL
FT                   NFLWTGEGFTELASELSVSRSGSGTNTVTVTPRAMTLNFSLTADNTPTPIDHYAPANII
FT                   LTSGSSGQPKAAVHSLSNHKASAEGSRSLISLEPGDVWLLSLPLFHIGGLAIINRCAFV
FT                   GATVVLQDRDVGLSIQISRDQITHLSLVSTQLVRLLKEDADSLKGVKSLLLGGGAISSS
FT                   LLGQLNALSINSFTSYGMTEMASQVTTGPANSDGSSGRLLPSRELKIIDEKIYVKGETL
FT                   FLGYLDAQAQTHEQNSCADDVCKLIRPTDEDGWFFTKDRGYWDAAGKLHILGRIDNMFI
FT                   CGGENLQPEEVEAALKQHPAIEDAIVFAQADEEFGNLPAAIIKVSHSKSAKPSCDELTQ
FT                   FLADKVARFKRPRVYYTWPNIESTSLKVSRKQVIEAVLKKVLGSKS"
FT   gene            complement(256472..257527)
FT                   /locus_tag="Ssed_0224"
FT   CDS_pept        complement(256472..257527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0224"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="KEGG: slo:Shew_3601 O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34837"
FT                   /db_xref="GOA:A8FPR4"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR4"
FT                   /protein_id="ABV34837.1"
FT                   /translation="MIISALHLYQYQIPLDKLLPVGSQRIDVRRGLVLKVEVIDETGET
FT                   LTEQVEIAPLSGIDIDGNPLHGFSKESLTQVSEKLESLLERLVQKPIDNLLDIADIEYL
FT                   PSLAFGLSLMHAKLKGQLNGHTISLNEDLRTIPLLYRNSDESINALRQRVGDLPADMHA
FT                   AKVKVSQTSLEEEVQLIHQILAIRPDLKLRLDANRGFSLEQAIDFAACLPLASIEYIEE
FT                   PCQRPSDNAAFYEAIGMPWALDESLNDPIFQFAMQPGLTALVVKPMLIGSLEKLQKLQA
FT                   EAEHSGVRFILSSSLEASLGIEALARLSQIMIPDEIPGLDTLTAFSCDLLVGSGKPRCQ
FT                   SWIDLTLIKSC"
FT   gene            complement(257524..258306)
FT                   /locus_tag="Ssed_0225"
FT   CDS_pept        complement(257524..258306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0225"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="KEGG: slo:Shew_3600 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34838"
FT                   /db_xref="GOA:A8FPR5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR5"
FT                   /protein_id="ABV34838.1"
FT                   /translation="MLALSCHGDSRKPALVMLHGFLGSKNDWDTLISDLLPHFYCICID
FT                   LPGHGQSPVLAPGSSAFERVADAIQTTLNSLSIERYHLLGYSLGGRIALHVAQAYPDNL
FT                   LSLSLESSHPGLQTLAERQVRARNDHSWSEKLSSVPIESFLSQWYQQGVFAELTESKRQ
FT                   ALILKRSNNSSEALLTVFESTSLAKQEDLWQLPGQLQLPCHYFVGKDDSKFSALASRWA
FT                   SLADIQVHEIADAGHNVHLASPTLFCRQLIKHLIEDAQ"
FT   gene            complement(258306..260015)
FT                   /locus_tag="Ssed_0226"
FT   CDS_pept        complement(258306..260015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0226"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="KEGG: slo:Shew_3599
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34839"
FT                   /db_xref="GOA:A8FPR6"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPR6"
FT                   /protein_id="ABV34839.1"
FT                   /translation="MQIDKTAELNLLWGTLILEELSRLGVQHVCMAPGSRSTPLTLAAA
FT                   KQSKLKQHLHFDERGLGFMALGLAKTSHAPVAIITTSGTAVANLYPAIIEAWLTQVPLV
FT                   VLSGDRPPELIDCGANQAIIQPALFAQYAKQINLPTPDIAIRPEALLTMLDEAISNQSL
FT                   PVHINCMFREPLYPSTMSADFTQYLSTLGNWQHTTSPFNQYGKTSQHSLPTQDSLARFV
FT                   HGKGVIIAGTLSPQESPEILVELSQKLGWPLLTDAQSQLRQHSGVIGNVDQLLHQPKAR
FT                   ALLAQAESVLVFGGRLLSKRLINFLSEQKWKRYWQVLPQQMRLDPSHSAKQVWHSSVAA
FT                   FASQAWPRSSDANWALQLIQFNDGLETLFQQQIDNAEFGEAMVVRAIAKAQNRQSQLFI
FT                   GNSLPVRLYDMYAPITPDYPRTYTNRGASGIDGLLATACGVAKHEGKATTLLIGDISQL
FT                   HDLNSLAIARTIESPFVIVILNNDGGNIFNLLPVPDEKLRSDYYRLAHGLEFGYGAAMF
FT                   GLAYNRVDDFESFNEAYQEAIAFQGPSVIEVSVAQHQASEQIASIATWVKQS"
FT   gene            260780..261730
FT                   /locus_tag="Ssed_0227"
FT   CDS_pept        260780..261730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0227"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: sfr:Sfri_3686 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34840"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR7"
FT                   /protein_id="ABV34840.1"
FT                   /translation="MIYRVFYNLLCGVITVLCLSLSAHAVPWQNLTGEQLEQKLAEKFS
FT                   AGEYSSKGADSCLMCHRKDEAVMAIFDGTHGMMNSKQSPMAGLQCEACHGPQGKHNRGG
FT                   KEPMIAFGTDSKLSASAQNSVCQGCHNDPKQMAWHSSTHNLEEVACADCHTLHSAKDPA
FT                   LDKLSVNDTCSSCHTKEKADMNKRSSHPLKWDQMTCIDCHSPHGSMSESALNKPTINDT
FT                   CYSCHSEKRGPVLWEHAPVTENCVTCHNPHGSVNEGMLKSRAPQLCQQCHAPDGHASRV
FT                   VQEPGMDAFGGGKSCLNCHSKIHGSNHPSGSLLQR"
FT   sig_peptide     260780..260857
FT                   /locus_tag="Ssed_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            261745..263754
FT                   /locus_tag="Ssed_0228"
FT   CDS_pept        261745..263754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0228"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfr:Sfri_3685 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34841"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR8"
FT                   /protein_id="ABV34841.1"
FT                   /translation="MGFKLNIITVSLLAVSGSAMATNFGVGNANTDSINMDKYQCKRCV
FT                   STNGYIGEVSVSAGYNSVDDIHAGNALGSAEDGAIAAVSGDIRYQNETGYRAQIQAHQL
FT                   GMDNGFANIKVGKSGLYELELDYQSLKSYQAGDVQSQLWHDDGMLTPSSYTNEFDLALK
FT                   REKSAIGFNYGEGFYNTFIRYSQEEKTGHQSSSLVAPSPVNFGLPVDATTKQLDAGASL
FT                   AGDNWLTELSYFGSYYGNNIKDLSLPHMNDVYSATPDNEAHQVSLSGQYQFNRTVMSGR
FT                   LVTGRMIQDDALIQMSGNPLQSWDGQIDTLDGRFAVTSMLSNRLRLGGSVDYSKRDNKS
FT                   SVWEFTQYSYNGLSGSFKQNVPQDIERNTYKVNASYRIASGYRLQAGYDRKEVDRSYSE
FT                   REQTNEDSLWAKFNVSAFDTFKVNLKASHGNRGGSDYEVDEVTSSQENALMRKYYLADR
FT                   KRNAVELKVNHSPLSWMSIDVTGRYAKDDYDATEIGLTESEDFGYDVNLSLQFSKHLSA
FT                   YGFAGQQWINSAQAGSQSFSSPDWNADIEDEFINIGAGFSYGGLMQDKLTLGGDYLFSN
FT                   SISDTSVGGTLVTTNGSQPYGDYFSYNHSVRMYADYALSKQMALKLSYQYERYYDTDAA
FT                   QVATNAVPGLTTLGELNHDYNAHEVMLSFSYLLR"
FT   sig_peptide     261745..261810
FT                   /locus_tag="Ssed_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            263789..266305
FT                   /locus_tag="Ssed_0229"
FT   CDS_pept        263789..266305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0229"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="KEGG: spc:Sputcn32_0627 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34842"
FT                   /db_xref="GOA:A8FPR9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPR9"
FT                   /protein_id="ABV34842.1"
FT                   /translation="MERRSFLKMSAAMGCAASVTGCKTSSDDANVVPPQPPVGEEQITW
FT                   SSCLVNCGSNCPVKVFSRDGVITRVETDHDVADGDDVYQVRACARGRSLRQRTYAVDRL
FT                   KTPMKRVGKRGEGKFVPISWDEAAKTIGTKLTSVIAEHGNKAIFRSYGSGAYYGFASNA
FT                   CFNRLFNLNGGCLNAYGNYSWAQQMEAAKHTFGTGSTSGSSTVTLANSDFLLGVAYNPS
FT                   EIRQSGSGEGYDYLKALQKSNGLKVVMIDPRYTDSMLGKESKWLPIRPGTDAAFAEAIA
FT                   YQMISSGWVDQNSLSFINKYAVGFDAASITAQKELFANSGDATKQEYAKVMKPEENYRD
FT                   YILSQGVYADQPLKTSEWAEKITGIPAAQLEQIATDLQNAKAPYIVVGAGVNRQANGEQ
FT                   SMRALYMLSVLTGKLGTLGASNGELPSMSGMYRAGIPTGSNPVKESISFFTWSEAIHNG
FT                   ETMTARSHGVRGTDGLDTPLGTNIKVIISASDSSLLNQHAEINNTAKILEDETGVELIV
FT                   SCDCWMTPGAKFADIILPDTSWLESNDLVNDSYASGALGYITAMKSAIEPMWDCKSMYE
FT                   ASALIAKYMGCEAEFTEGKTEEQWLEELYQKTKDSSTNLGVVPAFPATYKEAQEIGFFR
FT                   KNMNDNHVALKSYINGGKALSTPSGKIEIYSAELAWRAANWDQELTTDVKGDTITAIPQ
FT                   YTVTWDGYEDEDTSTDYPIQLAGYHTKGRTHSSYHNVPWLREAVEDAVWVNPMDAAENG
FT                   LSAGDKIEMYNERGSIAVKVRITPRVAPGVFALGQGAWFKPGNTVGSTGHIIDEGGAIN
FT                   TLTRYQPSPVAKGNPQHTNRVAIKKI"
FT   sig_peptide     263789..263869
FT                   /locus_tag="Ssed_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.792 at
FT                   residue 27"
FT   gene            266320..266997
FT                   /locus_tag="Ssed_0230"
FT   CDS_pept        266320..266997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0230"
FT                   /product="anaerobic dimethyl sulfoxide reductase, B
FT                   subunit"
FT                   /note="KEGG: son:SO1430 anaerobic dimethyl sulfoxide
FT                   reductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34843"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS0"
FT                   /protein_id="ABV34843.1"
FT                   /translation="MTQPTQYGFYVDSTKCSGCKACHVSCKDRQSNEIRNNSNPEGNAL
FT                   PALEGVTWRRVYEYGGGEWTKGNNGCFEQNVFAYYMSIGCNHCSEPVCVKACPTGAMHK
FT                   RREDGLVHVAQELCIGCESCARACPYDAPQIDRERKVMTKCDGCFERIAEGRKPVCVES
FT                   CPLRALDFDTMDNLRAKYGDGDGHIAPLPSPSITSPNLIIKANVNGRPAGSGEGQILNL
FT                   SEV"
FT   gene            267075..267734
FT                   /locus_tag="Ssed_0231"
FT   CDS_pept        267075..267734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0231"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3682 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34844"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS1"
FT                   /protein_id="ABV34844.1"
FT                   /translation="MPSINTFDFQAGQGIARILHNVLLSYPTGELLNNFKQYEVVETWP
FT                   EFGQSQDNQTGKAALSRYLSLYSDEQLDELKLDYGQLFFGPEEPKAMPWGSVYLGEAQL
FT                   LNDRSTLDLIAFYKQQGIEFELEYNQPQDHIALFFSVIDRLLGLLVENPDDESVRRTLS
FT                   VLLQHHMLPWSHRCLELAIEHSQTDFYSGIAHLALDFQKVLAEVFQVIPMPVRLYR"
FT   gene            267775..268251
FT                   /locus_tag="Ssed_0232"
FT   CDS_pept        267775..268251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34845"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS2"
FT                   /protein_id="ABV34845.1"
FT                   /translation="MSVIKAFGQQHTKAEFAYLLQGYLSQSAEVCELFTGATNMTTVVN
FT                   LIAALSYRESDERFAVTSLDTELVFSVLFDGFHLLFIKEVQHGSLNQAEHLILRLTQYY
FT                   AAKLEADFVPELTDGSRTEQHLELRNKLKQVLIASSQLDDLYLQRRGMQSNMGR"
FT   gene            complement(268291..269031)
FT                   /locus_tag="Ssed_0233"
FT   CDS_pept        complement(268291..269031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO1415 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34846"
FT                   /db_xref="GOA:A8FPS3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS3"
FT                   /protein_id="ABV34846.1"
FT                   /translation="MANRTSLKRQRISAILDSAEKAIVENGLFSLSLLELARQSGCSVN
FT                   TLYNYFSNREDIAVSLFNRYIGKWGVQASREISQHRYSFAERFLAMQMIWVYRQHRDID
FT                   EGGVQFLAAIPCVWKHASHQRISTTRQLLDTWFTLNREFLMMAREQGEMTASDAQIDEC
FT                   LLMVSITERGFSLLANNYLFRENIINMPLSKIFDSMNEELKQLEWKTAISDSSFNRVLE
FT                   LVTHVNEQLSDHHIDNLIYDIEDK"
FT   gene            269290..269898
FT                   /locus_tag="Ssed_0234"
FT   CDS_pept        269290..269898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0234"
FT                   /product="thiol:disulfide interchange protein, DsbA family"
FT                   /note="KEGG: son:SO3871 thiol:disulfide interchange
FT                   protein, DsbA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34847"
FT                   /db_xref="GOA:A8FPS4"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS4"
FT                   /protein_id="ABV34847.1"
FT                   /translation="MIKLLSTAAILLSFGASAASFTQGEHYVDLGEAAFNAPNQVTKVY
FT                   SVNCPFCYKYEKAVIPGFVKNLPDGVSFDSYHITTKPPFGKEKATVIAVAKVLGDKQYK
FT                   TAKMAYYKHIHDDKKKFSSAEDAISFGLKAAKIDSVTFSAHKDTSEVKALLTQWDQGVA
FT                   VAKVRGIPAIVVNGKYLINTKTITSMTMLDELTAELLEK"
FT   sig_peptide     269290..269346
FT                   /locus_tag="Ssed_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 19"
FT   gene            269907..270542
FT                   /locus_tag="Ssed_0235"
FT   CDS_pept        269907..270542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0235"
FT                   /product="disulfide bond formation protein"
FT                   /note="KEGG: son:SO3870 disulfide bond formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34848"
FT                   /db_xref="GOA:A8FPS5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS5"
FT                   /protein_id="ABV34848.1"
FT                   /translation="MNAISQGWQDLKTAPVSTLQQWQEQRWIWLLMSGAAAFLIGSAMG
FT                   YFQWFLEMDPCEICVYIRFSQFCILFAGLVIAINPNQVLLKVLGLTLAWYGVVQGMMWS
FT                   IDLSMLHDASHAMDDVMAGGGDLFAAGGGGGACSTEPTFPLGLPLHEWFPYEFQPSGIC
FT                   GEDDWSLLGLNMAQYCIIAYSVFGIALSAVTFGWISRLTQGHSSVKAH"
FT   gene            270603..271346
FT                   /locus_tag="Ssed_0236"
FT   CDS_pept        270603..271346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0236"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0719 putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34849"
FT                   /db_xref="GOA:A8FPS6"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS6"
FT                   /protein_id="ABV34849.1"
FT                   /translation="MKYLRNVIALSLLAAAPASQAGMLAVEAGVMDWSQQAEDYFGEGK
FT                   SENSFIQMKGATGSAFGDLYAHVKLEDIEDSAAIGSEINIVGQINMGDSDFNWYGQVFN
FT                   KQKPVWSETNTTLGVSWDKQFDNGLYAQLALAGHIVTADYKHFNSDFKGGFNGGYFIYT
FT                   LMKDFDIGDQNFSFVWWQEHFFGRDDLYLKLSGDGKDFGFNGSAILRWHFHEQISAALT
FT                   YRYAENNMGKEGFHDGVFYSLQYNF"
FT   sig_peptide     270603..270668
FT                   /locus_tag="Ssed_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 22"
FT   gene            271380..273083
FT                   /locus_tag="Ssed_0237"
FT   CDS_pept        271380..273083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0237"
FT                   /product="arylsulfate sulfotransferase"
FT                   /note="KEGG: son:SO3872 arylsulfate sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34850"
FT                   /db_xref="GOA:A8FPS7"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR035391"
FT                   /db_xref="InterPro:IPR038477"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS7"
FT                   /protein_id="ABV34850.1"
FT                   /translation="MKKSILVAALSIGLMGLGAQPVFAGDDWADKYLTSVNTQGELGIV
FT                   KVNPYDFAPLTALIDLNGFEISDVHVRVEPKKGGVAIDYPVTKEGVTTHNGIPVFGLYP
FT                   DFENTVSVEYVKNGKKISEKYKIKTGPLKPLLFDGQVRTFPEVKPVTVDKKFKDRLYMV
FT                   NHLGADENTVGWDNYPVVFVTDTKGEVRWFMDWDAVYDQENDPGIAMGFHQADNGDLYW
FT                   GFESYYARYDLLGRKVFKRDIPRGFNGFSHAMKEMPNGNYLLRVAKEDYLRKDGKRIDT
FT                   VRDHIIEVDRNGKVVEVWDLNKIFDNMRDDLLKGLDAGAVCLNVDESHAGETAKLEPDA
FT                   PFGDLPGVAAGRNWAHVNSIDYDEKDDSIILSLRHQGTMKVGRDHEVKWILAANKGWGD
FT                   LSDKVLTPVNAKGKPLKCNNNTGECETNFDFPWTQHTSWLTSRGTLVSFDNGDGRNFEQ
FT                   PAMPTMKYSRGVEYKIDEEKMTVQQTFEYGKERGYEWYSPITSNIEWREDKDTFFMYSA
FT                   SAGLFTGEPGKHFINEVTEKGKVKVEMTINSMAKTEPSYRALIIDPNIMF"
FT   sig_peptide     271380..271454
FT                   /locus_tag="Ssed_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            273869..274867
FT                   /locus_tag="Ssed_0238"
FT   CDS_pept        273869..274867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0238"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: saz:Sama_2899 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34851"
FT                   /db_xref="GOA:A8FPS8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS8"
FT                   /protein_id="ABV34851.1"
FT                   /translation="MRKELSRLDYFTLKVLIGLFEFKSCSVVAEKLNTTQPKVSRALSC
FT                   LREVIQNELFVRQQYGLQPNSMAEKIYPLAKSIVATLEEIDLVAMSEPDTRRVVNVAVQ
FT                   EHMSAFFLEAISEASVHLNQEVVVNVQSWCDNVSQLIAQGKLDYAITVNSTYHEMIENL
FT                   ELGEVRYRFVVAKKGHPIFRKPLSYSGLIENRLVFINYCQVGSKPNWFESSVKLRGEEL
FT                   KLTLKTSSLNMALDHIVKSDDVCCTASIFAYQNFKNRDDTDFFDATDFSHVELAKAKKE
FT                   LAPAEHQKDYYYLQYHHSNEHEFTHLLSEIMKRKLDLMQDEYEQAKSLVAS"
FT   gene            complement(275085..276050)
FT                   /locus_tag="Ssed_0239"
FT   CDS_pept        complement(275085..276050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0239"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: shn:Shewana3_3964 transcriptional regulator,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34852"
FT                   /db_xref="GOA:A8FPS9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPS9"
FT                   /protein_id="ABV34852.1"
FT                   /translation="MRDITFSDLDLLSLNILVNLYESKSATSVSHKLNIPAPKISRCLK
FT                   HARELFGNELFIRKKYGLVPNEFAGKIYPIAKEIVECSKSLQKLHCENSVELAHHFEIA
FT                   SPDLISYTFPKVLLTSIRNAGKDMSFNISTCTRKSIDSIVTGEIDIGLCCCNIIDDIKN
FT                   IDENLEAIPLKKLNKLFLICHHEHPILKQEITLESIAAYPFVNVNVDDTKQKRSPFQAY
FT                   CDANNIQLNTEMDLSSLSGIFEYLRSTQAVALLPYSSIYNMINSTHNLHACRISDVESE
FT                   RLYMQIKVPTLYLVYNKAKADPNLQWLSTQIQDLVNTALH"
FT   gene            276582..277082
FT                   /locus_tag="Ssed_0240"
FT   CDS_pept        276582..277082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34853"
FT                   /db_xref="GOA:A8FPT0"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT0"
FT                   /protein_id="ABV34853.1"
FT                   /translation="MNASVIFSYAFMYFVLFLVVPFVLVTFTMTCIKFFKPNDTESVGA
FT                   KIKFSRHPMEPKSVGFINKLNTIVKDKYNVLYGTCLDSILDIDKAETPDDVHSYLRGCH
FT                   LDYVLVDSESSSVKLVITDPEHNSPEQSEFIDNSLAEVGVKVIHLAKNQKWDESLIRNG
FT                   LAA"
FT   gene            277170..277643
FT                   /locus_tag="Ssed_0241"
FT   CDS_pept        277170..277643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34854"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT1"
FT                   /protein_id="ABV34854.1"
FT                   /translation="MSKIDRFVTPLLASILMLVLGSFSPAATAGKVELKINQNKQCIMC
FT                   HKRNGKMFGLHANDALDLTCQNCHGEKAGHPRKASELIGFSAKSVAEPAVQTAACLQCH
FT                   DVETLSQADWTHDVHSNKVNCASCHQLHPEVDPIIGVTALDRSELCSGCHSAK"
FT   sig_peptide     277170..277259
FT                   /locus_tag="Ssed_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 30"
FT   gene            277659..278336
FT                   /locus_tag="Ssed_0242"
FT   CDS_pept        277659..278336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0242"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: she:Shewmr4_3763 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34855"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT2"
FT                   /protein_id="ABV34855.1"
FT                   /translation="MKNSRRLFLKSACAVVVAASGYTIAKSSTESVEIDGKKYALVHDE
FT                   TKCIGCDACSIACREVNQVPEGVSRLKIEREGPYGEYPDQYFRFTRKSCQQCEDTPCVK
FT                   VCPTGAAYKDPETGIVSVDSWKCVGCQYCIAACPYQVRFINPVTHAADKCDFCKETRLK
FT                   EGKQPACVSACPTQALTFGDLKDPESNIVKVLKSAPNYRSKTELGTRPKVFRIASREGE
FT                   VTL"
FT   sig_peptide     277659..277736
FT                   /locus_tag="Ssed_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            278333..279274
FT                   /locus_tag="Ssed_0243"
FT   CDS_pept        278333..279274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0243"
FT                   /product="polysulphide reductase, NrfD"
FT                   /note="KEGG: slo:Shew_3158 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34856"
FT                   /db_xref="GOA:A8FPT3"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT3"
FT                   /protein_id="ABV34856.1"
FT                   /translation="MSPFHFDGLVWHWPIAIYLFLAGVSAGAITFAILLKHFKLGNNAY
FT                   KSGFIQAACLIAPLSVFAGLGILVLDLTKPFDFWKILVFYNGTSVMSVGVAVLMIYQLI
FT                   LFAWLICVFKEPVLNWCHGRWPLVNRLLSALAKHEPSITGFLTILALSLGAYTGFLLSA
FT                   LTTYPMLNNPVLPLLFLISGLSSGAAGTLLGGVLLKGNPDGKEVHFIHNIEIPIILVEL
FT                   VLLFTFFIGLIISGGQSKIAALTAIGEGFWGWVFWGGIIIVGLSLPLAFNLFMKASSKR
FT                   KFSYVAITASCSLIGVFLLRNFILYTGQMTVA"
FT   gene            279296..279586
FT                   /locus_tag="Ssed_0244"
FT   CDS_pept        279296..279586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34857"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT4"
FT                   /protein_id="ABV34857.1"
FT                   /translation="MFKALGLSILISFSGAVFAGGIADSHAEMSGCESCHEDGAPSDDG
FT                   AFENEACASCHGPLKEFDSDVHNKHEGALLCNDCHVVHEEALAKDSCDNCH"
FT   sig_peptide     279296..279355
FT                   /locus_tag="Ssed_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(279689..279826)
FT                   /locus_tag="Ssed_0245"
FT   CDS_pept        complement(279689..279826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0245"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: slo:Shew_3598 transcriptional regulator, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34858"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT5"
FT                   /protein_id="ABV34858.1"
FT                   /translation="MGLLAYVQGNSMKRLHEIREYIDAQTDIIKIKTHVVLSEWIDNQG
FT                   "
FT   gene            280092..280697
FT                   /locus_tag="Ssed_0246"
FT   CDS_pept        280092..280697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0246"
FT                   /product="methyltransferase type 11"
FT                   /note="KEGG: slo:Shew_3596 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34859"
FT                   /db_xref="GOA:A8FPT6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT6"
FT                   /protein_id="ABV34859.1"
FT                   /translation="MLAFFEIEQGQTVLDLFSGGGYYSELLSYVVGGEGEVIAHNNQAY
FT                   LPFAKEDLDERSYATRLPNVTPLLSEANDLNFAADSLDRVFYILGFHDIYYRDETWPEI
FT                   DDDKLVANLFHSLKPGGIIAVIDHDAVSGAGKETAQEFHRLSSEHVISKMTQAGFVLTD
FT                   SAGLLKNDADPLTISVFDKAIRGKTSRYMLKFTKPQTN"
FT   gene            complement(280758..281210)
FT                   /locus_tag="Ssed_0247"
FT   CDS_pept        complement(280758..281210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0247"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="KEGG: shn:Shewana3_3955 protein of unknown function
FT                   DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34860"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT7"
FT                   /protein_id="ABV34860.1"
FT                   /translation="MIAKLKKFLSSHSQAVTPEEQARQLNLAAVSLLLEVVFADETLST
FT                   EEAKLLPTLLTSALSLTQAEAEELVDEAKKIQGNSISLYEFTHEINQQCSIEQKQKLIL
FT                   AMWKLAYADGQLCRYENQIIRRTSALLHLKHSELIQMRNLAIESQR"
FT   gene            complement(281329..281913)
FT                   /locus_tag="Ssed_0248"
FT   CDS_pept        complement(281329..281913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34861"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT8"
FT                   /protein_id="ABV34861.1"
FT                   /translation="MFLLKKLECSQYSDLFTTGRLTMKLSAVTGLLLGSLMMSSPATAG
FT                   WFDDLTSKKEVKPQVTQTQSSDLVGSVMSQLGLNQSQAEGGLGSLFSLAQSTLGSDDFG
FT                   PIASAIPNMDSLLSAAPAIDSGSGISGLLSQAGDLGASLQGGAQIYDAFEKLGISKELA
FT                   VPMIDIVKGYLDANAGNGTTDLLIKGLGAIL"
FT   sig_peptide     complement(281779..281913)
FT                   /locus_tag="Ssed_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 45"
FT   gene            282032..282748
FT                   /locus_tag="Ssed_0249"
FT   CDS_pept        282032..282748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34862"
FT                   /db_xref="GOA:A8FPT9"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPT9"
FT                   /protein_id="ABV34862.1"
FT                   /translation="MSLSAIFTEAYNFFRNHISQLAALTVPILFIQVGIQLWLGMEMAN
FT                   ADLENPQFGALHMAAVMALLLVFSLLIASLTLFMEIRSQGHEANTALILKTSLSFVPPL
FT                   LLAGVFSGLAILAPVMLFAAFGPLWLVGLVISIYIFARLAYVNFMVVVERLTPLEAIKG
FT                   SFKFSGAIAFKTLLVLMLYIPLSLIGGTLSSLAQDAVGFPLQLIVEVFIAFIGLFVNVA
FT                   LFRLYMVSRPKVEEQA"
FT   gene            282807..284225
FT                   /locus_tag="Ssed_0250"
FT   CDS_pept        282807..284225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0250"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="KEGG: slo:Shew_3592 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34863"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU0"
FT                   /protein_id="ABV34863.1"
FT                   /translation="MLTDVEFVTQFSTELGHDYGVAKSYVRDVPTQALLQIRSFTHKLT
FT                   ELLAKPKRITFDSPNLYDRIEMLNRKRVINVRTTRALHKLRGDGNRGAHPEKYHLTSEQ
FT                   LLELSEKSIEKLLSLVASLFTQVTTNPLPEYRFEAFDSFAGRDLCYRAVMESDPQAQYL
FT                   VGMSLKTKALMQREQEQALAEPEEEQGSPPDKFSDSTFKKAEYWFTQAADSNMDALYES
FT                   GVALIHGYSGKVDIAAGEQVIAAAAEANVANAMALLGYFHLVGGESIKLDSDKALHYLQ
FT                   LAADLEQSEAIANLGVLFYQRGDLEKAKHFIAKAAQAGFPHAQYHLALMLARGEGCDAD
FT                   SIAGEQWMAEAAEQGQVDAMLARAQSMLNDDNAFGCDLSQAELYLREAIKYGHSVPAMI
FT                   ELSIALADGMLGKIDVVGSAALLKLARERSNPQELAVIEPLWESLSLQVENVLSMTDNT
FT                   DEVASLQRAKELLS"
FT   gene            284323..285573
FT                   /locus_tag="Ssed_0251"
FT   CDS_pept        284323..285573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34864"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU1"
FT                   /protein_id="ABV34864.1"
FT                   /translation="MEIPLPTASQSENERLNELAQSYVKLVLAVGMHDPFYVDAYYGPE
FT                   LWRKECQLVPLSLLDLDAKRLLCELDAVALANADAKLVSRQRFLRTQVASVGYFIRHLQ
FT                   GERGSFDVESMGLYDTQANKFSLESFDSVLTEMAGLLPGEGPLAERFEAFRSGFIVPQN
FT                   RVPQVFEAAVEKARALTGAHISLPESESFSMEFVNDKIWTAYNWYQGNYQSLIQLNQDQ
FT                   PLYIERCLELASHEGYPGHHVFNLLQEQDLVRNEQWIEYAIYPLYSPISFLSEGSANYG
FT                   LRLIMSEDEVLGFERDYLMPLAGIEGDIEHYHRVLTCYKRLAYLDNLVCEQLTDGHICV
FT                   SDAECLLRDYGLYSESRARQRVKFYLSNRAYVINYNHGEESVARWVERGGNTTPVERWR
FT                   RFEALLRRPLSASQFTI"
FT   gene            complement(285705..286073)
FT                   /locus_tag="Ssed_0252"
FT   CDS_pept        complement(285705..286073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34865"
FT                   /db_xref="GOA:A8FPU2"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU2"
FT                   /protein_id="ABV34865.1"
FT                   /translation="MIYSQFQQSPFQNRFSGVKGWMAFAIGLAVITLTLIALPFVLLIG
FT                   AVSFILLSLFGRIFLKRQLARFRQQQEQGVYGAQQQEADFSQANVERDSQVFTESPFAE
FT                   RRPRVTPHQGRTFEHDPS"
FT   gene            complement(286268..287230)
FT                   /locus_tag="Ssed_0253"
FT   CDS_pept        complement(286268..287230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0253"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: slo:Shew_3589 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34866"
FT                   /db_xref="GOA:A8FPU3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU3"
FT                   /protein_id="ABV34866.1"
FT                   /translation="MNLDNLARIDLNLLVILQVLLEEQSVTRAASRLHLSQSALSKSLN
FT                   RLRDTLDDPLFIRTAHGLKPTAHAVQLSDKLPSLLENLSQLTQPPTFTPASSDRKFSFA
FT                   MVESAYETLLPYFIGPLLSNAPNLRLDSYGWMGKSIQDLQKGQVDFGIAGRDLHPKSNV
FT                   HMDRLPDGIAHQLLFTDHQICLVREEHPILSAITTGNWNLDIYLEMSHVQVRCEGNEWW
FT                   ALDYHLAEQGHRRRLSTTVPDFYGAASVCAHSDLIFTVPSSFARHAKKLYPLVELPLPF
FT                   DFIPLAYVLLWHERNNDEPGHRWMRETICKSVADAFSNI"
FT   gene            287338..288540
FT                   /locus_tag="Ssed_0254"
FT   CDS_pept        287338..288540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0254"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="KEGG: slo:Shew_3588 drug resistance transporter,
FT                   Bcr/CflA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34867"
FT                   /db_xref="GOA:A8FPU4"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU4"
FT                   /protein_id="ABV34867.1"
FT                   /translation="MRRNLLPILMSMVVLSPLAIDIYLPSMPTMAAEFSVSASEVQSTL
FT                   VLFLFAMGVGQIVIGPLADRYGRRPIALGGILLYIASSILAAVAMEFHWLQIARVLQGL
FT                   AACSTSIVVFSAVRDCFTPKESARYYSYLNGVICVIPALAPTLGGLLAMQFGWRSTFVF
FT                   MTLYAIVMMVLVGYRLPETRPANTVTTGPLYRWSRYKPVIIEPHFLFYAFSCMAGMAAI
FT                   LSYVSYAPVWIIETLGMSELTFSGLFGLNAAVNIVACFAAPMVIAKLGNRPTVMLALST
FT                   MLVSAIMQVLLQQWGPATGLPAALSFMLPMMLLCIGFALLLGPATSMALAAFGERAGTA
FT                   TAILGFIQMSGASLLTGLVQQTDLPAPYAVALVMGTLAITLLTMMAMPRFDNWHQEQHA
FT                   H"
FT   sig_peptide     287338..287433
FT                   /locus_tag="Ssed_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.710 at
FT                   residue 32"
FT   gene            complement(288663..289553)
FT                   /locus_tag="Ssed_0255"
FT   CDS_pept        complement(288663..289553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34868"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU5"
FT                   /protein_id="ABV34868.1"
FT                   /translation="MNKTTLTLAVLLGLTSTHIYAVQDTAYQHEAEVTYAGSSESFSDG
FT                   TWNGQYRYYFTSVNQDSAPYALSGFLAQTSNLGGQYSKLDVDVDADFTTYAIDGEYVFE
FT                   DKWYIGARYQNADWDNLITKTESDTYTYEVTLGYYFNDTSSVYVNYGKYGNTTQPKYMT
FT                   SLNDISKTEVDTTSYGIGVKSYLPLSSGQGILFSALFSHSSSDAKVISPTDEYQSSDSS
FT                   DSLSAAVDWYITRSWSVGATYATSFDSDWDDPYGINTAYTLRITDGLSAKFNLTKQLEP
FT                   DMDGVFAAIGINGRF"
FT   sig_peptide     complement(289488..289553)
FT                   /locus_tag="Ssed_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.972 at
FT                   residue 22"
FT   gene            289774..290367
FT                   /locus_tag="Ssed_0256"
FT   CDS_pept        289774..290367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0256"
FT                   /product="DTW domain containing protein"
FT                   /note="KEGG: shn:Shewana3_3947 DTW domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34869"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU6"
FT                   /protein_id="ABV34869.1"
FT                   /translation="MSRPICPKCHYPLKACLCESIESMQVSTELIVLQDPSEVGHAKNS
FT                   VRLLELVIEDTQVYVGECPDDFTQLRQHLEQSVKPVYLVYPSEQSEDVESVSFDEDVIL
FT                   LFLDGTWRKAYKLLQLNPWLQGLPALHLDIESASNYKIRKASRIDSLSTLEAAAMMVKA
FT                   IEPHQEVSPLLNALNAMVNQRISSMPDSVRKRYE"
FT   gene            complement(290669..292780)
FT                   /locus_tag="Ssed_0257"
FT   CDS_pept        complement(290669..292780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0257"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: slo:Shew_3585 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34870"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU7"
FT                   /protein_id="ABV34870.1"
FT                   /translation="MDRWSYLLSKLSSDRPSLSQRLQAWQLEPNALPLAIIQGYHFIGA
FT                   NPLTLSYFQTQTDNFVNATPYDFSPRIQSSGRNSIEYAQQMMRHALEGDVIEFNWLHLS
FT                   QQGRELPTRVSLFPFEFEGSPVILAMFEPSNRRSRSRESANNGFDMLPKELLSITLEDS
FT                   AEAAYITDAEHRIIAVNKAMCRISGYSADQLLHKNAEVIDLKRHTAAEEMEHNNALEER
FT                   GNWQGEVWKQRSDGTEFPAWKSCRKILAEERVYYVTIFSDISTKKKLEAKLTEQAMFDT
FT                   LTGLPNRHHLKLLLNQALQEIKETPGKMGALMFLDLNGFKNINDCFGHATGDKVLQLVS
FT                   ARLEASCIEKADIARLGGDEFTLVLRDCNGHQEVEDISQQIMSLFEAPFEIDDQKLYLG
FT                   TSIGIALFPEHSSEANKLLSLADTAMYSAKQSPEHVLFYNNSMHEEAEQKLTILSELRH
FT                   AHNLKQFSLAYQVIVNLECNSVIGAEALLRWQKPDGEILNATDFVPLLEEAGLLITIGQ
FT                   WVLKQACLQVATWRTQHAPDLKACVNVSPMQLEHPDFVQQVTEALTYSQLPANALVLEI
FT                   TELALLRQPQRVKKTLTLLKSKGISIAIDDFGAGLSSLSKLGSLPIDSLKIDAGFAHRL
FT                   SEPQGKELCQAMIKLAQALDISFVVEGIETKQQKEILKNMGKGFGQGYFFGHPKEAARF
FT                   TPENFSTYN"
FT   gene            293104..293421
FT                   /locus_tag="Ssed_0258"
FT   CDS_pept        293104..293421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0258"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34871"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU8"
FT                   /protein_id="ABV34871.1"
FT                   /translation="MSGLLCALVSISIQASDKRSLTEKADEARKQSRTIEQEQLQKARD
FT                   AASETQSREKKILKRQQSADWESEQVEKAQQQFKERESREEKYLREAKEAAAKERKIPK
FT                   P"
FT   gene            293459..294094
FT                   /locus_tag="Ssed_0259"
FT   CDS_pept        293459..294094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0259"
FT                   /product="methyltransferase type 12"
FT                   /note="KEGG: slo:Shew_3583 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34872"
FT                   /db_xref="GOA:A8FPU9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPU9"
FT                   /protein_id="ABV34872.1"
FT                   /translation="MNSCPLCGRASLFFFYQDKRRSYLRCNHCHIVVVPPEYLLCAEAE
FT                   KSVYDQHENDPQDKKYRRFLSRTFEPLIALLPDDAKGLDFGCGPGPTISVMAEEVGLLV
FT                   SNYDLYYHNTPEVLEHYYDFVTITEVIEHVADAKALLTRLDSLLSSGGVLAVMTSRMVD
FT                   AGAFGQWYYKNDPTHIRFYSIETFEWVAHHFDWHLEIVDRDVVFFHKK"
FT   gene            complement(294163..294876)
FT                   /locus_tag="Ssed_0260"
FT   CDS_pept        complement(294163..294876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34873"
FT                   /db_xref="GOA:A8FPV0"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV0"
FT                   /protein_id="ABV34873.1"
FT                   /translation="MGSSTTYEFSYLNSMPCNTEVTIQVVTPSQPIRLRTRLIGVDPHR
FT                   AIIFALGSDNSWQEAKKFLKPGQPIIVRLVNSDEPDANILAFRSSIRKLLGSTEPWLII
FT                   DYPKALQKVALRQHSRIAINLEASIQVMPAEGSDEGETTQLLSPGQLSNISINGGAFIG
FT                   KILQEISVETPCLLQVKVLQEAETMSIPITIKNIQDIEYGRMRGQYGFELSGEKSETET
FT                   FVQKVILNHLLQQPK"
FT   gene            295106..296437
FT                   /locus_tag="Ssed_0261"
FT   CDS_pept        295106..296437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0261"
FT                   /product="peptidase M16 domain protein"
FT                   /note="KEGG: slo:Shew_3581 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34874"
FT                   /db_xref="GOA:A8FPV1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV1"
FT                   /protein_id="ABV34874.1"
FT                   /translation="MIRKLSALIMAAGLMMTSQVSQATQVEDIKSFTLDNGMKIMVLED
FT                   ASIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGAKKYGPKMFDRTMEAAGGANNA
FT                   YTTENITVYTDWFPANALETIFDLEADRIASLDINEKMVESERGVVASERTTGLENSNW
FT                   RTLQEEIKGAAFRAHPYSWSVIGHESDIAAWTLDDLVQYHKTYYAPNNAVVVIAGDVKL
FT                   AEVKALADKYFAPISAQAPPKEVKTVEPLQKGERRVYVHKASVSTPNVMLAYHVPSTSH
FT                   EDYYALDLLSSVLSTGNSSRLYQSLVEKQVAIEVETYLPMTFDPNLFYVMGVANPGITA
FT                   TELEKDLIAEINKVAREGVTEQELEKVKNIKLMNFYRSMETINGKANTVGTYELYFGSF
FT                   EKLFNAPEAYGKVTPADLQRVAQTYLRRANRTVAVLAAIEETDE"
FT   sig_peptide     295106..295177
FT                   /locus_tag="Ssed_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.797 at
FT                   residue 24"
FT   gene            296434..297876
FT                   /locus_tag="Ssed_0262"
FT   CDS_pept        296434..297876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0262"
FT                   /product="peptidase M16 domain protein"
FT                   /note="KEGG: slo:Shew_3580 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34875"
FT                   /db_xref="GOA:A8FPV2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV2"
FT                   /protein_id="ABV34875.1"
FT                   /translation="MKTLTHLSKSSNRLIAAIFITGMSLSGCATQTVSTPVDTGSFSMP
FT                   AYEQFKLENGLTVYLMPQKEVPLITVNAVVRAGAVNDTTSGVAGMTAQSLLLGADGKSK
FT                   SEIEQMVDFLGASIYADAGKEGSYIGADFMAKDSDKILPLIQSLLLSPDFDAAEFDKLR
FT                   QREIAGLSQAKESPRAVISRYFDKLIYGSHPYGNASSGNSVSLAELNISQLRAFHQSYY
FT                   QPANTAISVVGDFDVKQMKSTMKQLFGRWKNSEEVVTPALKSNQPELTKSQVLLVDKGD
FT                   AIETTFLIGGKGISRDNPDYVGLKVINTILGGRFTSWLNDELRVNAGLTYGARSGFIPY
FT                   SEGGIFRISTFTKTETTKETIDLALKTYARLWETGVDQKTLDSAKAYVKGQFPPKFETS
FT                   GKLAGLLSDMYLYGFDDAFINDFQSKVDGLTLTEAQRLVSTYFPQDNLQFVLIGNADKI
FT                   APIAAEYGDVTRIGIKAVGFGG"
FT   sig_peptide     296434..296523
FT                   /locus_tag="Ssed_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.737 at
FT                   residue 30"
FT   gene            298019..298585
FT                   /locus_tag="Ssed_0263"
FT   CDS_pept        298019..298585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_3442 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34876"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV3"
FT                   /protein_id="ABV34876.1"
FT                   /translation="MVMSQVLAANKHRDIHQDDDTVDWCHIQESLKILLLAMAQIELSL
FT                   TDGEHNVTELGSLFTNMAKHLDEVNAFLSQQSDTPDEIISHGTDLAASINEGVVAFQFY
FT                   DRVSQRLQHVIMGLALMEEVLNSKQLRISPDAWRKLQEEIQESYSLDCERKMFDLVLQG
FT                   TSVHEALKLYRDENQSPKEDDIELF"
FT   gene            298542..299078
FT                   /locus_tag="Ssed_0264"
FT   CDS_pept        298542..299078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34877"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV4"
FT                   /protein_id="ABV34877.1"
FT                   /translation="MKISHLKKMISSCFKYSLLFLIFTPSLSLADKASFSDFCLSMAGQ
FT                   WQGTSAKLKQKPLQTYVSAICSADRRQLIFSVSRSAKHPFSETWWFRERGESTFLIYYD
FT                   GVDKDKSQSFSLYQQNESFSLLGEGKLNKRPALIQLRFEPKESGWLWLQNVQYLDDDTD
FT                   RYLFYRGIEMMPLER"
FT   sig_peptide     298542..298634
FT                   /locus_tag="Ssed_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.965 at
FT                   residue 31"
FT   gene            complement(299126..299590)
FT                   /locus_tag="Ssed_0265"
FT   CDS_pept        complement(299126..299590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0265"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="KEGG: slo:Shew_3577 RNA methyltransferase, TrmH
FT                   family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34878"
FT                   /db_xref="GOA:A8FPV5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV5"
FT                   /protein_id="ABV34878.1"
FT                   /translation="MFHIALFEPEIAPNTGNIIRLCANNGCQLHLIEPMGFDLEEKKLR
FT                   RAGLDYSDLTRVTRHKDFESFLAAMDGKRIMACTTKGSRPHTELAYEKEDVLLFGPETR
FT                   GLPIEIIESLPTTQRLKIPMTANSRSLNLSNAVAIISYEAWRQIGFEGAV"
FT   gene            299843..300778
FT                   /locus_tag="Ssed_0266"
FT   CDS_pept        299843..300778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0266"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /note="KEGG: ppr:PBPRA2008 putative transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34879"
FT                   /db_xref="GOA:A8FPV6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV6"
FT                   /protein_id="ABV34879.1"
FT                   /translation="MDLIKLSRISMKHLITLHVMLDTLSVTASAQRLCLSPSSISKTLG
FT                   QLRNSLNDELFYRHGNKLVATPLARRLGPSVHQMINDMNQIMTQEVFDPARYQGRFSLA
FT                   MRESTFELLAAKLSAHVLALAPNIRLDIWSKDSVGFDGLAKGTLDFIILPHDRSQPPST
FT                   HSDLVWETLTNDEMVCLMSPEHPLVKKGNKEQPFTLDDYLSYGHIGITDTDLNTPFFEM
FT                   QLAQQELQRKVAISVPDFGGAALMCHHSELLFTCSRRWAETAFQAKGLQIKPLPFNYGE
FT                   VVYSLVWHRPSMNDPAHRWLYEQILAIGCN"
FT   gene            complement(300775..301671)
FT                   /locus_tag="Ssed_0267"
FT   CDS_pept        complement(300775..301671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0267"
FT                   /product="conserved hypothetical pyruvate formate lyase
FT                   activating enzyme"
FT                   /note="KEGG: ppr:PBPRA2007 hypothetical pyruvate formate
FT                   lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34880"
FT                   /db_xref="GOA:A8FPV7"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023912"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV7"
FT                   /protein_id="ABV34880.1"
FT                   /translation="MNNRLSTLSKTASVSQIINFSCVDGPGSRLVVFLQGCNYNCKNCH
FT                   NPHTIDMCDSCGDCIAHCPTQALSMESIDGKDAIRWNSDLCSGCDTCLAVCPKQSTPKT
FT                   QEYNVTQMLEMIRKQASFISGITISGGEATLQLHFIIALFKAIKSSDDLQHLSCMLDSN
FT                   GSLNETAWQKLLPYMDGAMIDLKAWQQETHRYITGRDNHRVLRSINLLNLHNKLYEVRL
FT                   LQIPEVTDFESEIDALAGFLTQLPPSTRIKLNAFQHHGVTGEALAWRVCSEANIERLAS
FT                   QLTERGVKQPILPSVYL"
FT   gene            complement(301643..303196)
FT                   /locus_tag="Ssed_0268"
FT   CDS_pept        complement(301643..303196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO2407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34881"
FT                   /db_xref="InterPro:IPR016905"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV8"
FT                   /protein_id="ABV34881.1"
FT                   /translation="MTLQKKFAQIVSDPRLSPKQKSNYLALEADASLPYLTISKAVTQA
FT                   MSTGIICDMFEGNAPFKPRYVLPDYAKFLQQGSEYLELQAPQDLDEALNALTIIYHHVP
FT                   SVTNIPVYLGQLDEILMPFVDGLDEDVVYRKLKLFWIMLDRTLPDAFMHVNIGPSDNIV
FT                   CRTILRVDAELKQVAPNLTFMYDPDITPDALLQVAASNICECSKPHIANYPIHKSAYDK
FT                   QGFGIVSCYNSLPLAGGANTLVRLNLKEVALKADNIDNFFAHTLPHYCQLTYELIEARS
FT                   KYLHEESHFFDSFLVKEALIEEQRFAPMFGIYGMAEAVNILLGNPELCETASEKPSKHY
FT                   GHSKAANELGHRISAALDSIVKSTPVTYGYHGRALLHSQGGISLDIDVTPGVRIPYGTE
FT                   PDPISHVRALAEHHQYYTSGISDILTIDETVKSNPEAMYQLCKGTLSLGFREFTANVAS
FT                   NDLIRVTGYMIKLSDIADFKRQGSRTNTTGLGAEAAANTGILNRKPRVTSHEQSPVYAK
FT                   "
FT   gene            complement(303447..304967)
FT                   /locus_tag="Ssed_0269"
FT   CDS_pept        complement(303447..304967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0269"
FT                   /product="aldehyde dehydrogenase (NAD(+))"
FT                   /note="KEGG: shm:Shewmr7_3772 aldehyde dehydrogenase
FT                   (NAD(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34882"
FT                   /db_xref="GOA:A8FPV9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPV9"
FT                   /protein_id="ABV34882.1"
FT                   /translation="MIYAQPGTSDALVNFKVQYANFIGGEWIAPVGGKYFDNSSPVNGQ
FT                   TFCQIPRSDERDIELALDAAHAARESWGLTSVTERSNLLLRIADRVEQNLEYLAVAECW
FT                   ENGKAVRETINADLPLFVDHFRYFAGCIRAQEGSAADIDSNTVSYHFPEPLGVVGQIIP
FT                   WNFPLLMAAWKIAPALAAGNCVVLKPAEQTPVSILVMLELIQDLLPPGILNVVNGFGSE
FT                   AGQALATSKRIAKLAFTGSTEIGHHILKCAAESLIPSTVELGGKSPNVYFADVMDHEDE
FT                   YLSKAVEGMLLAFFNQGEVCTCPSRVLIHESIYEPFMAKVIERAKAIKQGNPLDTDTQV
FT                   GAQASMEQFDKILSYLQIGKDEGAQVLLGGDMCKLEGDQSSGYYIEPTILKGTNDMRIF
FT                   QEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNKAQRMGRGIQAGRVWINC
FT                   YHAYPAHAAFGGYKKSGIGRETHKMMLDHYQNTKNLLVSYDVNPLGFF"
FT   gene            305272..307068
FT                   /locus_tag="Ssed_0270"
FT   CDS_pept        305272..307068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0270"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, fis family"
FT                   /note="KEGG: shw:Sputw3181_0215 GAF modulated sigma54
FT                   specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34883"
FT                   /db_xref="GOA:A8FPW0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW0"
FT                   /protein_id="ABV34883.1"
FT                   /translation="MASKLQLQHWLSDSWQRSVGAGLSESQPPEELRLNSSAIRQKHEQ
FT                   HGQLIDLVQSHALPLFNQLMAHTSSRLILSDREGYVLSHWGVDKYSDRLANVALDIGVN
FT                   WQEEHKGTNAIGTALTARQAVSVVGDQHFIRQHRFMSCTACPIFSPSGEMIAAIDITSE
FT                   QQRHTQQTLLLVSSLAQQVETALLCHLPDSHYRINLASQPSLINSGWQGILVADNDGKI
FT                   LGCNPMAKQLLGSARVGDAIDQHLGRDWSHNERIQKHENLHLQTQPLKPARIGVGQSRS
FT                   RSNRPVSQLGVKFREPKLERAWQHANKVLSKNIPLLITGETGVGKDQFVKQLHAQSRRR
FT                   EQPIVAVNCAALPDNLVESELFGYHSGAFTGANRAGYIGKIRQADGGFLFLDEIGEMSL
FT                   GAQSRLLRVLQEREVIPVGSNNVYKVDIQVIGATHTDLKQRVADGLFRQDLYYRLNGLQ
FT                   IRLPPLRQRSDIERIIQKLHNKHKAHEQNLCGRLLSQLCHYQWPGNLRELDNFMQVASI
FT                   MAEGESELNWSALPDELQTQLMDGKAIPPTDSKPMELSDTVDANVVAAYRRFEGNVSQS
FT                   AKHLGVSRNTLYRKLKRLGLKS"
FT   gene            307242..308222
FT                   /locus_tag="Ssed_0271"
FT   CDS_pept        307242..308222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0271"
FT                   /product="alcohol dehydrogenase GroES domain protein"
FT                   /note="KEGG: slo:Shew_3572 alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34884"
FT                   /db_xref="GOA:A8FPW1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW1"
FT                   /protein_id="ABV34884.1"
FT                   /translation="MFKALVLTQEDRVTLANICQLPETDLPEGEVLVDVACSSLNYKDG
FT                   LAVTGTGRIIRNFPMVPGIDFAGVVSESADPRYKAGDRVILTGWGVGENHWGGMAEKAR
FT                   VNADWLVPMPEACSADKAMMIGTAGLTAMLCVQALQNANIKPESGDILVTGASGGVGSV
FT                   AVTLLSRLGYKVVASTGRADENADLLRSLGASEVMERSELEQDARPLEKQRWAGIVDTV
FT                   GNKVLATALAQMQYGGAAAICGLAGGFALPTTVMPFILRGVSLLGVDSVSCPFEKRQAA
FT                   WEQVLELLPDSYYQQAGQTISLDQVPEFADKIVKGQVTGRVLVKL"
FT   gene            complement(308219..309136)
FT                   /locus_tag="Ssed_0272"
FT   CDS_pept        complement(308219..309136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0272"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: vfi:VF0021 transcriptional regulators, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34885"
FT                   /db_xref="GOA:A8FPW2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW2"
FT                   /protein_id="ABV34885.1"
FT                   /translation="MELEDIYRQDLSLLIALQILVEECSVTRAAKRLHLSQSATSRILA
FT                   RLREMLNDPLFSRVGQRLVPTQFALDCYQQLQHPTGQLIEMLTPKVFVPEACKQKFTIA
FT                   ATDYAMQALVPFILPDIYRKAPNIQLEIIPVQHKEMQSQLSAQGADMAICRAIGQTLQL
FT                   NQEFLGKVGVSCLLSPGHPLANSELTLEDYLHYPHATIAISDGVKALLDAAISGHQAPT
FT                   ERLRTSHLDSALALLPFHELLIILPAGMAQLAASKHRLRVKPLPFEIPALDYNLFWHSR
FT                   CELDKGQQWLRKEIATATQRLLAD"
FT   gene            309405..310925
FT                   /locus_tag="Ssed_0273"
FT   CDS_pept        309405..310925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0273"
FT                   /product="flavocytochrome c"
FT                   /note="KEGG: shm:Shewmr7_2230 flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34886"
FT                   /db_xref="GOA:A8FPW3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW3"
FT                   /protein_id="ABV34886.1"
FT                   /translation="MKDANLLGRRNFIKGMGAAAGVAIAAPAMAISEKADGVKWDKEVE
FT                   VLIIGSGFAGLAAAIEASRKGAKDVHIFEKMSYFGGNSAINGGLFAAPGTPMQKQEGVK
FT                   DSVDRMVADQMKSGRGVADEALLRHVAEHAVEALQMTMDAGSEFHPYLQQLGGHSVART
FT                   YQTTVSCGAGITQPLLNECRKLGVHTHNRAKFEGFLVGDKGEIVGVKMRENYHFGEDQP
FT                   GKISHIRAKRGVIMATGGFAQNINLRMAQDPTLTAEVGCTNAPGATGEGMYEMFRLGAI
FT                   PVHLAHIQSGPWASPDEGGFGYVSNYTIYNFPHSLAIHRLTGKRFMNEIADRKTRADAE
FT                   LSCRDEKGEALPPILITSYKDSKKHPNTKKVIKYNVGWKFDTIEELAKHFEVPLKPLKA
FT                   QIEEYNSYVKSGDDKQFGKNMTKAKDKFIEAPFTVVRLWPKVHYCQGGVQITTKAEVKD
FT                   SFTGQPISGLYAAGEVCGGIHGVSRLGSCSIPECMVMGMTAARSVMQA"
FT   sig_peptide     309405..309497
FT                   /locus_tag="Ssed_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.790 at
FT                   residue 31"
FT   gene            310954..311307
FT                   /locus_tag="Ssed_0274"
FT   CDS_pept        310954..311307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0274"
FT                   /product="tetraheme cytochrome c"
FT                   /note="KEGG: spc:Sputcn32_3535 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34887"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW4"
FT                   /protein_id="ABV34887.1"
FT                   /translation="MIKLKAVLALTLGCLLTLSVQAVEVRDHHKEVIGKDCKTCHDNGI
FT                   KQFPSDQSCLQCHDVDDLAEQTARNEEDKWQNPHNNLHYGKELPCQECHGEHQPKQPMC
FT                   NNCHTFKFDKHKQ"
FT   sig_peptide     310954..311022
FT                   /locus_tag="Ssed_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            311595..312758
FT                   /locus_tag="Ssed_0275"
FT   CDS_pept        311595..312758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0275"
FT                   /product="porin"
FT                   /note="KEGG: slo:Shew_1530 porin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34888"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW5"
FT                   /protein_id="ABV34888.1"
FT                   /translation="MKNSIFSGRLSLVGTAVVVALSAPCSTAQAGDTEFKFGGYVKTDV
FT                   MFSDYSNGAPGSGAISRQFYVPGAIYGAEGNGEQVVDFQARESRFNFKTSTNLDGHKLS
FT                   GFIELDFMTHADGNERVSNSYSPRIRHAIVSFDNWTIGQTWSTFQNPGALPENLDFVGA
FT                   AEGTPFVRQSMVRYTNGGFQFAVENPETTVTPNGGGARITSGSGMVPDFVARYNFKTEG
FT                   GAKFTVAGLARQLNIEQGDLDTQEMGYGVSLTGVIPVGSDDIKLSATVGEGMGRYMALN
FT                   YANAGVLNSDGDIETISSYGGFASYRHWWNDKLRSSFTVSGFKADNDVALTGGAVNEES
FT                   YSGYVNLLYSPVKPLTVGVEYMYAENTKQNGDSGELNRVIFSVKYVL"
FT   sig_peptide     311595..311687
FT                   /locus_tag="Ssed_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 31"
FT   gene            complement(312872..313735)
FT                   /locus_tag="Ssed_0276"
FT   CDS_pept        complement(312872..313735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0276"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="KEGG: sfr:Sfri_3892 transcriptional regulator, LysR
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34889"
FT                   /db_xref="GOA:A8FPW6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW6"
FT                   /protein_id="ABV34889.1"
FT                   /translation="MLKSELLEGFIAVAECGNLSKAAEKICRTQSTLSLQIKKLEESVG
FT                   QSLLLRDNKGVTLTEPGETLLNYAYKMMQLNSQALDELKECKNKEVIRLGVPTDYINRY
FT                   LSSSLLEFIREFTCIELVIDTDVSGNLYKRLHQGEFDVIVATHWQTPAPGHGELLFERR
FT                   FLWATAKGGNAHKRNTIPMALYPENCPIRAQVFANHQISMRQINVLLSTPSPNALCMAV
FT                   ENDLAIAPIAEFRINDKMEVLDPIEHNLPPLPVFNESLYLNPDTQTKATKQLTTLLKAH
FT                   TEKYQQ"
FT   gene            313869..314513
FT                   /locus_tag="Ssed_0277"
FT   CDS_pept        313869..314513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0277"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: sbl:Sbal_0259 putative transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34890"
FT                   /db_xref="GOA:A8FPW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW7"
FT                   /protein_id="ABV34890.1"
FT                   /translation="MSNWEQRGHYLIEVAQRCLQGHKTFDLCRSHLVKASQISKGTIYN
FT                   HFPSEADLIVAVACADYSRWLEQAKEDELNYSDPLRRILFHHCWRLRDTLSNQRFVIER
FT                   VMPNAEILVQATQYYRHRFEKLYSQYELWNKGLISQVGDVAGFDRAELVVNYLRGAMIN
FT                   SDDANKHSGDVQMYYQFSYALTHLMGHSDKRIPDKMEFSAWLVQERAASAA"
FT   gene            complement(314510..315877)
FT                   /locus_tag="Ssed_0278"
FT   CDS_pept        complement(314510..315877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0278"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: sbl:Sbal_0260 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34891"
FT                   /db_xref="GOA:A8FPW8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW8"
FT                   /protein_id="ABV34891.1"
FT                   /translation="MIKDRLPNRIFIKLLLGFWLCSSLIIAIVGLLPLLQQSHDRAPLP
FT                   PHLEKLLERYAERIIDNPEIIQNNQFRRLSHRRDFQGKPIRFYLVNDQGRVINTEKVSR
FT                   GMRRFMLMAEETSKPISHQFKDELLFGPYNFAVSGKQYSLYGRFNDRHPRPWFFFFAEN
FT                   KLLTLTLAIGLSGLICGLLAWHLGKPLRTLRLSADALANGDLTNRVDYATTKRKDEIGQ
FT                   LAQAFNGMADSVENMVNSQQRLISDISHELRTPLTRLQLALALARKKGQESAETERIGY
FT                   EAEQLEKMISELLELSKVKLNAHDHKRHLGLAETLGQVLDDAEFEAEQQQKELIIKIDE
FT                   EIELPLYPKPLSRAIENLLRNAIRYSQSSVSIKAHKAMNIVTIEITDDGPGIDNEQDLL
FT                   AIFKPFYRPQSARERESGGWGLGLAITEAAVMAHQGKITASNLAPHGLNVTIELPS"
FT   sig_peptide     complement(315761..315877)
FT                   /locus_tag="Ssed_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.686 at
FT                   residue 39"
FT   gene            complement(315877..316560)
FT                   /locus_tag="Ssed_0279"
FT   CDS_pept        complement(315877..316560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0279"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: slo:Shew_3570 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34892"
FT                   /db_xref="GOA:A8FPW9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPW9"
FT                   /protein_id="ABV34892.1"
FT                   /translation="MSQILLIDDDLGLSELLAQLLELEGFELTLAHDGQEGLKLALEKQ
FT                   FDLILLDVMLPKLNGFEVLKALRVSKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELVARIKAIIRRSNILPEEKATTVYEYGDIQLDPGRQEVFCQDQLLILTGTEFGLLF
FT                   EMLQNGGELISKEMLSEKVLGKKLMPFDRSLDMHLSNLRKKLPERTDGRPRVKTIRGKG
FT                   YIWLP"
FT   gene            316789..317295
FT                   /locus_tag="Ssed_0280"
FT   CDS_pept        316789..317295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0280"
FT                   /product="protein of unknown function, Spy-related"
FT                   /note="KEGG: she:Shewmr4_0253 protein of unknown function,
FT                   Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34893"
FT                   /db_xref="GOA:A8FPX0"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX0"
FT                   /protein_id="ABV34893.1"
FT                   /translation="MKANTLKAGLLAIVAGTALLTTSVYAEQQTGCQDSGYHMKGDRMG
FT                   HHNGGMKSAMKKMFRGLDLTDEQRTEIKTLMKAQKDSMQGSRPTSDERQAHKTEMLALI
FT                   TADSFDESQVKLLMQQKHEKRQDKAVGMLKVQNEIYKLLTPEQQVKFKENFEKGHSRHE
FT                   RKGER"
FT   sig_peptide     316789..316869
FT                   /locus_tag="Ssed_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            317399..318268
FT                   /locus_tag="Ssed_0281"
FT   CDS_pept        317399..318268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0281"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: slo:Shew_3568 cation diffusion facilitator
FT                   family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34894"
FT                   /db_xref="GOA:A8FPX1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX1"
FT                   /protein_id="ABV34894.1"
FT                   /translation="MKQTSQYDFWVKLASRAAVATALTLIIIKMAAWMYSGSASMLASL
FT                   TDSFADALASIVNFIAIRYAIVPADQDHRYGHGKAEPLAALAQSAFILGSAFLLLFHGG
FT                   DRLINPTPINHAMVGVVVSVVAIVLTFALVLLQKRALAETSSTVVEADALHYKSDLFLN
FT                   AAVLLALVLSQYGWWWADGLFAILIAIFIGQQAIGLGYRSIQSLLDRELDADTRLTIVE
FT                   LIQEDPRVNGFHDLRTRESGKTTFIQCHLELDGDLTLRDAHTIADETEERLRNAFDHAE
FT                   VIIHQDPV"
FT   gene            318985..320519
FT                   /locus_tag="Ssed_R0004"
FT   rRNA            318985..320519
FT                   /locus_tag="Ssed_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            320850..323745
FT                   /locus_tag="Ssed_R0005"
FT   rRNA            320850..323745
FT                   /locus_tag="Ssed_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            323884..323999
FT                   /locus_tag="Ssed_R0006"
FT   rRNA            323884..323999
FT                   /locus_tag="Ssed_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            325699..327233
FT                   /locus_tag="Ssed_R0007"
FT   rRNA            325699..327233
FT                   /locus_tag="Ssed_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            327564..330459
FT                   /locus_tag="Ssed_R0008"
FT   rRNA            327564..330459
FT                   /locus_tag="Ssed_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            330598..330713
FT                   /locus_tag="Ssed_R0009"
FT   rRNA            330598..330713
FT                   /locus_tag="Ssed_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(331803..333218)
FT                   /locus_tag="Ssed_0282"
FT   CDS_pept        complement(331803..333218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0282"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, fis family"
FT                   /note="KEGG: shw:Sputw3181_0221 nitrogen metabolism
FT                   transcriptional regulator, NtrC, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34895"
FT                   /db_xref="GOA:A8FPX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX2"
FT                   /protein_id="ABV34895.1"
FT                   /translation="MSITEQVWVLDDDSSIRWVVERALKGASITSASFAAAESLWEALE
FT                   LAQPKVIISDIRMPGTDGLSLLERIQVHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLP
FT                   KPFDIDEAIALVERALTHSTEQASNTPEEIQVKAPEIIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGQSGTGKELVAGALHKHSPRKEKPFIAINMAAIPKDLIESELFGHEKGAFTGAA
FT                   GVRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHSPVQVDVRIIAAT
FT                   HQDLELLVQKGDFREDLFHRLNVIRVHLPPLSQRREDIPQLARHFLSSAAKEIAVEPKV
FT                   LTSETAKKLSELPWPGNVRQLENTCRWLMVMASGQEILPQDLPPELLKEPNSSNIDRSG
FT                   ETADWQESLKNWINQRLKEGESDLLTEVQPAFERILLETALEHTNGHKQEAAKRLGWGR
FT                   NTLTRKLKELAME"
FT   gene            complement(333272..334312)
FT                   /locus_tag="Ssed_0283"
FT   CDS_pept        complement(333272..334312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0283"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: shw:Sputw3181_0222 signal transduction
FT                   histidine kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34896"
FT                   /db_xref="GOA:A8FPX3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX3"
FT                   /protein_id="ABV34896.1"
FT                   /translation="MDIKHLFNNLVTAVMVIDVDLKLCYANAAAEQLLGVGSHRLTEHV
FT                   LSDSFQILGVSTDLLSKAIRENQGLTVNTAPLVTLDNQHHTVDITLTPLEQEQGLGLLE
FT                   LRQVDQQRRIHQQLTLDAQQQAAQYLVRNLAHEIKNPLGGLRGAAQLLSRELHDPQLNE
FT                   FTDLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHEVVQKVLNLVNMALPPNITLKQDYD
FT                   PSIPDIQMDPEQLQQAVLNIVQNAIQALDTAGGEILIRTRTQHQVTIGTLRHKLVLALS
FT                   IIDNGPGIKPELLDTLFYPMVTGRDNGSGLGLSIAHNFARLHGGRIDCHSKLGRTEFTI
FT                   LLPIKN"
FT   gene            complement(334444..334980)
FT                   /locus_tag="Ssed_0284"
FT   CDS_pept        complement(334444..334980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34897"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX4"
FT                   /protein_id="ABV34897.1"
FT                   /translation="MRLALIFSLLLFTVISHAAVYKWVDKDGKIHYSDKPIQNSEVVEF
FT                   KSNTQNQITIQAPKNSASDTEEQTVPSTQYKMSILTPKEDETIRDNNGDITIMATITPD
FT                   LKPKHLLVILMDDKVIGPAQENPIFSLKNIDRGEHSFVIKAVAQNGKQLATTSPRKIFL
FT                   HRAIINSKAKVTPFN"
FT   sig_peptide     complement(334924..334980)
FT                   /locus_tag="Ssed_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(335181..335858)
FT                   /locus_tag="Ssed_0285"
FT   CDS_pept        complement(335181..335858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0285"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="KEGG: sbl:Sbal_0270 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34898"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX5"
FT                   /protein_id="ABV34898.1"
FT                   /translation="MNILMVLTSHDKLGDTGLKTGFWLEEFASPYYRFKDKNFNITLAS
FT                   PAGGQPPLDPTSEQADFQTAATDRFNQDSETQQQLATTLTLASIKAEDYDAIFYPGGHG
FT                   PLWDLTNDAHSIALIQAFYQANKPVGLVCHAPGALKNVKSADGTPLVQGKRVTGFTNTE
FT                   EAAVQLTDVVPFLVEEMMQENGALYSKGDDWASYLAVDGNLVTGQNPASSEVVADEMIK
FT                   QLG"
FT   gene            complement(335941..337098)
FT                   /locus_tag="Ssed_0286"
FT   CDS_pept        complement(335941..337098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0286"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="KEGG: spc:Sputcn32_0377 iron-containing alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34899"
FT                   /db_xref="GOA:A8FPX6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX6"
FT                   /protein_id="ABV34899.1"
FT                   /translation="MYSFDYYNPTHISFGEGKIAELDKLVPSKAKVLVLFGGNSAKRTG
FT                   TLDEVKTALGQRDIVEFGGIEANPTYETLMQAVAVIKEEKIDFLLAVGGGSVIDGTKFV
FT                   AAAALFEGEPWDILLSWGAKVTEAMPFGTVLTLPATGSEMNSASVVTRKEFQAKLSFMS
FT                   DHVFPQFSVLDPSKTFTLPERQVANGVVDAFIHITEQYLTYPVNAPVQDRFAEGLLQTL
FT                   IELGPKALSQPDDFDVRANLMWVATMALSGVIGKGIPHDWATHMIGHELTALYDIDHAR
FT                   TIAMILPGMLDCRRDSKQEKLLQYGERVWGISQGTIDERIDAAITKTREFFEAMGIKTR
FT                   LSDYDLTAASIDEIMTKLEKHGMTALGEKQDVDLAMSRKILERNL"
FT   gene            complement(337213..337815)
FT                   /locus_tag="Ssed_0287"
FT   CDS_pept        complement(337213..337815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0287"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: shw:Sputw3181_0228 transcriptional regulator,
FT                   TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34900"
FT                   /db_xref="GOA:A8FPX7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX7"
FT                   /protein_id="ABV34900.1"
FT                   /translation="MKTDTQLTRQHIIDSGYTLISSKGFSNVGLSQILKFADVPKGSFY
FT                   HYFKSKEQFGEEIINSYFKTYLSAIDELFAPEKGSGLERLMEYWLRWQATQSDTCIDQK
FT                   CLVVKLSAEVADLSEPMRLALKTGSTGVISRIANCIEAGIDDGSIPEMHGFNTAEMLYQ
FT                   MWLGASLMNKLSRDPKVIERVLEATRKQLGLTVSTAN"
FT   gene            complement(337975..338292)
FT                   /locus_tag="Ssed_0288"
FT   CDS_pept        complement(337975..338292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34901"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX8"
FT                   /protein_id="ABV34901.1"
FT                   /translation="MNNKIKATLVSLSLLFTSTSYAAMSDIAVCNDCSAQEVKTLIDNE
FT                   TSANIYVVDFVNRTAQKFTSGDENGSQPIAIAMSISELNTINQRYEYRKTHLRALNPSS
FT                   K"
FT   sig_peptide     complement(338224..338292)
FT                   /locus_tag="Ssed_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(338414..339613)
FT                   /locus_tag="Ssed_0289"
FT   CDS_pept        complement(338414..339613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0289"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="KEGG: shm:Shewmr7_3722 sodium:dicarboxylate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34902"
FT                   /db_xref="GOA:A8FPX9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPX9"
FT                   /protein_id="ABV34902.1"
FT                   /translation="MRNKLQPYRTSIILLSALFIGGGMGIVFPELALTLKPIGQIFLNL
FT                   LFMIIVPLVAISVTSSIARMKDLNKLGAILVSILLISVIMAIIPAIGILGLAMLFDPAQ
FT                   GVSLDLNQSLQTSVGDIDFVDLLTTSDFAGLLSKSNILALIIMSVLSGIAIGRSGEDGK
FT                   KISSLLDSLNTVIMKLVAIIMLAAPIGLGAYFASTMASQDPELILTFARTIGLFFIASL
FT                   IYLTLGSTLYAWVGGGKQGIKVFWKHAIAPAATALGTSSSLATLPVNLRAAVKMGIQEE
FT                   VADICLPLLVNLNKGGASMITALKIIFIYSLLGLAFTPEVFVITILISLLSAFIIGGIP
FT                   GGAFLGEIFIVTTLGLPFETIPILVVIGTVTDALSTVINVIHDLNATQIIERINRWAPQ
FT                   "
FT   sig_peptide     complement(339515..339613)
FT                   /locus_tag="Ssed_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.714 at
FT                   residue 33"
FT   gene            complement(339691..342486)
FT                   /locus_tag="Ssed_0290"
FT   CDS_pept        complement(339691..342486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0290"
FT                   /product="Histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: saz:Sama_0067 signal transduction histidine
FT                   kinase-like protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34903"
FT                   /db_xref="GOA:A8FPY0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY0"
FT                   /protein_id="ABV34903.1"
FT                   /translation="MAPSSYRHSIGFRLNLSTLIIGFIICVILSGYFIQETRERLKVQA
FT                   HHELTQITDSLKLALETNSQTSNMIRVVGVLSTYPNITRLTVIKASDLSISADSLVQNN
FT                   GKRANLVFSNTIMKLINNPAKSSQRDQGILIDNSLHQSVKIHLVDPQANRLKPYIIYLE
FT                   YNKQALERILQQARNHLMLIVIGGLILLLLINIFIQRVVVLKPLSKMTQQLLNQDNSEQ
FT                   IPEPLQVSTNDEFSILANSYNGSIHKQLLQKAEVEKSHRYIKNMASALPVHLLYVDIDK
FT                   KIQFINQYSLQWLAKPMEEVLTQTCRQVLPSQLFSLIERPIETALQGDSITLDAEFFHK
FT                   NMSLFFHITHIPDIDNEGRIKGIFICIEDRTQTRDNEKKIEKYAHQLEMNNLALDDARE
FT                   TAEAAAQSKSEFLACMSHEIRTPMNGVLGMLTLLERTALDQSQRNHLDTAQGSARNLLG
FT                   LINDILDFSKIESGKFPIESVNFSLTNLLNETIRPLAIRAQEKGIELVSDITDITSQSF
FT                   KGDPTRISQVLTNLIGNAIKFTEKGSITVYVKQNDDIEPRLNFSVEDTGIGLASNQLEK
FT                   LFQPFTQADSSTTRHFGGTGLGLSIAKRLTELMGGSISVVSTEGKGSKFSFNVRVEIAS
FT                   KDDLYATDLNSLPILFFSRGTRADQVLGKTLNLLNASLKVVKAARLANFKPASISDTYR
FT                   PKLTIIHLPAGQEAIETELAKLASNTDLPDTPILLFIAAIDESIMTQYLNEQIFTYLCN
FT                   PLHLEQLLIALKQIDQTAPHLVQRLAPQTQRDWDLKSYFEDRLPKLLLVEDNKTNQMVA
FT                   QGIIAEFGLEIDIASDGEQAIEILKDSITSPYQLIFMDCQMPRLDGYQTTQMIRAGYTG
FT                   HQYKHIPIIAMTANAMVGDRERCLQAGMNDYISKPLDPDDIKQALLSTLAGHDTESEMR
FT                   N"
FT   gene            complement(342492..343454)
FT                   /locus_tag="Ssed_0291"
FT   CDS_pept        complement(342492..343454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0291"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system protein"
FT                   /note="KEGG: slo:Shew_3789 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34904"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY1"
FT                   /protein_id="ABV34904.1"
FT                   /translation="MTMIKYLASLLITLMLTACGGEKPQPQITIAINPWPGYELLYLAE
FT                   KKGFFEKVGINIKLVQTATLSDAQRAYINGRVDGFTSTIVEAVQAQEFGGEPLTIALLA
FT                   DYSNGGDVILGSESFQSITDLKGKKVGCEVSSLGIYILARALAVSDMSLDDVQIVNMEQ
FT                   GNAHQALAYGQIDAMVTYPPYSFDILNDKKLASHRIFTTAEIPNEILDTVSLSKGVIAR
FT                   NPKLTSQLQQAWQLAMDYLEQHPEEAVKHMAEREQISEIEFNQALSDIHLLSSMEQKQL
FT                   LKDKEKLTKLSKSVCNTLNQVGAFNSSCLHVESLFHSGI"
FT   sig_peptide     complement(343392..343454)
FT                   /locus_tag="Ssed_0291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.957 at
FT                   residue 21"
FT   gene            complement(343643..345052)
FT                   /locus_tag="Ssed_0292"
FT   CDS_pept        complement(343643..345052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0292"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: slo:Shew_3554 glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34905"
FT                   /db_xref="GOA:A8FPY2"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY2"
FT                   /protein_id="ABV34905.1"
FT                   /translation="MSAESVLQQLEELEVKFVDLRFTDTIGKEQHVSIPSHQVDADFFE
FT                   DGKMFDGSSISGWKGINESDMVLMPDAASFVLDPFTAETTANIRCDILNPGTLTGYNRD
FT                   PRSIAKKAEEYLRSTGIADTVLIGPEPEFFLFDDVKYGADMSGCFYKVDAEEASWNSGT
FT                   HYDEGNTGHRPGVKGGYFPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTLKADEVQVLKYVIHNVAHAYGKTATFMPKPIVGDNGSGMHVHQSLAKDGVN
FT                   LFAGDKYGGLSEMALFYIGGIIKHARAINAFANPSTNSYKRLIPHFEAPVMLAYSAANR
FT                   SASIRIPMVPSAKGRRIELRFGDPMANPYLAFSAMLMAGLDGIQNKIHPGEAMDKDLYD
FT                   LPPEEAAEIPTVATSLENALECLDADREFLTRGEVFCNDFIDSYIALKSADVERVNQTT
FT                   HPVEFELYYSL"
FT   gene            345432..347255
FT                   /locus_tag="Ssed_0293"
FT   CDS_pept        345432..347255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0293"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: slo:Shew_3553 GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34906"
FT                   /db_xref="GOA:A8FPY3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY3"
FT                   /protein_id="ABV34906.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKMLAQSGTLETRGEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDFPIV
FT                   YASALNGFASLDPEVSEGDMTPLFETIVEKVSSPDADAEGDFQMQISQIDYNSYVGVIG
FT                   IGRIKRGSVKTNQQVTIIGADGKKRNGKMGQVLGYMGLDRNEVAEANAGDIVAITGLGQ
FT                   LQISDTVCAPTTVEALPPLSVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLEQELV
FT                   HNVALRVEETDSPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVIVKEIDGEMCEP
FT                   FETLTVDVEEDHQGTVIEKLGIRKGDMRDMQLDGKGRVRIDFVIPSRGLIGFQTEFMTA
FT                   TSGTGLIYHSFDHYGPVKGGDIGQRARGVLISNATGKALTFALFNLQERGRLFITHAAE
FT                   VYEGQVVGLHARANDLTVNCLKGKQLTNMRASGTDEAQVLTPHIEMTLEQALEFIDDDE
FT                   LVEVTPLNIRVRKRYLTENERKRHNRAAKDA"
FT   gene            complement(347570..348784)
FT                   /locus_tag="Ssed_0294"
FT   CDS_pept        complement(347570..348784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0294"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: slo:Shew_3549 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34907"
FT                   /db_xref="GOA:A8FPY4"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY4"
FT                   /protein_id="ABV34907.1"
FT                   /translation="MSFVESLTLMLALAYSASLLYWSGKKSGAVVTIIIAVGAGISSLY
FT                   WPLLVALAIAATSLTIFTKLRPEAAKGELRANSLRDGIQHLLALSMLLVGVQFAANTAM
FT                   LKAGITPWLARPDVGDAFLPIAGGIELKAIMTLGLWDQTHPAAAVMLAVVLLTGLLCKR
FT                   AFCGWACPLGLAGEYLYKLRKRFIKQEFMPPAWLDWPLRMLKYLLLAALLYIIIGMPSA
FT                   SIPQYLAGNYHKIADLKMALFFVTPGLITLICFAFILGLSAWRRQGFCRYICPYGALLG
FT                   IISFLSPFKIRRSTQHCLIETKGMNCDKCTRACPANISVHTQKNIRSDECQACMRCVSA
FT                   CPKREALHFSTRNGIKLSARGLTIMLLLIMFIIPLGAYVGDFWHSQTLDQDRIYLIQHL
FT                   KSIGH"
FT   gene            complement(349069..349839)
FT                   /locus_tag="Ssed_0295"
FT   CDS_pept        complement(349069..349839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_00385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34908"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY5"
FT                   /protein_id="ABV34908.1"
FT                   /translation="MYNTWYNADALTNDNGDDTGLDVDINAYVQVHRLVHVTEKKLFGA
FT                   NWAYNVIVPMINKETSIADFGVDDSTSFALGDVVLEPLALFWFRDNYEAALGLSVIVPT
FT                   GDYDPADAASPGMGYWSGMLTLGGTYYLDSDKSWSVSGLTRTLVHSEQDDTDIRPGAEF
FT                   IIEGGIGKQFALDEHWLLRPGLSYCASWQISDDSRDGHGTLAGERKTGYGIGGEVNVFY
FT                   LPWLLQGNLRYVNEFGTKNTAKGSSFVFTLTKSF"
FT   gene            complement(350171..351406)
FT                   /locus_tag="Ssed_0296"
FT   CDS_pept        complement(350171..351406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0296"
FT                   /product="Arabinose efflux permease-like protein"
FT                   /note="KEGG: mem:Memar_0422 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34909"
FT                   /db_xref="GOA:A8FPY6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY6"
FT                   /protein_id="ABV34909.1"
FT                   /translation="MRPDHRNFYRVTRMAHRNHFQLLFVINFIVTLGFGICDTFFSVYV
FT                   FELGGRGALLALPLISYSVAKAVFSPFMGRCSDTFGPEKIMLVSLTIYLLVSVLFLVST
FT                   NLFILAISRLLQGVACAMFRPVIVSLVSESAIKEKRSSIMGTFDISFYAALSFGPIVGG
FT                   YMKDQLGFSAIFSGVTLLCILAILLCTCCVRDSSARVATTHSSRNKPSSLIQPIIRSRN
FT                   LRGLLAFIFGRASCISLTGTFLPIILTEELKLTGTQIGIVMASSCLTITLLLRPMGMLA
FT                   DRVSHAILIILGGISVSIIYLIIPATLTFTQIIFATTLLGLFSALSQPACTAMLVEEGT
FT                   HYGTGNTVGIFNGAMNLGFIFGPIFGAFILSGFGIDAVFYSAGVIGASTILLFALITHP
FT                   SLLSPVDSRCKN"
FT   gene            complement(351507..351845)
FT                   /locus_tag="Ssed_0297"
FT   CDS_pept        complement(351507..351845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0297"
FT                   /product="flavocytochrome c"
FT                   /note="KEGG: sfr:Sfri_2586 flavocytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34910"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY7"
FT                   /protein_id="ABV34910.1"
FT                   /translation="MKYLASIATAALLMLAVNAPSYAGELSKVHEDADITCMDCHGTDT
FT                   PTRRGKTSLCKNCHGELVEVKEFQVEERVVNVHKSPHGEVRCTACHKTHEPSVLYCNDC
FT                   HQYEVELP"
FT   sig_peptide     complement(351774..351845)
FT                   /locus_tag="Ssed_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(351912..353438)
FT                   /locus_tag="Ssed_0298"
FT   CDS_pept        complement(351912..353438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0298"
FT                   /product="putative flavoprotein subunit of a reductase"
FT                   /note="KEGG: eca:ECA0910 putative flavoprotein subunit of a
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34911"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY8"
FT                   /protein_id="ABV34911.1"
FT                   /translation="MNKLSMAIALSLLSASSYAANYTKNVDVVVIGSGASGMAAAAAAE
FT                   EKGLTTVLLEKQANIGGSALYIEGTFAVETEQQKSMYIGLTKDWAYKNHMEFNHGFING
FT                   PLMRKWINRSDESIKWMEEKGVTFHDVRTLFEDGNRTWHIFKDGKGVEFVQKMEQSFTK
FT                   NGGKIYTETPATELVYKDGKVVGVIAEDGEGDTYTFNAKGGVIVATGGFINNPKMLKKF
FT                   GIRTDHLIVGPKKGRDGDSIKWWEETGARLEGMKTHLAIGAWLYGKDPNTQLSHPEHTT
FT                   VYSQMASLLRQPYMWVAKDGKRFIDESQAPLWHNTGPAVERVGNGYFAVFDDNMREYMK
FT                   TDGIDISHSDWVRVGHKLDLLDEGIEVGQKEGWLVKSNTIEGLAKKMGIDVATFKQTVV
FT                   DANRYAINGVDEEFPKNRKYVRSMDKPPYFAVKGQNATLITLGGPTTDTDMQVLREKDM
FT                   KPVGGLYVVGCEVGGVYGDSYNLTLEGMASSFAINSGRFAAEHIAQKMKL"
FT   sig_peptide     complement(353379..353438)
FT                   /locus_tag="Ssed_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            353807..355450
FT                   /locus_tag="Ssed_0299"
FT   CDS_pept        353807..355450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0299"
FT                   /product="sigma-54 dependent transcriptional regulator, fis
FT                   family"
FT                   /note="KEGG: mxa:MXAN_5879 sigma-54 dependent
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34912"
FT                   /db_xref="GOA:A8FPY9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010523"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPY9"
FT                   /protein_id="ABV34912.1"
FT                   /translation="MLINDIDPKDFLEFVPEEGIIKLKDQRMLLFDAVALGLLRKELID
FT                   TFGHFAARSILTRFGYAHGWRTAELLRSEYPTIFSQDEGGSYLHMLFGLTRTCDFNHSD
FT                   NLASGFSMQVCWDNSYEAEQHHLLFGVAEEPICWTLTGFASGYESCKQEREVYFIEDKC
FT                   RGAGDPFCRIVGKFREDWGDELEAHQPFYSMESADTLLKGLTQKLKRTELDLKRQQEQL
FT                   SLYNANLHNISGLVTRSNEMKRIVELARRIAKVDSSVVVSGESGVGKERVSRFIHDHSS
FT                   RASGPFVAVNCGALTETLLESELFGHKKGAFTGADRDHIGLFEQANEGTLFLDEIGDIS
FT                   AAMQVKLLRALQEKEIRRVGDSQDRKVNVRIIAATHRNLSEEVKANRFRADLYYRLCVI
FT                   ELTIPPLRDRAEDILFIAKVILEQVNKDMNRNVIGFSPKASELLLSYGWPGNVRELQNV
FT                   VERSVALCMGQEITPGDFPETMTQNPVLKSQLSTPTLSLEEMEMEYILSVLKSCGGNKT
FT                   LAMEKLKIGKTTLYRKLNDYRKLSEELVTA"
FT   gene            complement(355662..356309)
FT                   /locus_tag="Ssed_0300"
FT   CDS_pept        complement(355662..356309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34913"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ0"
FT                   /protein_id="ABV34913.1"
FT                   /translation="MKKYISIAIIATSLLLTGCQSAYYGAMEKVGYHKRDIMVDRVEDA
FT                   KESQEDAQKQFSSALEEMQALLNHDGGDLEGAYNKAKDEYESAQDAADDVTKRIDKVED
FT                   VAEALFDEWQSEIGEISKASLRRNSEAKLRETKRSYNQLVKSMRRAESKMPPVLTAMKD
FT                   NMLYLKHNLNAQAIGAIKGEFTSLQTDISGLIKEMNKSIDESNKFIASLEGN"
FT   sig_peptide     complement(356229..356309)
FT                   /locus_tag="Ssed_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.402 at
FT                   residue 27"
FT   gene            complement(356351..356578)
FT                   /locus_tag="Ssed_0301"
FT   CDS_pept        complement(356351..356578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34914"
FT                   /db_xref="GOA:A8FPZ1"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ1"
FT                   /protein_id="ABV34914.1"
FT                   /translation="MSQQGSAGNVIAAIASFFFAGLGQLVQGRILAAIIFCLATYASYG
FT                   IATFTFGIFLVVALPLHLWCIIDAARYKAD"
FT   gene            356728..357624
FT                   /locus_tag="Ssed_0302"
FT   CDS_pept        356728..357624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0302"
FT                   /product="putative ribonuclease BN"
FT                   /note="KEGG: slo:Shew_3545 putative ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34915"
FT                   /db_xref="GOA:A8FPZ2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPZ2"
FT                   /protein_id="ABV34915.1"
FT                   /translation="MIHLKQRLAEDQINIRAGHLAYVTLLSLVPMVAVTMSMLSAFPVF
FT                   SGIRGQIEGFIYNNFLPAAGDTVQVYINEFVSNASKGTAVGIAALMVVAIMLISAIDKA
FT                   LNNIWRTTEKRSMVVSFSMYWMVLTLGPVLMGASLVATSYVVSLKVFNGSDLSGVVPVL
FT                   VERLPMFFSVATFLLIYMVVPNIKVKFFHALLGAIVAALLFEFGKKGFAIYLTKFPTYE
FT                   AIYGALATIPILFMWVYLSWIIVLLGAEITAAMPEYLDKRQSGKDEESEKKAEAHDPQI
FT                   SFSISTAVNESKKENRQ"
FT   gene            357624..358577
FT                   /locus_tag="Ssed_0303"
FT   CDS_pept        357624..358577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0303"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="KEGG: slo:Shew_3544 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34916"
FT                   /db_xref="GOA:A8FPZ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ3"
FT                   /protein_id="ABV34916.1"
FT                   /translation="MSSHLPAFIRRDWLDVGDGHVLHLAQHGNPDGIPLLFLHGGPGGG
FT                   CAVEDLRLFDRDTFHIFLLDQRGAGRSKPHGELKHNDLLHLLGDIERVRLWLNIPAWCV
FT                   VGGSFGATLGFIYSCLYPQRVLSQVLWGLFIPNEEGANWLYGNQGAATLFPQDYLEFTA
FT                   LAPFSAKIDTLFKRYQSGFLDPDVDTRLEYVRGWLKWELALALPGAELPESGTPLAKSL
FT                   AEIELHYASQQYFGAYALMREMACGIKADTVILQGEMDWVCPSVIVEKFLEEFGSGDMK
FT                   YTLIKGGYHALANDKMFLEVVYAVQEMANNMREIDK"
FT   gene            358574..359143
FT                   /locus_tag="Ssed_0304"
FT   CDS_pept        358574..359143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34917"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ4"
FT                   /protein_id="ABV34917.1"
FT                   /translation="MKKLIIAGLVTMLSACAATDKSDTTASATIAPERVTLGGMTNEDA
FT                   AKTLFDALIKKNYLATMASPSRIALQFDDNQFVLQPSINPDGIDRIMMNRFYAVHPKLV
FT                   GSQDLLILIGTLNHKLNFAKFTLRENGAIIQVQGAATFVNTIELEEIRRFMLWTDEGLR
FT                   QVGHSLPKGSEQLIKPIPVMQQSRSL"
FT   sig_peptide     358574..358627
FT                   /locus_tag="Ssed_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 18"
FT   gene            359212..359649
FT                   /locus_tag="Ssed_0305"
FT   CDS_pept        359212..359649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0305"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="KEGG: slo:Shew_3542 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34918"
FT                   /db_xref="GOA:A8FPZ5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPZ5"
FT                   /protein_id="ABV34918.1"
FT                   /translation="MIALIQRVTQAKVDVDGKTIGAIDKGLLVLLGVEREDDSFKMEKL
FT                   ANKVMSYRVFSDENGKMNLNVSQAGGALLVVSQFTLAADTGRGLRPSFSGAGTPDQAKV
FT                   LYEEFVAFCRAKGMPTQTGEFAADMQVSLVNDGPVTFNLQV"
FT   gene            359652..360125
FT                   /locus_tag="Ssed_0306"
FT   CDS_pept        359652..360125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0306"
FT                   /product="thioesterase domain, putative"
FT                   /note="KEGG: slo:Shew_3541 thioesterase domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34919"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ6"
FT                   /protein_id="ABV34919.1"
FT                   /translation="MTASDERGQQIASLLKELTETWHQTIPVSEFMQISPLGYHDNRLK
FT                   VTAPLSPNINLHQTMFAGSIYTLATLTGWGMLWLQQRLAEVNGDIVLADGHIRYLAPIS
FT                   GAPTAKVSWPDVDLSRLTLGRRVKVKLVVEIYVGDRCCAEFEGIYVSQPVPHT"
FT   gene            360318..360911
FT                   /locus_tag="Ssed_0307"
FT   CDS_pept        360318..360911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0307"
FT                   /product="(acyl-carrier-protein) phosphodiesterase"
FT                   /note="KEGG: slo:Shew_3529 (acyl-carrier-protein)
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34920"
FT                   /db_xref="GOA:A8FPZ7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FPZ7"
FT                   /protein_id="ABV34920.1"
FT                   /translation="MSKVLILKSSILGDYSQSGQLVEHLKQHWEQQGAEISVRDLAAEP
FT                   LPMLDGEIASGLRGGDQLSARQEQALLLSDSLIQELKAHDTIVIAAPMYNFSIPTQLKN
FT                   WIDLVARAGVSFTYTETGPKGLITGKRAVLITTRGGVHKGGASDHVVPYLKTVLGFIGI
FT                   EEVETVYSEALNMGPEASKQGIESAQQALEKIVA"
FT   gene            complement(361077..361397)
FT                   /locus_tag="Ssed_0308"
FT   CDS_pept        complement(361077..361397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0308"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: sbl:Sbal_0322 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34921"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ8"
FT                   /protein_id="ABV34921.1"
FT                   /translation="MLQSLLSKLAGAGPDKRSWELIKQGARVIDVRTPEEFGSGHLPQA
FT                   INVPLSQISTWLIDQDPKQSFVLYCAAGIRAQKACDQLKCSGFPNVINAGSLKDLLSYQ
FT                   AT"
FT   gene            complement(361522..362268)
FT                   /locus_tag="Ssed_0309"
FT   CDS_pept        complement(361522..362268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FPZ9"
FT                   /protein_id="ABV34922.1"
FT                   /translation="MIKHITLALVLTLSSVAGQALAETFTEAEYVAIFNGDNINKQKQA
FT                   IDSLVLAGLSDPKVFDTLHAKFKASLPQAVNNASIDYSAWLLKGLAYSGDEKYLQTFNE
FT                   IIAGDYPGKLKKYAKKSIPTLKQYKSWTPILSDKSQYAASETREVNVIANALRSDELEL
FT                   KRYAAKRMINHSLYAPYLLSVLDSELKDPRLLKHEKLAINTYAYMAKALASSGEPEYKA
FT                   TLEHIAKQSSERKLQKYAKKYLKTYY"
FT   sig_peptide     complement(362200..362268)
FT                   /locus_tag="Ssed_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(362282..363529)
FT                   /locus_tag="Ssed_0310"
FT   CDS_pept        complement(362282..363529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0310"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="KEGG: shn:Shewana3_0326 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34923"
FT                   /db_xref="GOA:A8FQ00"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ00"
FT                   /protein_id="ABV34923.1"
FT                   /translation="MSRRVVITGCGGISSLGHDWPTIAANLKAQKNCVVRFDEWDRYTG
FT                   LNTRLAAPVTDFEKPAHYSRKKVRSMGRVSLMATRASELALIDAGLLDDPIVSSGAMGI
FT                   AYGSSTGSTDPIIAFGDMLKNGDMSGVTATSYIRMMAHTTAVNVGVFFGLKGRVHTTSS
FT                   ACTSGSQGIGYAYEAIKYGQQELMLAGGGEELCATEAVVFDTLFATSTKNDTPELSPSP
FT                   FDKGRDGLVIGEGACTLVLEELEHAQARGAKIYAEIVGFGTNSDGLHVTQPNAGTMEVA
FT                   IRQALKDSQLSPDAIGYVNAHGTATDRGDIAETQATHAVFGASMPISSLKSYTGHTLGA
FT                   CGALEAWVTVEMMNAGWFAPTLNLTEIDPECGELDYIKSDIRHIDTDYVMSNNFAFGGI
FT                   NTSLIFKRWSDTNSTQ"
FT   gene            complement(363567..364292)
FT                   /locus_tag="Ssed_0311"
FT   CDS_pept        complement(363567..364292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0311"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="KEGG: sfr:Sfri_0338 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34924"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ01"
FT                   /protein_id="ABV34924.1"
FT                   /translation="MNKRILITGSSRGIGKAIALQLAEAGYDIALHFHSNREAAELTKQ
FT                   ALLEHGVNVSSLQFDIADREGVKTSIESDIEQHGAYYGVVLNAGINCDTAFPAMTEDEW
FT                   DSVVHTNLDGFYNVIHPTIMPMIQTRLGGRIITMASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVKEIVPMRRMGKPSEIAGLAKFLM
FT                   SEDAAYITRQVISVNGGMI"
FT   gene            complement(364299..364787)
FT                   /locus_tag="Ssed_0312"
FT   CDS_pept        complement(364299..364787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0312"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ"
FT                   /note="KEGG: slo:Shew_3524
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34925"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ02"
FT                   /protein_id="ABV34925.1"
FT                   /translation="MTQEYLLPEPLSQLPVAEVVPHRDPMILIDTLVEHGPDTLLTQTN
FT                   ITKQSPYFDAAIDAVPNYVGIEYMAQSIAALAGLEAKSRGEAIRVGFLLGSRKLKMHRP
FT                   NYTLGESYQTRVTRLYQEESGLAVFDCQVFHGDTLVAEANVNVFQPQDALAYISESQG"
FT   gene            complement(364784..365989)
FT                   /locus_tag="Ssed_0313"
FT   CDS_pept        complement(364784..365989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0313"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="KEGG: shw:Sputw3181_0288 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34926"
FT                   /db_xref="GOA:A8FQ03"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ03"
FT                   /protein_id="ABV34926.1"
FT                   /translation="MKKIMTKIAISHIGLCTPLGQSPEQVLARLVTGDIGAMKLRDDLI
FT                   PQSNTLVGEVNLPLPELPDSLMQFCTRNNQLLLCAAQQVADRVKQAREQYGPERIGIIL
FT                   GTSTSGIAQGEEALKHRAEQDLLPSDYQYSQQELGNGSDFLREYFKTSGPCYTVSTACS
FT                   SSAKVFASARRLLQADLCDLVIVGGSDSLCRLTLNGFNSLESVSKGQCQPFSASRDGIN
FT                   IGEGAALFTLERGDAEIMLAGIGESSDAHHISAPHPEGRGAISAIRAAIDDAGIGVDKI
FT                   SYINLHGTATQKNDAMESRALQQVFGNNIPPCSSTKPLTGHTLGAAGAIEAAFCCLLLT
FT                   SLNTAQALPPQVWDGKQDANDPSLPLVNKGQTADLNYIMSNSFAFGGSNASLIFCRKEA
FT                   LS"
FT   gene            complement(366060..366692)
FT                   /locus_tag="Ssed_0314"
FT   CDS_pept        complement(366060..366692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34927"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ04"
FT                   /protein_id="ABV34927.1"
FT                   /translation="MVQFHNTIPDRLKRGKGICVLICLTMLVSACSQTLQRQTCVALAK
FT                   GVSYCLAPIPSDNKARSATQQVAINVNDSRHELLSHLELDREKLTLVGLAPLGQALFTL
FT                   VFDGASLNSQQSMLLGDEFKAEYLLALIQLIYWPLEDVNAHLQGATLTSPECDAPRCRR
FT                   IYATGNDTKADQQESILKIRFDKREPWKAEVELAIPQANFELKITPV"
FT   sig_peptide     complement(366594..366692)
FT                   /locus_tag="Ssed_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.630 at
FT                   residue 33"
FT   gene            complement(366721..367983)
FT                   /locus_tag="Ssed_0315"
FT   CDS_pept        complement(366721..367983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0315"
FT                   /product="tryptophan halogenase"
FT                   /note="KEGG: slo:Shew_3521 tryptophan halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34928"
FT                   /db_xref="GOA:A8FQ05"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ05"
FT                   /protein_id="ABV34928.1"
FT                   /translation="MPASSSTPETLTDIDVAIIGAGPSGCIAASLLHQQGKRVIVIEKL
FT                   HFPRFSIGESLLPCCMQWLEEANMLDAVNQAGFQFKNGAAFRYKEQYTDFDFSDKFTPG
FT                   PGATFQVERADFDKLLADTAAEQGVDIRYGETVTTVDLIGKPRLTVTDANGEAYLIEAE
FT                   YLLDASGFGRVLPKLLELEKPSTLANRSAIFTHIQDNIGKKEVDDRPFDRNKILISVHP
FT                   QNRDIWYWLIPLSPDRCSLGVVGEPHLMGNSDLDLEVILMDMVNQEPGLKTLLADAEIL
FT                   RECAELKGYSANVSTLATDKFALLGNAGEFLDPVFSSGVTIAMQSASMATKCVVRQLNG
FT                   EKIDWQSEYAKPLMRGVDTFRTYVEAWYDGRFQDVIFYDAPDNKIKQMVCSILAGYAWD
FT                   EANPLVAESEKRLNLIVELCR"
FT   gene            complement(367983..370397)
FT                   /locus_tag="Ssed_0316"
FT   CDS_pept        complement(367983..370397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34929"
FT                   /db_xref="GOA:A8FQ06"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ06"
FT                   /protein_id="ABV34929.1"
FT                   /translation="MIDKLALRLSQYPARLKFALWVMLLCITTLTGIQLWQGGAKIQSD
FT                   ILAMLPKLKEDPLTETALARVEEQLSNTVYIALLAEDKSQAVTAANTLIESLSSDNRDA
FT                   FVDIRSADLNQAQALNHFYFNHRFNLLTQAQASALSSGKLSELLRQAQLQLYNAFGYAN
FT                   SGLIANDPLLLYPDNLQALAPKQRLQVQQGILLGQWSPNETDESSKPAAKVAAIVMAKG
FT                   LGSAFNPNTQELQMAVLQEAFETVESQNKQVAFLKAGALFHASAATKSAKSEVSTLGLA
FT                   SLIGVSLLVWLAFRSVMPLGIALLTITTSLLTAVVMTLLIFSELHLLTLVFGTSLIGIA
FT                   IDYNFHFYCERLAQAEKSANEIIRKIFPAITLALLTSVLAYSGIGLAPFPGMQQVAVFC
FT                   AAGLFGAYITLSLAYPLLASGPLPSGEKPLSMAAAYLTKLNSISRFLNYKIGGVLLALS
FT                   VIISAFGLYQLTSDDDIRNLQQSPESVSDEEQQLRGILSGGTDNQFLLVRGETEEQLLQ
FT                   RLEILSPKLNNAVEKGLIGNAFSLSTYLPSRSKQEDNYQLQGLIYQQNLASIVENLGLD
FT                   DSLISDLAEAYQKAKGSYIDAESFISSDAGKLFKPLWITPTPLQDQYGAIVLLGGITEI
FT                   DKLESFFSKLSYVQLVDRVGEISGVMGQYRQLTLWLLAIAMAIAALIFSTRFGIKLAAL
FT                   VVAVPALSAVLTLSLLGLIGAPLTLFHALALILVFGIGVDYSLFFAESKHQSRGVMMAV
FT                   FMSASSTILAFGLLAFSSTPAIHSFGLTLLLGIGFTFALSPFIQTFTRTFK"
FT   gene            complement(370394..371197)
FT                   /locus_tag="Ssed_0317"
FT   CDS_pept        complement(370394..371197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3684 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34930"
FT                   /db_xref="GOA:A8FQ07"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ07"
FT                   /protein_id="ABV34930.1"
FT                   /translation="MKTRERSYSTWFATGLSRGKSVFGLLLLLSLSTFNVHATQSSNYD
FT                   TLFESSADNKRLQALADRLMIGESASGSFTQYRTLKVLKKPLISHGHFIFDSRLGLVWQ
FT                   QTQPFETTLILKEGELIQIDSAGRRQVSQAGSNQGAAAIAQTMPKLLSALLSGNLSDLS
FT                   EHFNLYLKADDTRNEPQEDEPAHWQLGLIPKDPLLVKAIPQMVLEGGEQVSALILLSNS
FT                   GDSSRIEFEQISKAPLSQEQRLFLSDRQGEDSPKVQPEAKPEPYP"
FT   sig_peptide     complement(371081..371197)
FT                   /locus_tag="Ssed_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 39"
FT   gene            complement(371194..371673)
FT                   /locus_tag="Ssed_0318"
FT   CDS_pept        complement(371194..371673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0318"
FT                   /product="thioesterase superfamily protein"
FT                   /note="KEGG: slo:Shew_3518 thioesterase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34931"
FT                   /db_xref="GOA:A8FQ08"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ08"
FT                   /protein_id="ABV34931.1"
FT                   /translation="MTKLSGKAILTIELEMLIPFHDVDSMGITWHGNYLRYFEIARCQL
FT                   LDKIQYGYREMQASGYSWPIVDLQIKYVQPSTFEQKIKVIASLVEWENRIKINYQVRDV
FT                   VTNQRLTKGYTIQAAVETETNELCFVTPDIFREKIAHLIEKHASQNPVVSEGSGR"
FT   gene            complement(371673..373232)
FT                   /locus_tag="Ssed_0319"
FT   CDS_pept        complement(371673..373232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0319"
FT                   /product="Histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: slo:Shew_3517 histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34932"
FT                   /db_xref="GOA:A8FQ09"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ09"
FT                   /protein_id="ABV34932.1"
FT                   /translation="MTQTNQSNPNEMIVHFGHRALSLEDVVAVAKGAKAKLKESHDYQT
FT                   YIQKGANFIDSLLNEEGVVYGVTTGYGDSCTVTVGLDLVHELPLHLTRFHGCGLGEILS
FT                   PMQARAVMACRLSSLAVGKSGVSYELLQRIENLLNLNIIPVIPEEGSVGASGDLTPLSY
FT                   LAAVLVGERDVIYEGVRQPTADVYAKLNISPLRLRPKEGLALMNGTAVMTALACLAYDR
FT                   AQYLSRLASRITAMASLTLKGNSNHFDDILFAAKPHPGQNQIAAWIREDLNHHEHPRNS
FT                   DRLQDRYSIRCAPHIIGVLQDALPFMRQFIETELNSANDNPIVDAEGEHILHGGHFYGG
FT                   HIAFVMDSMKNTVANIADLIDRQMALVMDPKFNNGLPANLSASTGARRAINHGFKAVQI
FT                   GVSAWTAEALKNTMPASVFSRSTECHNQDKVSMGTIAARDCMRVLQLTEQVAAAALLAM
FT                   TQGINLRISQEELCHSSLTPSVAKTLEQVKADFELLTEDRPLESVLRQTVDKIQHGLWE
FT                   VC"
FT   gene            complement(373233..374936)
FT                   /locus_tag="Ssed_0320"
FT   CDS_pept        complement(373233..374936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0320"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="KEGG: slo:Shew_3516 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34933"
FT                   /db_xref="GOA:A8FQ10"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ10"
FT                   /protein_id="ABV34933.1"
FT                   /translation="MQLALVIPNFNHQAAIEKTLESLAELEFHCYLVDDGSNDETRHLL
FT                   ISLADKYSWITLLHHPFNRGKGAAVTTGLRAAYKDGYSHALQVDADGQHNLDDIPAMVA
FT                   RAEANPKALISGLPQYDESVPKSRFYARYLTHFWVWVETLSFDIQDSMCGFRVYPLAAT
FT                   EKLFLSQALGERMDFDIEVLVRLHWAGTEVIHLPTQVIYPEDGISHFQGLWDNLRISGM
FT                   HTRLFFGMLKRLPQRFIKNNRDTHWSGVAERGSYWGIKLLAASYKLGGHWLCRAIMYPV
FT                   IFYFFLTGRSAREASLTFLKQVKSYDPKQPQLQGNVDWRQSLKHFLAFGNAALDRIDAW
FT                   CDRIQLSQVDFPNRALLADQLAAGQGAVLLVSHLGNLELCRAISVHQKRVKVNVMVLTE
FT                   NAENFNRVLKQLNPDSSLNLIQVTDLGPTTSMLLQQKIEEGELVVIAGDRTSSNTQGRV
FT                   IYAPFMGKQAPFPQGPFILAGLLDCPVYLMFCLREQGRYRVHLETFSNTLKGPRKGRMQ
FT                   RLEDAVNNYSSRLEYYARREPLQWFNFFDFWRKDCEIQRTNFQGKDRTDK"
FT   gene            complement(374936..375313)
FT                   /locus_tag="Ssed_0321"
FT   CDS_pept        complement(374936..375313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0321"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: shn:Shewana3_0337 thioester dehydrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34934"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ11"
FT                   /protein_id="ABV34934.1"
FT                   /translation="MIKSKLPRVLSTDIQVEAVEWRIFIDADLPFFDGHFPEQAVLPGV
FT                   TQLDWAIRMGCEYFNYPADVATLEVLKFQQLMLPNSEVSLKISQNSSKTKLLFSYFDDE
FT                   KRFASGRILLASPALADIENS"
FT   gene            complement(375306..376670)
FT                   /locus_tag="Ssed_0322"
FT   CDS_pept        complement(375306..376670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34935"
FT                   /db_xref="GOA:A8FQ12"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ12"
FT                   /protein_id="ABV34935.1"
FT                   /translation="MTELLKSWLSKGPSSQQLISFNHHDIVNGAAFTSQVTNIHQQLIQ
FT                   SKSQRWLLACESSDLFAVGLCAALLAGKEIILPSNTQTGTLSEITHEFDGVISDQPLCE
FT                   GKTFIMLKRDLHETNNVWPKCDNYGKLVLFTSGSSGHPKAVCKTLEQLDAEVSILENTF
FT                   AKHLPHCSVISTVSHQHIYGLLFKILWPLAASRPFLSDIVEYPETLTYYTSLFPNLCLI
FT                   SSPAQLSRLPESLDNERQLRSPSLVFSSGGPLNFEAAQGIAHCYGRQPIEVFGSTETGG
FT                   VAYRRQTQQDQAWRVFDSIDIRQDDKDGALLLKSPYLENDKWLRCEDKITLLKPGEFQL
FT                   QGRLDRVVKIEEKRLSLVQMEALLESHPLVSQAALLVLDQPRTQLGAVIELSQQGKEQL
FT                   DTEGKLSLNNLFKAHLLTQFERVTLPRRWRYPETVPVNSQGKRLANQLSELFEHD"
FT   gene            complement(376667..377215)
FT                   /locus_tag="Ssed_0323"
FT   CDS_pept        complement(376667..377215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34936"
FT                   /db_xref="GOA:A8FQ13"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ13"
FT                   /protein_id="ABV34936.1"
FT                   /translation="MRLFLQIVTSLLLIGYPLAVYFGLNYLPAGTIAMVLCLFLILRLL
FT                   IQKQQVKSMVLPVLVGIGLTAGSFIAKRHDWLLYYPVVINLSMLLLFGYSLKSGPSMIE
FT                   RLARLKEPDLPDEAIPYLQKVTLIWCGLFVFNGVVALYTARYSSLEIWTLYNGLIAYLL
FT                   IGSLLGGEWLYRTIWLKKS"
FT   gene            complement(377215..377463)
FT                   /locus_tag="Ssed_0324"
FT   CDS_pept        complement(377215..377463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0324"
FT                   /product="phosphopantetheine-binding"
FT                   /note="KEGG: slo:Shew_3512 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34937"
FT                   /db_xref="GOA:A8FQ14"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ14"
FT                   /protein_id="ABV34937.1"
FT                   /translation="MQSREQILEALTQILVDEFEIEAEDITLEASLYQELDLDSIDAVD
FT                   LVIKLQQMTGKKIKPEEFKAVRTVDDVVTAIEGLTKG"
FT   gene            complement(377472..377726)
FT                   /locus_tag="Ssed_0325"
FT   CDS_pept        complement(377472..377726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0325"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: shn:Shewana3_0344 acyl carrier protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34938"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ15"
FT                   /protein_id="ABV34938.1"
FT                   /translation="MSLHNEIKQLIIDCLDLEDVSIDDIETDAALFGEGLGLDSIDALE
FT                   LGLAIKKRFDVKIEANSEATKAHFYSVANLASFIESQRA"
FT   gene            complement(377730..378521)
FT                   /locus_tag="Ssed_0326"
FT   CDS_pept        complement(377730..378521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0326"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: slo:Shew_3510 phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34939"
FT                   /db_xref="GOA:A8FQ16"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ16"
FT                   /protein_id="ABV34939.1"
FT                   /translation="MDNAPAKRLTGIAYIPRWLGGVSCYIVFGLGGLLTSLTILPLLRF
FT                   WPGTREQRVSRVQKAVHIMFRGFVHMLTRAGVIKVTPVNITRLSEARGKVVIMNHPTLV
FT                   DVVVLISLMPNAGCIVKQGIWRNPFMRGVVACAGYIPNRGAELLLLDCKQVLDRGTNLI
FT                   IFPEGTRTVLGTVINDFARGAANIALRTKTDILPVILHTNASGLTKQEAWYEIPRRTIG
FT                   MRVEVGETIDHIRYDTQAGGDAKMARLLTRDLEDHFKKELK"
FT   gene            complement(378514..379230)
FT                   /locus_tag="Ssed_0327"
FT   CDS_pept        complement(378514..379230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34940"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ17"
FT                   /protein_id="ABV34940.1"
FT                   /translation="MQLLFTICSWGAWSPRCQQASDWKRWPETKLAHDSDLPRAPKLAQ
FT                   VPAMQRRRYSALTKMQLEAAFQCDAPQQCRTIFSSRHGELNRTIGLLDNVVNREALSPT
FT                   AFSQSVHNTASGIYSILKGNRSASTSIAAGSETLYQALVEAYAQLHEDPTPLLFVFGDE
FT                   PVPQVYSQFTDEPELPLSMAFVLTLTAPEPGQPQLTIGNLTSADDLSYGELLHSLATKQ
FT                   PTSGTLSKHHWQLSFG"
FT   gene            complement(379475..380344)
FT                   /locus_tag="Ssed_0328"
FT   CDS_pept        complement(379475..380344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34941"
FT                   /db_xref="GOA:A8FQ18"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ18"
FT                   /protein_id="ABV34941.1"
FT                   /translation="MQVSQEDRIAPQEKSAGANTIAIVALAVVVLISGGAYYYFSDTAE
FT                   LQPQERAAVEIPDVLPEEPLVTIADIPEPEIEAVVEPVIEVVETPQPEIEPLPTLEESD
FT                   SFVHDKTVVMADGMAIEPMLVEKDLVRHFVVFVDNLAQGELARKVSPLKGPERVFTVSE
FT                   ITNKTYLNPDSYHRYDLYADFVANLNEVQLADTYKELTPLLSEAFEELGYGDMSFNERM
FT                   LEAIDIMLAAPIIEQPIELDGVSVNYQFVDPQLEALPNAQKLLVRMGPENSKKVKAALR
FT                   RLKKHLAD"
FT   gene            complement(380531..382606)
FT                   /locus_tag="Ssed_0329"
FT   CDS_pept        complement(380531..382606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0329"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: shw:Sputw3181_0304 ATP-dependent DNA helicase
FT                   RecG"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34942"
FT                   /db_xref="GOA:A8FQ19"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ19"
FT                   /protein_id="ABV34942.1"
FT                   /translation="MNRLDLVPVTELKGVAKKMAERLAKLGIHTVQDLLFHLPLRYEDR
FT                   TQIYPIASLYPGNYGTIEAVIQSSQIIQGRKRMLTCTVRDDTGSLTLRFFNFSVAQKNG
FT                   LENGLTIRAYGEIRRGKHQAEIIHPEYKLVQTNSDLPLSDTLTPVYPTTEGLKQASWIK
FT                   LTEQALALLEEGGLQELIPPELQPNNLSLKAALMLLHRPHNGVNLFELEQGTHPAQQRL
FT                   IQEELLAHNLSMLKLRQRSNRDKAVLMPASGQLLNPFLKSLPFKPTGAQQRVGADISTD
FT                   LEKPFPMMRLVQGDVGSGKTIVAALAALQAIENGYQVAMMAPTELLAEQHAENFTQWFE
FT                   PLGLKVGWLAGKLKGKARTQSLMDIESGEANMVIGTHAIFQEKVTFNKLALIIIDEQHR
FT                   FGVHQRLGLREKGIAQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVAT
FT                   VAVSDSRRNEVIERVRQAATNDGRQAYWVCTLIEESEVLECQAAEDTAEELRLMLTELK
FT                   VGLVHGRMKSAEKQAIMAEFKAGNLNLLVATTVIEVGVDVPNASLMIIENPERLGLAQL
FT                   HQLRGRVGRGAVASHCVLMYKAPLSPSATKRLGVLRDSNDGFIIAQKDLEIRGPGEVLG
FT                   TKQTGIADMKIADLIRDQALIPHIQKLAVHLMQQAPDNVDGIVQRWLGDREQFVQA"
FT   gene            complement(382787..383719)
FT                   /locus_tag="Ssed_0330"
FT   CDS_pept        complement(382787..383719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0330"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="KEGG: sbl:Sbal_0350 Na+/Ca+ antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34943"
FT                   /db_xref="GOA:A8FQ20"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ20"
FT                   /protein_id="ABV34943.1"
FT                   /translation="MLILLSIIGGFLILTLGAEALVRGASAIALRLGIAPLVIGLTIVA
FT                   FGTSAPELAVSLKSALAGKSGIALGNVIGSNIANIGLILAITALIRPIQVQSQMVRRDI
FT                   PIMIVASLLFWGLLLDGGLSFWDGALLTTLLVGYLGFSYISSRNEGNSEEIDERPQSPL
FT                   LSVVLIILGITMLVTGGILFVDGAVELAKTLGISEVIIGLTIVAIGTSMPELVTSVVAA
FT                   RKGESDIAIGNIVGSNLFNILGILGITALIHPIAAGGVQSLDLMVMLLLAILILPFAWS
FT                   GFRIGRREGGILLAGYISYIGYLVAQATA"
FT   sig_peptide     complement(383657..383719)
FT                   /locus_tag="Ssed_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.479 at
FT                   residue 21"
FT   gene            complement(383891..385558)
FT                   /locus_tag="Ssed_0331"
FT   CDS_pept        complement(383891..385558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0331"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="KEGG: slo:Shew_3502 AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34944"
FT                   /db_xref="GOA:A8FQ21"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ21"
FT                   /protein_id="ABV34944.1"
FT                   /translation="MESLMESTIKTPVEMLAHWVDKLGNNTYLRQPINGQYKDFSWVEV
FT                   QQKMQQIAGALRHLGLKPGDKVAVLSKNCAEWFITDLALMHGGYISVPIYPTANADTIR
FT                   YVLEHSEAKAIFIGKLDYWADQEAGVGGDILRMAMPYDTMPAQYQWDSLLEMGQPLIDA
FT                   PFATPDQTMTLIYTSGSTGKPKGAILNFASYGWTCKAVVRDLKTDIEDRLISYLPLAHI
FT                   TERVAMEGSSFYSGSSVAFVESLDSFVTDVQRARPTVFFSVPRLWSLFQQNIIEKIGYK
FT                   KLNFLLKVPILNNIVKKKIHEGLGLEHCHLLGSGSAPIPPSLIAWYHKIGLNISEAWGM
FT                   TENSAYSIINYPFDPAKIGTVGRAIEGCSIKQTESGELLVKSPGLMTGYYKQPEMTAAC
FT                   FDPDGYFHTGDLCEIDNDGCVTITGRVKDNFKTSKGKYVAPVPIERKLAQDPHIELLCV
FT                   IGSGLPHPIALVQLSEGASLQPREEVRTSLKATLDSINPNLESHETLDAIIVVSEPWDV
FT                   DNDVLTPTLKIKRHVLEKRFSERVDGIRGGKVRWEEEL"
FT   gene            complement(385804..386499)
FT                   /locus_tag="Ssed_0332"
FT   CDS_pept        complement(385804..386499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0332"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="KEGG: slo:Shew_3501 tRNA
FT                   guanosine-2'-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34945"
FT                   /db_xref="GOA:A8FQ22"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ22"
FT                   /protein_id="ABV34945.1"
FT                   /translation="MSPERFARINEMLDNRQPDLTLCLDKVHKTNNIAAVIRTADAVGI
FT                   HQVHAIWPDLDMRVSGNTASGSQQWVKTIRHDHMDEAQTQFRAQGMQILATNFSEDAVD
FT                   FREIDYTRPTAIILGNERDGVSPEGIAAADQHIIIPMIGMVQSLNVSVASALIMYEAQR
FT                   QREAAGMYGQRRLDEDYCQVKLFEQGHPIYAKACRRKSIPYPKVDALGQIVADAAWWER
FT                   MRSPQKAVK"
FT   gene            complement(386567..386950)
FT                   /locus_tag="Ssed_0333"
FT   CDS_pept        complement(386567..386950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0333"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="KEGG: slo:Shew_3500 putative endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34946"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ23"
FT                   /protein_id="ABV34946.1"
FT                   /translation="MAEKIIIATDKAPQAIGTYSQAVRVGSTVYLSGQIPLNPETMQMV
FT                   SDEFEAQVVQVFENLTAVCEAAGGSLSDIVKLNIFMTDLSHFATVNEIMERYFSQPYPA
FT                   RAAIGVKQLPKDSLVEMDGVMEI"
FT   gene            complement(387040..389145)
FT                   /locus_tag="Ssed_0334"
FT   CDS_pept        complement(387040..389145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0334"
FT                   /product="GTP diphosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: slo:Shew_3499 (p)ppGpp synthetase I,
FT                   SpoT/RelA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34947"
FT                   /db_xref="GOA:A8FQ24"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ24"
FT                   /protein_id="ABV34947.1"
FT                   /translation="MYLFEGLKESASGYLEPDQVELLKQAYQVARDAHEGQMRTSGEPY
FT                   ITHPVAVARILADMRLDHETLMAALLHDTIEDTPVTKEELAEIFSESIAELVEGVSKLD
FT                   KLKFRDKKEAQAENFRKMMMAMTQDIRVILIKLADRTHNMRTLGALRPDKRRRIARETL
FT                   EIYAPIANRLGIHNIKIELEDLGFQAYYPMRYRVLKEVVKAARGNRKELIQSIEAAVHT
FT                   RLEDTGLQGTVKGREKNLYSIYNKMRSKELQFQEVMDIYAFRVIVDSIDTCYRVMGAMH
FT                   GLYKPRPGRFKDYIAIPKANGYQSLHTSLFGPHAVPVEIQIRTEDMDQMADKGVAAHWV
FT                   YKKGSSAEQGTTTQVRARKWMQSLLELQQSASTSFEFVENFKTELFPEEIYVFTPEGRI
FT                   LELPVGATPVDFAYEVHTDVGNTCVGARVNRQAYPLSQPLISGQTVEIITAKGARPNAA
FT                   WLNFVVTGKARAKIRQILKSLKEVDAVALGKRLLNHALGETKLDTISAEQIDSVVNDTK
FT                   HNTLDELLADIGLGNAMSIVIAQRLRGDQIEQHEDKDSNMMPIRGAEGMLVTFANCCRP
FT                   IPGDAVIAHVSPGKGLVVHMESCANIRGYQGEPDKYIPVQWDSAEGVEYQANLRVEIVN
FT                   HQGALAKITSIVAAEGANIHNLSTEERDGRVFLINLRVSVRDRIHLANVMRRIRVLPEV
FT                   LRTSRNR"
FT   gene            complement(389159..389443)
FT                   /locus_tag="Ssed_0335"
FT   CDS_pept        complement(389159..389443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0335"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="KEGG: slo:Shew_3498 DNA-directed RNA polymerase,
FT                   omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34948"
FT                   /db_xref="GOA:A8FQ25"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ25"
FT                   /protein_id="ABV34948.1"
FT                   /translation="MARVTVEDAVNQIGNRFDMILVAARRARQIAVQGKDPMVEEENDK
FT                   PTVIALREIELGLVTADTLDADERQTVREREAAEIAAVAAIAEGRNNVI"
FT   gene            complement(389500..390123)
FT                   /locus_tag="Ssed_0336"
FT   CDS_pept        complement(389500..390123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0336"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="KEGG: shm:Shewmr7_0330 guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34949"
FT                   /db_xref="GOA:A8FQ26"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ26"
FT                   /protein_id="ABV34949.1"
FT                   /translation="MTARGNLFIVSAPSGAGKSSLISALLKDKPTDKQVSVSHTTRQPR
FT                   PGEVNGQHYHFVTVEEFKALIEENAFFEWAEVFGNYYGTSRRVIEQTLNEGIDVFLDID
FT                   WQGAQQVKKLMPESIGVFILPPSRAELERRLAGRGQDSNEIIAGRMAQAASEISHYAEY
FT                   DFIIINDDFDTALADLIAIIRSQRLTGAGQIHAQNDMIKDLLAD"
FT   gene            390490..391557
FT                   /locus_tag="Ssed_0337"
FT   CDS_pept        390490..391557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34950"
FT                   /db_xref="GOA:A8FQ27"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ27"
FT                   /protein_id="ABV34950.1"
FT                   /translation="MQYRSLFCVRGRDNGPRFALISALAYLILLLGFIFIGASSALIII
FT                   GLFLTPLLGLSGLRRMRDAARPAWLLGLSFIPLLFFVLSLVYGDSLSFSASCVVFATLI
FT                   TGFLAMQRSASKNSHYHQGYSGPAAMTAGGKGRKRVEPTLDGSAAPVGGHISDNMSEQV
FT                   EEPESYEETGRGFDGISLEQWSSWAKQNRRLLLASVGGLSCMILIAGVWSLFSGAAGDE
FT                   DVAQEPEVSAPQIIVKRDEVKLPDGFSLILEHDLLVMRWLGETEEPGTIWSLATAQGDK
FT                   TCAHLIFNNGTRYRPVTVEQMPDTGIEARFSPLDTESIISDIARRGSVKLCGYDFSLKG
FT                   SQSALAKSGSFIPYL"
FT   sig_peptide     390490..390615
FT                   /locus_tag="Ssed_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.589 at
FT                   residue 42"
FT   gene            391663..392631
FT                   /locus_tag="Ssed_0338"
FT   CDS_pept        391663..392631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34951"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ28"
FT                   /protein_id="ABV34951.1"
FT                   /translation="MTLTAIMNENRPLTLVIMAAGLGSRFGGDKQLAALGPNGETMLEL
FT                   STISAYKAGFTQVVLVIRPELEAQLESLFCERVKPQVSSEFQYHFCYQKIDDLPAEALT
FT                   HFDTFDHRLKPWGTAHALWCTRHKVKGLMAVINADDFYGDTAFELLAQGLRNRPQEWML
FT                   VAYPLHLTLSEHGGVNRGVCRVDQGVLQGVAEWTDIRQEPQGLVGLCDGESGNLKSSTP
FT                   VSMTCWGFSAAIFSVLEDALNQFIVEHGHEQRAECYLPTVIQHHMDSAKLNKQPNNEQE
FT                   ARVIRVETAQEPWFGVTYPQDVAWVQNKLNELVNKKNGVVA"
FT   gene            392628..393704
FT                   /locus_tag="Ssed_0339"
FT   CDS_pept        392628..393704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0339"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="KEGG: shn:Shewana3_3807 aminoglycoside
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34952"
FT                   /db_xref="GOA:A8FQ29"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ29"
FT                   /protein_id="ABV34952.1"
FT                   /translation="MIDFIRQSVLPFYGIPSADTSVSPLGNGHINDTFLVRWSQGELVL
FT                   QKLNTQVFKTPNALVENADKIAQYLLNKKTRGAYSLSVVEPIRTQDGKLAVDLGEQGFW
FT                   RAINYLPHSHSIDVVSTEDEAFAAAKAFGHFSSALSSLDATELADVIAQFHHLPGRIEQ
FT                   LQEAVAKDAKARVSTCREWVDFALSQQSLLKELNEISLKLPLRTCHNDTKINNMLFDKR
FT                   DMSSLAIIDLDTCMKGHLMYDFGDMVRTFCSPEEEDSRALENVRVRESVFAAICRGYLS
FT                   ELGDVLSREERASLWLGARVICLMIGVRFLTDHLNGDVYFHIHHENHNLERAANQFTLY
FT                   KSLLDQEKSLTSYLNVSG"
FT   gene            complement(394139..395614)
FT                   /locus_tag="Ssed_0340"
FT   CDS_pept        complement(394139..395614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA1406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34953"
FT                   /db_xref="GOA:A8FQ30"
FT                   /db_xref="InterPro:IPR021794"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ30"
FT                   /protein_id="ABV34953.1"
FT                   /translation="MSENRQEGSVNSELSYQQAHKPASDFETREAYLNNELIIMRFRRW
FT                   RLHLPFRDFGIEPEDLVPALAATIGKVVMVTAMAAAFAVQFGLTPEFVAENVRYELLIA
FT                   GVLFVILFSALLNPNTNLAGTHGPMIPLIPLIAAAGGHPLALGIMVGLFGLLLSFSKGG
FT                   SKLVKLTGEGVRGGLLIYLGAVGLIGQITKLELWSGSIGQGAVSFGVILATIVIYAYLA
FT                   KIHKRWLAIPLCSLIAGLVAFAMGTPFEFVTEPGLPHFSPSYWWGESTGWQLGWPSISH
FT                   YVAVIPFAILAVAMWSPDFLGHRVFQELNYPKKAEGVLMNVDDTMTVCSIRQIVGSILG
FT                   GGNLASSWGTYMIPAAIAKRPIPGGAVLTGIMCVLAAVIGYPMDLAMWEPVLRVALLVG
FT                   VFLPLLEAGMQMVRDTQDSQAAGICLFSCAFVNPVFGWALTMLLDNMGFIGDKTRSEKL
FT                   SLMDKLIIPLTAFIICVGSLALVGQLPGIPALL"
FT   gene            395907..396092
FT                   /locus_tag="Ssed_0341"
FT   CDS_pept        395907..396092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34954"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ31"
FT                   /protein_id="ABV34954.1"
FT                   /translation="MPPSLVASALDVEVVAHNHRSDIFQPGVLTEMDAFISARETLGGV
FT                   SFSYWGPVSAGADVGQ"
FT   gene            complement(396516..396896)
FT                   /locus_tag="Ssed_0342"
FT   CDS_pept        complement(396516..396896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0342"
FT                   /product="tetraheme cytochrome c"
FT                   /note="KEGG: slo:Shew_2279 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34955"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ32"
FT                   /protein_id="ABV34955.1"
FT                   /translation="MFKTLNTLLLACLLVAPAASAVQMKDYHKEIMTNDNGKVECAACH
FT                   GDAKRKTIPAASQCESCHGSSDDMAMQTARPEDAGHDVEPNPHDSLHYGTDLPCTYCHQ
FT                   EHKESTVYCNQCHEFEYPDMKR"
FT   sig_peptide     complement(396831..396896)
FT                   /locus_tag="Ssed_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 22"
FT   gene            complement(396941..398584)
FT                   /locus_tag="Ssed_0343"
FT   CDS_pept        complement(396941..398584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0343"
FT                   /product="phenylalanine/histidine ammonia-lyase"
FT                   /note="KEGG: slo:Shew_2280 phenylalanine/histidine
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34956"
FT                   /db_xref="GOA:A8FQ33"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ33"
FT                   /protein_id="ABV34956.1"
FT                   /translation="MMNSKQVVMASLALSLMSGSALAMDSVVLDGQHMTQAQAWAIADG
FT                   AKVKIGDKAAKNLVKAHELLMDAARLGKPVYGLTVGVGLNKDQKLFTADGKLSKAVMEA
FT                   SKSFNYSTLRAHSAAMGEAVPVRLTRVALAVRLNTILSGQTGVQPYVAELYQQYLNKGI
FT                   TPVIPSKGTVGEADILMASHVGLAMIGEWDVFYKGKRVSSVKAMKDAGVKPLKPIGKDA
FT                   LSILSNNSVAVAYAMKGYRDASHLMTVSPTVFSLSLEGLNGNVSPFLPQTNDIRPFPYI
FT                   KEATSEILNQLDGSYLWQLNDQRSLQDPLSYRTTAYTFAGAKKALADLGEVIDVQINHS
FT                   DDNPGVILNASKDYTQHPQVAKYLIEGKGGVFPTTNFEPLPVALAVQGLSVALTHVSHN
FT                   SVMRTVHLSDSHFTKLSRFLGAPGNNGHAFGAIQKNFVDMQVRNKHLASPVSFDGIPVA
FT                   GNIEDTFTNLKLASDNLIQIVDNTNYIYGLELLHSTQAIDLRKLTNPNLDMGKATKAMY
FT                   KNYRKQVPFVELDRPFTPDIKASYDFIAQY"
FT   sig_peptide     complement(398513..398584)
FT                   /locus_tag="Ssed_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(398611..400170)
FT                   /locus_tag="Ssed_0344"
FT   CDS_pept        complement(398611..400170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0344"
FT                   /product="flavocytochrome c flavin subunit, putative"
FT                   /note="KEGG: son:SO3058 flavocytochrome c flavin subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34957"
FT                   /db_xref="GOA:A8FQ34"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010960"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ34"
FT                   /protein_id="ABV34957.1"
FT                   /translation="MSDKQPISLRRRQLITGGAALAVTGLGASLAKPVSAACVPAEEVK
FT                   FDEVVDIIVVGSGFAGMSAALQAREAGASVMVVDKMPVFGGNSTINGGAMAVAGSPLQQ
FT                   QNGIKDSVDTMVADMLEAGRGMNDVEMLKLVCNGTAESCQWLTDYGVKWKPFVQHFGGH
FT                   SIPRVLQTVESSGAGIIRPLVKAAKKRGIDMRTQTKLESFIEDDQGRVTGIEVKANYFF
FT                   PKERSGVTRRYGARKGIIMATGGFGRDIEYRKMQQPKLTKELDSTNHPGANADALKQMM
FT                   LIGANPIHLDQIQLGPWASPDEKGFGTASQFNTIATYPRGIVVDARTGKRFFNELADRK
FT                   ARADAIMTRRDAQGQPVYPIGFTNAEGASKAQTLDWGLKYNVIKKADTLEELAKIYGIP
FT                   ADALKAQVESWNKAVDTGEDSEFGRPMQKAMKLEQGPWYAVRMWPKVHYCMGGVKVNTR
FT                   SEVLHLVTYKPIAGLFAAGEATGGIHGASRLGACAVAEGVVTGRNAGQMCAASKSIVLK
FT                   HV"
FT   sig_peptide     complement(400075..400170)
FT                   /locus_tag="Ssed_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.920 at
FT                   residue 32"
FT   gene            complement(400647..401804)
FT                   /locus_tag="Ssed_0345"
FT   CDS_pept        complement(400647..401804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34958"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ35"
FT                   /protein_id="ABV34958.1"
FT                   /translation="MMKKSTQLMLSAVATAVAMAGSIGCAQAQEDGINIGGSVRVNYGL
FT                   KLYDDSSKDKGGDLVFDTATLVMKGKKGDFGLAAEYRFTKSTNFIKYGYGYYDIDPDWQ
FT                   LQFGINKVPFGNPGFISNSWWFGLPYYLGFEDDHDIGIKAVYEKNGWHTDLAFYKGAEY
FT                   GPSEIKRYATDLFTGTIDTTYDGIDNGTEYNNEETNQLNLRQTYTMEHEGGSTTFGASV
FT                   EAGQIYNNKTGNNGDRYAVAAHMETLYNGWKLQLQAMQYEYDAADAADDNKIGVSVVNW
FT                   QYEIASKGQVYSLNLAKTMPTSWGSVKCYNDFGLMTPDVADSSYDDSIQNVTGCAVSAG
FT                   PTYTMIDFIMGKNMTFSTKNNDHVGLPEFGDDLDKRININFGYYF"
FT   sig_peptide     complement(401718..401804)
FT                   /locus_tag="Ssed_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            402419..403975
FT                   /locus_tag="Ssed_0346"
FT   CDS_pept        402419..403975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0346"
FT                   /product="formate hydrogenlyase transcriptional activator,
FT                   putative"
FT                   /note="KEGG: son:SO3059 formate hydrogenlyase
FT                   transcriptional activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34959"
FT                   /db_xref="GOA:A8FQ36"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ36"
FT                   /protein_id="ABV34959.1"
FT                   /translation="MIFNGSHSEESMEKFYYKATQCLCSSLQLEESLQSYFDYIKSHLP
FT                   IDGIYLNIYRPDFSDIQFIAQVNDQQSSTLDRRIPISNEMCEALQDLDRPIIRIVNDIE
FT                   LDTVTQFVAPQVIPEIKSVILLRMVSGNTHLGVVGFYAKQAGVFRPRHVDMLEPHMQTF
FT                   SLITAFNLKGRNLLRANEALAEQNQSLKRTLNICNGVVGAHSGLKHVMQQVESIAKLNT
FT                   TVLMLGETGCGKEVIANAIHELSLRANKPFIKVNCGAIPESLIDSEMFGYERGAFTGAE
FT                   SRKAGYFEQANGGTIFLDEIGELPLSVQVRLLRVLQNSTITRVGGHDSVQLDIRVIAAT
FT                   HRNLKAMVSTGEFREDLWYRLAIFPIEIPSLRQRRTDIPLLVQHFIEMLSAKFNQDQLP
FT                   RVAPEQLAILSQYHWPGNVRELINVLERAIIQHPKGPLNFDFLVPEVKAEHKEKRGETI
FT                   IVDPSHATDKLVPLETMTRKYIEHALRVTGGKLYGPGGAAQLLDINPNTMRSKMKKLGI
FT                   C"
FT   gene            complement(403972..404430)
FT                   /locus_tag="Ssed_0347"
FT   CDS_pept        complement(403972..404430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34960"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ37"
FT                   /protein_id="ABV34960.1"
FT                   /translation="MTFIKALGAQWNKGKLAQQLEQALLQEPEIHSLFIGATTVTTVSN
FT                   LIAAIGFREPETQEQELPLTHEFMLTILFDCFRLLMIKQIEHDNLSQAEHLIIQIAKIW
FT                   ATKEMEEKPDNEICLTQYRELQQQILNLTEQLDELNRQRRLQKRNMGR"
FT   gene            complement(404461..405120)
FT                   /locus_tag="Ssed_0348"
FT   CDS_pept        complement(404461..405120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0348"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34961"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ38"
FT                   /protein_id="ABV34961.1"
FT                   /translation="MSSLTENELLEYQGIARILHNVLFNDPTPELIQSFIEHDVAQSWP
FT                   EFTGSARESSGRELLSNYLGQWTTDKQQALKLDYAQLFYGPGEPNAVPWGSVYLSERQL
FT                   LNDKTTLALKAFYQEQGISFELDTNQPVDHIGLFFAVLDQLLTQWAQTEDSEAIERSCM
FT                   ILLQQHLLPWSGRCLELMTEHAKTDFYRGIALLTQAYLEGLIQRLNLVPMTTRLYR"
FT   gene            complement(405205..405840)
FT                   /locus_tag="Ssed_0349"
FT   CDS_pept        complement(405205..405840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0349"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: sfr:Sfri_3127 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34962"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ39"
FT                   /protein_id="ABV34962.1"
FT                   /translation="MSNNIQYGFHVDASKCTGCKTCQVSCKDRKDLPVGINWRRVYEYG
FT                   GGQWTENGDGTVSQNVFAYYMSIGCNHCSEPVCVKACPTGAMHKRREDGLVHVAADLCI
FT                   GCESCARACPYDAPQIDKDRKVMTKCDGCYERLAEGKQPSCVESCPMRAIDFGPMDELK
FT                   AKYPGAISPDVAPLPESSVTTPNLLITPNRHTRPSGATDGEVLNYSEV"
FT   gene            complement(405853..408282)
FT                   /locus_tag="Ssed_0350"
FT   CDS_pept        complement(405853..408282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0350"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family protein"
FT                   /note="KEGG: sfr:Sfri_3128 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34963"
FT                   /db_xref="GOA:A8FQ40"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ40"
FT                   /protein_id="ABV34963.1"
FT                   /translation="MERRSFLKMSAALSCAATVSGCNSSSKDVEVVPPTPPVAGENLNW
FT                   SACLVNCGSNCPVQVFSTDGVITRVESEFTTTDKYGDHDVRACLRGRSLRKRVYAPDRL
FT                   KYPMKRVGPRGSGQFERISWDEALDLVAEKLQGTIDQYGNESIHFTYNSGARYHFSGKQ
FT                   CLYRLMNLKGGYLNAYGDYSWSQIYEAAGQTYGSAGPGWQGSSVSEMQNSDLVLMVGYN
FT                   PSEIRMSGSGEAYDFLMQKQKNKFKTILIDPRYTDSAVGKEDQWLAIRPGTDAALFEAL
FT                   AYEWITTNTVDQAFLDKYCVGYDEKTMPAGVGYEESYKAYILDNTTVGSSIPGVNAKTP
FT                   EWAAAITGIEAHIIVELARELAAARAPFIQIAASLNRQAAGENNTRAGYMLPILLGQLG
FT                   LPGTNCGGLCKGSFLHAPFMPTGSNPVKKAISFFTFTQAIEDGKNMTVLSDGVQGVDTD
FT                   EEGDGKLGTDIKAIINYGGNALINQHSDVRKTEKLLQDESKCEFILVVDNWMTPSAKFA
FT                   DVLLPDVTWLESEDLIYQSYAAGDTATLVQMSSGVDPMFESRPIYEVCVDLAKRMGVEA
FT                   EFTEGKSRKDWLDQFYAESKAATPGLPDKEVMLTQGIYRKYLPDGGYIVLEDFRNDPEA
FT                   NPLGTPSGKIEIYSSRLADKARTWKLKEGDVISALPKYVPTWEGYEDTETKKKYPLQLT
FT                   GYHTKGRAHSSYHNVPWLREVVQDAVWMNPLDANKRGLKTGDKVHIFNDRGTIEVEVKV
FT                   TPRIMVGVTALGQGAWFQPGGDVDKGGCLNVLTTQRTTPVTKGNPQHTNLVEIRKV"
FT   sig_peptide     complement(408202..408282)
FT                   /locus_tag="Ssed_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.462 at
FT                   residue 27"
FT   gene            complement(408323..410329)
FT                   /locus_tag="Ssed_0351"
FT   CDS_pept        complement(408323..410329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0351"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfr:Sfri_3129 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34964"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ41"
FT                   /protein_id="ABV34964.1"
FT                   /translation="MRFKFNLITLSLLAISGAVTGSAMAADFGVNRANTSTVKQETFQC
FT                   KRCPQVDGYTGTVGINAAYIESDDIHSGNAFGTDKDGANASLDADLNYRNGAGYKARFQ
FT                   AHQLGLDNGFAHLEAGKSGRYEITADYQQLTSYQSGDARSQLWYKDGVLTPSEHTQTQE
FT                   LSLQRNKAGLGLSYGRDFYQAYIRYDHENKTGYQSSSIVTPRPVNFGLPVDANTDNLTA
FT                   GLSLSGDNWATDLNYFVSQYKNDIGALSLPYLYDVFAPTPDNEAHQISLSGQYQLSRTV
FT                   MSGRLASGKMIQDDDLIQMSGNPIQNWDGEVETLDGKLSVTSLLSNKLRLGGSVDYSKR
FT                   DNKGSVWEFAQYEVNGITGAFKQNVPLDTERRGLKVNASYRFSSDYRLQAGYDRKEMER
FT                   SHGDREQTNDDVLWAKLNVRALDDIKLKFKASLDNRGGSEYQTSELTSSETNPLLRKYY
FT                   LADRKRTAFEAKFNHTPTSWLSLDMTARYAKDDYDKTQLGLTGSEDYGYDINLGLQLDV
FT                   HLSGYAFAGQQWIDSNQTGSQSFSAPDWSADIEDEFINLGAGFTYTGLLEDKLTLGGDY
FT                   LFANSTSDTLVIYDVVTPQGDYYSFNHSLKLHANYALSEEMALKLAYQYERYYDTDYAQ
FT                   IDVDTVPGLTTLGDLNHNYNAHQVMLSFSYQLR"
FT   sig_peptide     complement(410252..410329)
FT                   /locus_tag="Ssed_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(410345..411298)
FT                   /locus_tag="Ssed_0352"
FT   CDS_pept        complement(410345..411298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0352"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: sfr:Sfri_3130 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34965"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ42"
FT                   /protein_id="ABV34965.1"
FT                   /translation="MMNKCIITKLLCGIFAFACLSLSVQAAPWNQLTGEQLEQKLAEKF
FT                   AQGKYSKKGADSCLMCHKKNDKVMAIFGGVHGNTSQPDSPMAGLQCEACHGPLGKHNKG
FT                   GKEPMIAFGKESKLPAQSQNSVCLGCHNDPKQMAWHSSSHNLDEVACSDCHNIHTDKDP
FT                   VMDQLTVNDTCTSCHTQQKSDMNKRSSHPMKWDQMTCIDCHNPHGSMSESALNHTTVND
FT                   TCYSCHGEKRGPVLWEHAPVTENCANCHNPHGSVNEAMLTHRAPQLCQQCHMDDGHASR
FT                   VVQQGGSDAFGGGKSCLNCHSQIHGSNHPAGSKLQR"
FT   sig_peptide     complement(411218..411298)
FT                   /locus_tag="Ssed_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(412077..413807)
FT                   /locus_tag="Ssed_0353"
FT   CDS_pept        complement(412077..413807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0353"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="KEGG: psp:PSPPH_1251 oligopeptide transporter, OPT
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34966"
FT                   /db_xref="GOA:A8FQ43"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ43"
FT                   /protein_id="ABV34966.1"
FT                   /translation="MPTSNNISQPLSIRALLTGMTLGSLLVLCNLYMALRIGWSINMSV
FT                   LASLLGFVSWKAVETTIGCRAWDPSETNIQQTVASAAGATISAGLVAPIPAYLILTDTQ
FT                   FEYWPMVIWMIAISLLGICVASAIRPAMLNNERLRFPAGIATAEVITDMFSSGRIARHR
FT                   IIALLSAMAITISHRIFIPVSYKIPLGFSIPGQNAMAGTSISAKNLGFIIDPSYMLLAF
FT                   GAIIGTRAAISLSIGCLIAWLGLGPYILGQGWEQAGPVDGNWFSYIIDWLVWPGVAMML
FT                   ASALTTTAITLFKSDRKNRLSLMWGLPEFLLLGTITPVIVFLQVWLFDISWFAAILAVP
FT                   LAFLFAIVAAQVVGETGIPPVGALGKLSQLSFSIISPGSVTTNLMTANVAGGAAGQATD
FT                   LLNDFKAGHILGTNPRHQIFAQAMGILVGCLTSAGIFMLLIPNPAEQLMTEQWPAPGVA
FT                   TWKVIAIALTDGLEAIPQSARYAMFVGIVAATINELLPLIVQEKWHRYLPSMSAMGLAF
FT                   VLPAQVSMMLFIGAILAWGLRRLAPRWSQRFLLAIAAGCIAGESLAGVLGSLWHLLLSK
FT                   "
FT   gene            414104..414796
FT                   /locus_tag="Ssed_0354"
FT   CDS_pept        414104..414796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_0277 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34967"
FT                   /db_xref="GOA:A8FQ44"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ44"
FT                   /protein_id="ABV34967.1"
FT                   /translation="MSKLERESRLLEVARELILEHGMMSFKFTDIAKRAEVSRATLYKY
FT                   FSGKEDVLVSLFVSDAGNTLQMLLDIQADEILNDREKILLSLLAPVASSMEALNRSGTL
FT                   LLSANPGIFMFAGEAHQAKLEQIVAQIRGIVLEFWVIPFKQGHMRVTQEQLEEVMASTF
FT                   PYQRGCVTIPQNVMTVGKQINYPLKKVFENLLKLTEALDWCEEHANVDYEKTLIGIGRH
FT                   KRNEMIAY"
FT   gene            complement(414994..415314)
FT                   /locus_tag="Ssed_0355"
FT   CDS_pept        complement(414994..415314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34968"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ45"
FT                   /protein_id="ABV34968.1"
FT                   /translation="MAGWIEDYISKSLDIHPRVFGQVTIGAVSNYISSSAREYIEEAYS
FT                   ADVEIESFIHVCMCSAVCTMGSKRGDVQNIVVYVIKKAAVKCPLLHPLIESVPQSKLTS
FT                   IV"
FT   gene            complement(415350..415970)
FT                   /locus_tag="Ssed_0356"
FT   CDS_pept        complement(415350..415970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0356"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="KEGG: sfr:Sfri_3126 cytoplasmic chaperone TorD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34969"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ46"
FT                   /protein_id="ABV34969.1"
FT                   /translation="MNKALAEITPILAANMYHDPCDKVLEMYNEHDFSECYPLLTQSNT
FT                   RSEGVALISNYMKQYTSEQLPKLLLDFNQLFIGPGKMKVPLWGSYYLSEDNLLCGPSTQ
FT                   KLQARIDALGIAINTIDGDNQPIDHISLVLRLVEFALDEERSLELKAIVTEHLVPWAYR
FT                   VAELTIEHAKTNFYLGWGLLLKDYLDVLVESNGIIVKEHTLWG"
FT   gene            complement(416026..418128)
FT                   /locus_tag="Ssed_0357"
FT   CDS_pept        complement(416026..418128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34970"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ47"
FT                   /protein_id="ABV34970.1"
FT                   /translation="MNTKLSLVAVLLAGAMVTGCSDDDSETVYVCENGDTVSAPEQCPT
FT                   TPTDPTDPVEPPAVDGPFVHAGRTIIDGAFYSATSPSNEYDPLRDWENTMPAGYKEMRN
FT                   ASYPWGTTVYNSAANGEELWMGTISNGWCVWPYQNIAMPIELTTFESETTGCSVPGTTG
FT                   TPSQIFIYNFRTGAKEVIHESMLTSGGPQFTEAFKPINNTYGFRAAGTAGDLVFVAGHW
FT                   KTTEDKGRLRLFVFNAKERSFVGYRDIVGDTTRRFRTLEHADGTTGFYTIVGAETGMTQ
FT                   YGDGPTQLLRWVGTQDDPFAGGNIKGTDPLTTTGWSKVSTQLDNEQTPDGVQYGMIGDW
FT                   RQFTHTDGTERLIMSASAHPFVYKNGVRSDKFKESVILISDPIPNSGYTVDEQLTFREV
FT                   FGMDQYDPDTKGRWGAKWGTSAINDGYMYFGTYHQGTDAAYKHFAKADPALFTELTGLE
FT                   SAGEADATKVTDVTTTNDAQATDHKLFMINEWRATSIFRIDLKNIDAVSAGDTSKVELL
FT                   YGYETMEVNDGNGWKTTPNLLGKKPTHGEAGMGNPGNVYSWTSIAKDGKLFWGFFDAFS
FT                   GLHDLLFEAYSGEYMLFDGIVFQNPVWKRQMANNPAMWMYDYAKAEMDANGLGAEFIPG
FT                   GDLLMIEADGSARKLTTNGFGNQCSNGIRNVVDIDDKLYFGTSTWCNVGPTSGLEFYQY
FT                   EPSLDK"
FT   sig_peptide     complement(418063..418128)
FT                   /locus_tag="Ssed_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.504 at
FT                   residue 22"
FT   gene            complement(418130..418747)
FT                   /locus_tag="Ssed_0358"
FT   CDS_pept        complement(418130..418747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0358"
FT                   /product="anaerobic dimethyl sulfoxide reductase, subunit
FT                   B"
FT                   /note="KEGG: vpa:VP1448 anaerobic dimethyl sulfoxide
FT                   reductase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34971"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ48"
FT                   /protein_id="ABV34971.1"
FT                   /translation="MQLGFYVDTSICSGCKACMVSCKDKNDLNVGRNFRRVYEYAGGSC
FT                   TDNGNGVFSQSVFAYYTSISCNHCDTPACTKACPTGAMHKRSEDGLVMIHDDICIGCSS
FT                   CEQACPYDAPQLDEARGKMTKCDACIDRLNAGKQPMCVDSCIHRALDFGPIDELRAKYG
FT                   DTAEIAPLPSASITKPNLILRVHPDGQPVGSGAGSVVNPNEV"
FT   gene            complement(418758..421208)
FT                   /locus_tag="Ssed_0359"
FT   CDS_pept        complement(418758..421208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0359"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family protein"
FT                   /note="KEGG: sfr:Sfri_3128 anaerobic dimethyl sulfoxide
FT                   reductase, A subunit, DmsA/YnfE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34972"
FT                   /db_xref="GOA:A8FQ49"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ49"
FT                   /protein_id="ABV34972.1"
FT                   /translation="MERRTFLKFSAAAAAVATVTGCESSSASNPLPAPSEPVLPPVGEG
FT                   ITWGSCATNCWQACPLKVHSKDGVITRIETEGKATDDWDNFDHEIRPCPRGRSMRQKVY
FT                   NHDRLKYPMKRVGRRGSDEFVRISWEEAVSSVASAMEQTYSQYGKNAIFMPLGGGSHDL
FT                   NTGVTQSSVRLLNMAGGCLFFHNDYSAAQYREGSAGMYGYLASNAGDTVGFWNTGSSLR
FT                   SLEDSDLMVCFGYNPMEARLGGAGSGYEYLNVKKKNNFKTYYIDPRFTDTAVTANDEWI
FT                   PIRPGTDAALCEAIAYVLIEDGYADIPFLEQYTHGYDKYQDYITGVTDGTTKTPERAEG
FT                   ICGIPAEKIREIAQAIGAASAPFVTQGFGPQRQGNGENNARAVMMLPLLVGKISGDGTN
FT                   HGGTPGNDGLSHYAMMPADTLQDLMNMKIMDVTIPAASHLDAIEFGMQMKPSTHDVRYS
FT                   NPDLMAADTPLETNVRFLWLASSNMLANQNGDINRADRLLNDESLVDFVVVVEQHMTAS
FT                   AKYADIILPEVSWLEMYDVIQSYNKMDCGSLMYAYGITPAVDPMFECKPAYDICHMIAN
FT                   QLGIGSKFTNGGMTYLDQVRKVFAEFKKSNPWIQGDTFEEFVSFGPQRRPAGEHPNVGK
FT                   IRDFITDPIASPLGTPSGKVEIYSQYFEGKQTQAEGTDEINPLPVYFACDESYEDATAS
FT                   EFPLQCINYHGKHSAHSIHASTPWLNEVLEHHLWLNPIDAGAAGVINGQKVIVESRRGK
FT                   LEITARVTPRIVPGVVAMPQGQWRRMKGDIDVGGCANTLTDSKPSPVAKSFRSNTNRVR
FT                   VYSA"
FT   sig_peptide     complement(421125..421208)
FT                   /locus_tag="Ssed_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 28"
FT   gene            complement(421242..422939)
FT                   /locus_tag="Ssed_0360"
FT   CDS_pept        complement(421242..422939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0360"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3685 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34973"
FT                   /db_xref="InterPro:IPR020016"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ50"
FT                   /protein_id="ABV34973.1"
FT                   /translation="MKAKLTLVALAVLSVNATAANFAVPQDIEKDYACKRCVATEHANT
FT                   VGIITEQRSHLDTQYGASADIKGANYSINAVEAGADNGHLKAAAHLGDFALELAYVNRW
FT                   NLDDNDIGAERQQLSVGAKYQTQLVTAFVKASSEDKQGQRIGSVVDPKPTNYLETIDHT
FT                   TQVMNAGLQLHGDFWNLGVAAFNSEFTDNAGIDADNSAQQASVKAGLNYGSTRLSVSAA
FT                   SGKMIQDEAIEQENSLVPISNFDGEVETLDYSARISSRVAGFKVTGFYSYSDRDNVSGS
FT                   YEFFESINTPIDSSKTRLGVDASYRLGSTKFSAGFEQNDRTRTDSDREETQESEVFGRI
FT                   DYRYQQFNSHIKFISGERTGSEYHIGDDIYQKYYLADRDRVSTELGLGYSQNHYGANLK
FT                   VSIASDEYSNSSALKESDEMSVNVDGFYRFNDQMVLNAYAGTQTIDSLEIHNTTVSDEF
FT                   TYFGFGLDQYQINEDIALGTSYTFSLSGSDTAVDSTEMGDYYQYQHLAEIHMDYRISER
FT                   ISTRFAYSYERNYDTNYANQPIDAINTIDDLNQNYTDHKIGAFFTIKL"
FT   sig_peptide     complement(422880..422939)
FT                   /locus_tag="Ssed_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            complement(422949..423809)
FT                   /locus_tag="Ssed_0361"
FT   CDS_pept        complement(422949..423809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0361"
FT                   /product="decaheme cytochrome c MtrA"
FT                   /note="KEGG: son:SO1777 decaheme cytochrome c MtrA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34974"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020015"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ51"
FT                   /protein_id="ABV34974.1"
FT                   /translation="MRILQKIGLLTAFIAATALSVPSALANKSATPLEQQLVNKFTEAK
FT                   YSKKGADTCLMCHKKSQSVMAIFNTPHGNTNKGPMAGLQCETCHGPQGKHKGKNEPMLT
FT                   FGDELSVEGRNSVCESCHSQEHTPFHDQACSDCHNVHQAELAAEQPQAQCASCHSLQDS
FT                   AQFKRSTHLDTLTCSDCHNPHEEQPLSVNDTCYSCHAEKRGPTLWEHSPVTEDCTTCHN
FT                   PHGSVNDNLLNSRAPQLCQSCHNQAGHPGDVHNSLNGFTQGQSCMNCHSKIHGSNHPSG
FT                   HLFEK"
FT   sig_peptide     complement(423729..423809)
FT                   /locus_tag="Ssed_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 27"
FT   gene            complement(424401..425414)
FT                   /locus_tag="Ssed_0362"
FT   CDS_pept        complement(424401..425414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0362"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: sfr:Sfri_3878 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34975"
FT                   /db_xref="GOA:A8FQ52"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ52"
FT                   /protein_id="ABV34975.1"
FT                   /translation="MYSNHNEIRSKLALLQLAKELGSISKACDMMGYSRDSYYRFKKQY
FT                   ENAGEQGLHNLSRKKSTLKNRVSQEVEDQVIEIALDYPNYGQAKVAELLTARGCTISPS
FT                   GVRTIWLRHNLETKQNRLIALNSRLRQQNELDFNAQHQIEKSCKLQQEEGSLDCQGPGD
FT                   ICVQDTFKIGNIPGLGTVYQHTCMDAYSQYTHAHITLEKSSTISSDFLRTQVLPWYKNQ
FT                   YIPINSILTDRGAEFSGKYSQQFQNLLQQTAINHIQKRAYNGPIVNGIAARFHNLAHSE
FT                   FYAPFLKNNKVSNIETLNENLQKWLKRYNHQYAIAGRYTLGKTAIEVIELSRHLYR"
FT   gene            complement(425452..427050)
FT                   /locus_tag="Ssed_0363"
FT   CDS_pept        complement(425452..427050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0363"
FT                   /product="sodium/sulphate symporter"
FT                   /note="KEGG: sfr:Sfri_3879 sodium/sulphate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34976"
FT                   /db_xref="GOA:A8FQ53"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ53"
FT                   /protein_id="ABV34976.1"
FT                   /translation="MNKKKAHVDPLDMNQYRMEKLPIRSKSKFEQWLEKSGIWIAIAAF
FT                   IYLLVGEPSTFLTSFDPSTLSATASKHFLNVGNVEFSWHGQAMLAIFCAAIILWITEAI
FT                   PNYLTSLIVIITMVLTGVLPEKVAYAQLGHPIMWLNILSFILASMLVASGAAKRFALWF
FT                   ICRFATSATPIFYSFMVINLVLSAFISATTAKAAILMPIFMVIAAVYGASGGDKKNNFG
FT                   RNLVLQNLLQINLCAGAFVTGSGANLLAASLIAGAIGGSFFFADWMIVALPIVICMIIV
FT                   GWLLATKVFFPLSPEEHLPQIEGGMDRLKKELDKMGTISTREIKAIVIFVTILVFWATD
FT                   KHHGISATAIAFIGAIVALSPRIGVVNWNQVDVPWHLLLFSAGAYTLGAGFKQTDLPNL
FT                   AVNFGLEYFGLGDNTPFSVFYIGLTGAMLFSSLVFQSKTMRTMLFVPIAIGIAQRFNYP
FT                   IMSLALPVALLIEHVYVLPFNSKPALLLYSTDQYSLSDTFKFGITMLIIGWIGSIVLGE
FT                   TWFHWLGYTPNGVFW"
FT   gene            427389..428024
FT                   /locus_tag="Ssed_0364"
FT   CDS_pept        427389..428024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34977"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ54"
FT                   /protein_id="ABV34977.1"
FT                   /translation="MSELKIGEISKPRFEFRTFGQDFSVAAERMARLSVPVPEKVWRRE
FT                   SDEIYIMSRTNDLNNTKIRDGKMDVKAYVQTVNGLEQWDPKLKAEFPISKTQLVEEIFP
FT                   AFMVEIPALAKQEYSFEEFISIIDAHPDLQAVKIHKERYGYMVNNTICEVANVLVNGAS
FT                   LVSVNSESVELDDIQRTVSDLRLEGVENINYLQAIKRVIGMKNLPLAN"
FT   gene            428039..428509
FT                   /locus_tag="Ssed_0365"
FT   CDS_pept        428039..428509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0365"
FT                   /product="adenylate cyclase"
FT                   /note="KEGG: sfr:Sfri_3881 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34978"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ55"
FT                   /protein_id="ABV34978.1"
FT                   /translation="MAQEIERKYLVKNDSFKGQAVKAVRIIQGYLSSVPERTVRVRIKG
FT                   DKGFLTIKGIGNESGASRYEWEEQIPTEEAEELLKICEPGVIDKTRYIIEHASLIFEVD
FT                   EFYGSNEGLTVAEVELIDEAQAIDKPEWVGEEVTGDVKYYNSMLMKQPYTQW"
FT   gene            428526..429851
FT                   /locus_tag="Ssed_0366"
FT   CDS_pept        428526..429851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34979"
FT                   /db_xref="GOA:A8FQ56"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ56"
FT                   /protein_id="ABV34979.1"
FT                   /translation="MLSLSIADQYHLKISVEIPPEQQSLQWKVFFFFPAKLVQHSDSMS
FT                   SALFYRNLLQQQKLVKLEAVTHQGVKHDLLILRKTAYAVAKVNKTLYRSALADFVAASL
FT                   EMLTEKSDEELLDFARYLDKFHQIHDDEEHLSQRKLFKLADHLLLYHYHQALLKAKHSA
FT                   IKEEKAQYSLRIKNLTAYAESENHKLTHDSEFGREKLLDRLQLAQRILNRPYQLRRKML
FT                   NSGMLAEQLIFGFAAAFAMAFATAAAFMTQKAFGNFSTPFFFSLVLSYIFKDRIKELGR
FT                   NYLMEKYFAHYFQHHYRFYKGSDSEVVFDAKETLYRLNSENIKDLLKKVRKAFSSSDSN
FT                   AFKEALVYQRSYTAHVKKQQLVSAKFVDNLTLNLSGRLRSLPRVIRRHWKEADRNIQAV
FT                   NVEQIHPVYLAFEVKTDSGISHKIYKLTASRKGIHALVEAVE"
FT   gene            430127..431479
FT                   /locus_tag="Ssed_0367"
FT   CDS_pept        430127..431479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0367"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="KEGG: sfr:Sfri_3882 phosphate-selective porin O and
FT                   P"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34980"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ57"
FT                   /protein_id="ABV34980.1"
FT                   /translation="MAKANVSRISIVALAVSASLLCFSANAVASEKERINELEQRLDML
FT                   EVELIEAKDAASQVDRVKFSKSSPSPELISKDGRSTLEFKARIQTDYVSADELYTGSKR
FT                   EYEDSFNEASIRRIRFGLEGYFSNVWEYELEFDFDGVAEVEVKDANIAYKGWDNSQLTL
FT                   GFQKYAFGLEATGSSAHLAFLERAATDTFAPDRALGAQWRYVGNNYNVTLGYGVNAGFD
FT                   DDDLNFKQDIVNARFTTALIDSGEHLLHLGASALFVYNNEAVEETRYRARPNTKASGRT
FT                   IDTGKFDAESLQHYGAEIAYQYSNVLLQAEYATALADQADDSEPEVTVDAYYLQAIYTL
FT                   TGEAWKYKGKSGKFKTVKPDNAISAGGYGAWELAVRVDQANFDDVEAGIYGGKKTDYVL
FT                   GVNWYLENNLKAQFNYVHTTADYKKPYEDINGDMMYDQDANIFQARLQFAF"
FT   sig_peptide     430127..430216
FT                   /locus_tag="Ssed_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.851 at
FT                   residue 30"
FT   gene            431489..432313
FT                   /locus_tag="Ssed_0368"
FT   CDS_pept        431489..432313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34981"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ58"
FT                   /protein_id="ABV34981.1"
FT                   /translation="MRNNLLLIGLVNLCLSSSAYALSPGEFTSLEYHVNTGVGKTLPYA
FT                   AKAQTSSFKQAFNFIEFDDELSQKLVTYIDTPDRAFKAESIQIRVREHLTKPRKSKITV
FT                   KLRAKAPEGFGELSNYKKAEIDYTKGKAAYSVSYDIPYSPGDIDVKKLDMELVFNLLKK
FT                   NEVVWDMLGPIYEGNKKQFIQTVVMRTNEWEGTLKDDRFSNLEIDFQLWTPYYRKPRVT
FT                   FTEFSFKGHVSDKAKLEEAYQFLYQKVQEVGFSSGHQGSKTKATFKMTEGFK"
FT   sig_peptide     431489..431554
FT                   /locus_tag="Ssed_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 22"
FT   gene            432396..433064
FT                   /locus_tag="Ssed_0369"
FT   CDS_pept        432396..433064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0369"
FT                   /product="protein of unknown function DUF47"
FT                   /note="KEGG: sfr:Sfri_3884 protein of unknown function
FT                   DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34982"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ59"
FT                   /protein_id="ABV34982.1"
FT                   /translation="MFGFSRVTSLLSQSKSTEASIYTFLEQVTLSHHAFVQLWKAYLRH
FT                   GADSEEFKSTLDELQRIEQHADNLKREIENTLYRKTLIPDLRSDVASLIELTDRLINKQ
FT                   ETIGLHLDIEKPLIPVEVEEDLLLLLNVVGDTIDHALLCAKSFFTDLQRVQEYHKKTIM
FT                   FESDADKVCTRAKTILFETDQPLINKVQLRYFFDRIDQVANLAEDISDRISIFTLKRVQ
FT                   "
FT   gene            433077..434120
FT                   /locus_tag="Ssed_0370"
FT   CDS_pept        433077..434120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0370"
FT                   /product="phosphate transporter"
FT                   /note="KEGG: sfr:Sfri_3885 phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34983"
FT                   /db_xref="GOA:A8FQ60"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ60"
FT                   /protein_id="ABV34983.1"
FT                   /translation="MDIAIWIFLSSGLFLGWSLGANDAANVFGTAVGTRMVKFSTAALI
FT                   CSVMVILGAVISGAGASHTLGALGKVSALGGAFTVALSAATTVYFMTKSGLPVSTGQAI
FT                   VGAIIGWNLFSGMATDPKVLSKILSTWIMCPILAAFTAVLLYKLVAASINWFRPGLFQL
FT                   DKWTRIGLIIAGAFGSYSLGANNIANVMGVFVLSAPIDSAIWMGIEFSPAMQLFFIGSV
FT                   AISIGVFTYSKKVMLTVGDNLIPMTPITAWVVVMAHSIVLFIFSSQSLSNSFVELGLPA
FT                   IPLVPVSSSQAVIGAVIGIALLKRLPIRWAVLSQILMGWVITPIISALACFIGLFIVQN
FT                   LFNQVVV"
FT   gene            435056..436882
FT                   /locus_tag="Ssed_0371"
FT   CDS_pept        435056..436882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34984"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ61"
FT                   /protein_id="ABV34984.1"
FT                   /translation="MRSHLLALSVLPFAFSAIASSSLDALYGPIMPPAYIKAYEVNNHH
FT                   QIALNPYLQVGNADNPIILDEGEGYVWVIDKDGNFVIAPEVTSPWGRKYKEGMMRIEDG
FT                   KPKKWGYKEKYGHTALIGGSKARIGGELEMENGQWIMNNKSGRYNKRRPGRTEEAMHNA
FT                   GDLLIAIAPQIAELDYEYLKDYGPAKPISLKVMKDIEWHYMIDDDYFWDAEGKKLGKAF
FT                   VEKTPFIDWRAKVKFKEGFYMDTQDRFLKSQDEIFRVRLDVSKPRKSKFTHKLRSSDIT
FT                   DLKPMIDGEGEVDVSIGGDLYSLATDTGFNFLNFDFYNANSEEIFEYLMFADRRAYKQM
FT                   TPLMRYGADKVLKTDIMRQSKYKGWLNTGPFAGHEIEIQIWKKIIEPGKFGKEGKYSEP
FT                   LLLEIGFEGKTKNREELNKLNTWLYGKLKSADLLAKDQSQSKTEIAFAVSKRFDAKKTP
FT                   KLPQVAPEVKIAAIDGIKTRNLDGTINVKTNGDKQVIAGQKGVQGEVYQTALNGKPLSV
FT                   VVLGGKGNIKQALAKVVGAKGELLVAVAAGSSLDNPKSRAKLAAKLDGGNALKGYELLG
FT                   DTARDYLKPIIKKNMDIKARSNQHYYWSGVAE"
FT   sig_peptide     435056..435115
FT                   /locus_tag="Ssed_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 20"
FT   gene            437011..438036
FT                   /locus_tag="Ssed_0372"
FT   CDS_pept        437011..438036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0372"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: ppr:PBPRB1355 putative manganese-dependent
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34985"
FT                   /db_xref="GOA:A8FQ62"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ62"
FT                   /protein_id="ABV34985.1"
FT                   /translation="MTFHRLTLVALSLTAAMALPCQSADLDLSLNAQPISSDTLWFGHT
FT                   TPDTDTTVSAIAAAEFYGGQARSTGKLNKETQFVLDKLNVKTPPLARNLENAKVALVDF
FT                   NQTTQLMKGVDQNKIQAVIDHHALRDNPISLSAPISIVIKPWGSAATIIADDALDHGKT
FT                   ISKTMAGLLLAGILSDTLNLKSVTTTQRDRELVKTLSAKANLNADDFAQGMFKAKSDLS
FT                   DVSAYDIVVGDYKNYIVNGQDIGFGVAEVLDSSELLGRVDELRGAMAKARKNQKREQLF
FT                   FAIVDMQKKTAYVLTNSDKETKTASKAYGVKQNSQGIFVLEDTLSRKRQMMPAIKKALA
FT                   D"
FT   sig_peptide     437011..437082
FT                   /locus_tag="Ssed_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            438266..438928
FT                   /locus_tag="Ssed_0373"
FT   CDS_pept        438266..438928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0373"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: slo:Shew_2230 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34986"
FT                   /db_xref="GOA:A8FQ63"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ63"
FT                   /protein_id="ABV34986.1"
FT                   /translation="MRIMLLGAPGVGKGTQAQFIMEKYGIPQISTGDMLRAAVKAQSPL
FT                   GLEAKLLMDSGQLVSDNLIIGLVKERIVQDDCAKGFLLDGFPRTLPQADAMVANGIDID
FT                   HVVEIDVPDEEIVKRMGGRRIHPGSGRVYHTVFKQPKVEGKDDLTGEALIIRADDEEST
FT                   VRSRLDIYHQQTKPLVKYYGKLADFGKLTYNKFDGTQSVADVSAAIVKAHQAFAPSI"
FT   gene            complement(439043..439681)
FT                   /locus_tag="Ssed_0374"
FT   CDS_pept        complement(439043..439681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0374"
FT                   /product="ERCC4 domain protein"
FT                   /note="KEGG: spc:Sputcn32_3619 ERCC4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34987"
FT                   /db_xref="GOA:A8FQ64"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ64"
FT                   /protein_id="ABV34987.1"
FT                   /translation="MNKTLIEIAYDDREHAEILIEQLSLHTELCLVRKRLKLGDYQINN
FT                   WLIERKTLPDLVFSLCNGRLFSQIARLSKCSDNAALLIEGSSKDIASYDITREALIGAL
FT                   CSISINFNIPILRSLSQYESAKILYFCATQLNSRETGLKLNGRKPKRRKNRQLFILQSL
FT                   PEVGPRLARRLLKHFDSVEAVITASTDELIKVEGIGQERARKIREMLIP"
FT   gene            complement(439843..441147)
FT                   /locus_tag="Ssed_0375"
FT   CDS_pept        complement(439843..441147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0375"
FT                   /product="HipA domain protein"
FT                   /note="KEGG: she:Shewmr4_3395 HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34988"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ65"
FT                   /protein_id="ABV34988.1"
FT                   /translation="MSGSNFHILEMHFRGMVIGAIGFDIDTEQFSIEYTKPWQEKGFPI
FT                   SPRLPLDGQASSSQISIYLTNLLPENKGLDHLIEALGIAKSNTFGLIKGIGFDTSGAIL
FT                   YLPVGTKPPATSFTPICKEDLIKRIEDPEHWPMEVWDGKPRLSVAGVQSKLNLFHSDKE
FT                   YGFGEGELCSTHIIKFEKNNQHLVLNEFITMTLAGLIGMQVAKVDIMPIGKYKALSVTR
FT                   FDRMYEPERHIVMRRHQIDVCQALGFSVSRKYERNFGSGRDVQDIREGVSLERLFSIAE
FT                   HCANPAQAKFDMLRWTIFNLLVCNADSHGKNYSFYVTPDGLEPTPWYDLVNVQMYPDFD
FT                   QELAMAIGDEFEADKIHAYQLMTFAEECGIKQNILELSLKQLAKAIIGNLDKAAKQTGE
FT                   ITDAESKYVETYKKTIQARCEYYLAQVEEMKHIKL"
FT   gene            complement(441134..441382)
FT                   /locus_tag="Ssed_0376"
FT   CDS_pept        complement(441134..441382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0376"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: slo:Shew_0478 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34989"
FT                   /db_xref="GOA:A8FQ66"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ66"
FT                   /protein_id="ABV34989.1"
FT                   /translation="MLTQFDPNTLGKLIKDRRKAADMNQEIAASFCGVTKKTLIRVEKG
FT                   EDVYFSTIIKILNGLGIKLTVETPNSKNKLGGSNEWF"
FT   gene            complement(441797..442660)
FT                   /locus_tag="Ssed_0377"
FT   CDS_pept        complement(441797..442660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0377"
FT                   /product="YicC N-terminal domain protein"
FT                   /note="KEGG: slo:Shew_3489 YicC N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34990"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ67"
FT                   /protein_id="ABV34990.1"
FT                   /translation="MIQSMTAYARIEHKAEWGTASWEIRSVNQRYLETYLRLPEHFRNL
FT                   EPVLRDRLRKRLNRGKIEVNLRYDLADNSSNELQINQDLAKQLINAANWVKEEAGQGEL
FT                   NLVDILKWPGVMSGSEQDMDALGKELLVAFDSAIDQFIEARGREGAAINTMLQTRLDAI
FT                   VEQVTIVREHMPTVMQWQRDKLINRLAEITGELDPARMEQEMVILAQKMDVAEEMDRLD
FT                   AHVAETQRILKKGGAQGRRLDFMMQEFNRESNTLASKSISAEVTAAAVELKVLIEQMRE
FT                   QIQNVE"
FT   gene            442841..443554
FT                   /locus_tag="Ssed_0378"
FT   CDS_pept        442841..443554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0378"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: slo:Shew_3488 ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34991"
FT                   /db_xref="GOA:A8FQ68"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ68"
FT                   /protein_id="ABV34991.1"
FT                   /translation="MRPSDRTPAQSRPVTITRQFTAHAEGSVLVEFGDTKVLCTASFEE
FT                   GVPRFLKGKGQGWVTAEYGMLPRSTHSRMNREAARGKQSGRTQEIQRLIGRSLRAAVDM
FT                   KALGENTIVIDCDVIQADGGTRTAAITGACVALVDSLNWARGKGILKTNPLKFLIAAVS
FT                   VGIYKGEPICDLEYIEDSEAETDMNVVMTETGKMIEIQGTAEGEPFSHEELLSLLELAK
FT                   HGIREIVDIQKAALS"
FT   gene            443641..444282
FT                   /locus_tag="Ssed_0379"
FT   CDS_pept        443641..444282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0379"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: slo:Shew_3487 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34992"
FT                   /db_xref="GOA:A8FQ69"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ69"
FT                   /protein_id="ABV34992.1"
FT                   /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LARLGRFYAAALVDSGIKHDLLFGPAYKGIPIATTTAVALCEHHDIDIPYCFNRKEKKD
FT                   HGEGGSLVGSELKGRVMLVDDVITAGTAIRESMEIIEAHKAELAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCEIVSIIKLGDLINYLSEKSGMEAQLESVSAYRDQYGI"
FT   gene            complement(444582..445241)
FT                   /locus_tag="Ssed_0380"
FT   CDS_pept        complement(444582..445241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0380"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: slo:Shew_3486 GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34993"
FT                   /db_xref="GOA:A8FQ70"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ70"
FT                   /protein_id="ABV34993.1"
FT                   /translation="MTSKDAVLSESAQLVQSALLTRGLETPMLPSELSADERKDQIEQH
FT                   MRAILNLMSLDLTDDSLADTPRRIAKMYVDEIFSGLDYQNFPKITVIENKMGFDEMIKV
FT                   NDISLTSTCEHHLVTIDGLATVAYLPRKNIIGLSKINRIVQFFAQRPQVQERLTQQVLV
FT                   ALQTLLETKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLSN"
FT   gene            complement(445480..447444)
FT                   /locus_tag="Ssed_0381"
FT   CDS_pept        complement(445480..447444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0381"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="KEGG: slo:Shew_3485 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34994"
FT                   /db_xref="GOA:A8FQ71"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ71"
FT                   /protein_id="ABV34994.1"
FT                   /translation="MKLIKFFSFACLTILSYNAVAKIESPAEVFSRSAEFSNVKISPGG
FT                   DYLSTITTKDGKQVLIILDAKTRKPLHSVYFSTNAQVGDYQWVNDERVVLQKVYLKGWQ
FT                   DHPLYYGELMAVNADGSKPVYLFGYAQKGQQTGTRIKKNTPIRATAYILDPMPENKRYM
FT                   LVKALPWGSGSSNTAENLQQVYRVDVYKGKRKKLVTSPISYANFLTDDEGEVRFVSGTR
FT                   DYINSRLFYREDNLWVDTDKLQLNLEQMRPIAFGDDKDSVYVVGSEPGKNKGIYLINIK
FT                   TGTKKLVSRDDVVDPYNVWINQNNKKLYAVEFENGYPSYEFVDKQDARAKLIKQLLASL
FT                   PGHQIHLVSETTDANQFIIKAFNDRNPGDYYLFNTETMKLEYLVSQKNWLDPELMAEVK
FT                   PISFTSRDGKKIHGYLTLPNNIEAKNLPLVVNPHGGPHGPRDWWGFDAQNQLIASQGAA
FT                   ILQINFRGSGGYGKEFEHLGHQKWGTDIQYDIIDGTKYVIEQGLVDKDRICIAGGSFGG
FT                   YSALMAPTLAPDMFKCAIGFAGVYDLPLMFKEGDVQSRRAGERYLEKVLGEDTKVLQSM
FT                   SPTHNVDKLKTKLLLVHGGDDERAPIEQFEALEDALNERNYPYQKLIMDDEGHGFYNDD
FT                   HQAKYYGEMLSFLKENLKL"
FT   sig_peptide     complement(447379..447444)
FT                   /locus_tag="Ssed_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.957 at
FT                   residue 22"
FT   gene            complement(447863..448456)
FT                   /locus_tag="Ssed_0382"
FT   CDS_pept        complement(447863..448456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0382"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="KEGG: slo:Shew_3484 transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34995"
FT                   /db_xref="GOA:A8FQ72"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ72"
FT                   /protein_id="ABV34995.1"
FT                   /translation="MAVSPKINRREHILQCLATMLETNPGQRITTAKLAAEVGVSEAAL
FT                   YRHFPSKARMFEGLIDFIEESLLSRINLIMTEEKDTMKRCQLLLQLLLIFSERNPGISR
FT                   VLNGDALLGENERLRSRVSLIFSKIETHLKQILREKTLREGKGFNLDEAILANLLLAIA
FT                   EGRIAQFVRSEFKQKPTEHFDQQWIFIQQQLLQS"
FT   gene            complement(448601..449059)
FT                   /locus_tag="Ssed_0383"
FT   CDS_pept        complement(448601..449059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0383"
FT                   /product="dUTP diphosphatase"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: saz:Sama_0325 dUTP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34996"
FT                   /db_xref="GOA:A8FQ73"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ73"
FT                   /protein_id="ABV34996.1"
FT                   /translation="MKTPIEVKILDSRIGSQFPLPAYATPGSAGMDLRAMLETSIQVAP
FT                   GETILIPTGISIHVADSSLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNR
FT                   GSEPFTLEIGDRLAQLVFVPVVQAEFKLVDEFDNSSRGEGGFGHSGTK"
FT   gene            complement(449056..450258)
FT                   /locus_tag="Ssed_0384"
FT   CDS_pept        complement(449056..450258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0384"
FT                   /product="Phosphopantothenoylcysteine decarboxylase,
FT                   Phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: slo:Shew_3482 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34997"
FT                   /db_xref="GOA:A8FQ74"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ74"
FT                   /protein_id="ABV34997.1"
FT                   /translation="MNQSLTNKQILLAIGGGIAAYKSADLIRRLKERGADVRVVMSQSA
FT                   KEFITPLTLQALSGYPVASDLLDTAAEAAMGHIELARWADLVLVAPATANLIARINAGM
FT                   ADELITTTCLATESPVAICPAMNQQMYRNQATQDNIKNLSERGLTIWGPDSGSQACGEV
FT                   GPGRMQEPLEIAMQVEQFFAPKLLSGRSLLLTAGPTREAIDPVRYISNHSSGKMGFALA
FT                   KAAADMGANVTLVSGPVNLPTPTGVNRVDVESTDDMLNAVMAQVDAHDIFIGCAAVADY
FT                   RVADIATDKIKKSATEMQLSLVRNPDILASVASHTPRPFTVGFAAETQDVARYAKDKLI
FT                   RKKLDMIAANDVSSPELGFNADSNALKVIWEKGEQDLPATDKLTLATQLLTLIAKRIDN
FT                   A"
FT   gene            450403..451080
FT                   /locus_tag="Ssed_0385"
FT   CDS_pept        450403..451080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0385"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: sbl:Sbal_0377 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34998"
FT                   /db_xref="GOA:A8FQ75"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ75"
FT                   /protein_id="ABV34998.1"
FT                   /translation="MGIKDWPDGEGPREKLLKLGVGPLSDAELLAVVLRNGVQGLSAVE
FT                   LARNLIGQFGGLRELLTASEIEVCRMPGMGPVKFAQLQAAAELSKRISQQNLKRGKILS
FT                   DPDLTRDYLMRQLADRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPRDVVCLVLE
FT                   KKAAAVIVCHNHPSGVAEPSLADRRITERLKFALETIDVSLLDHMVVGDREIVSFAERG
FT                   WID"
FT   gene            451208..451444
FT                   /locus_tag="Ssed_0386"
FT   CDS_pept        451208..451444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0386"
FT                   /product="ribosomal protein L28"
FT                   /note="KEGG: slo:Shew_3480 ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV34999"
FT                   /db_xref="GOA:A8FQ76"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ76"
FT                   /protein_id="ABV34999.1"
FT                   /translation="MSRVCQVTGKKPMVGNNRSHAKNSTRRRFLPNLQNHRFWLEGEKR
FT                   FVKLRISTKGMRIIDKKGIEVVVAELRARGEKV"
FT   gene            451451..451624
FT                   /locus_tag="Ssed_0387"
FT   CDS_pept        451451..451624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0387"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: sfr:Sfri_3826 ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35000"
FT                   /db_xref="GOA:A8FQ77"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ77"
FT                   /protein_id="ABV35000.1"
FT                   /translation="MAKSKGNREKIKLVSSAKTGHFYTTEKNKRNMPEKMEIKKFDPVI
FT                   RQHVMYKEAKIK"
FT   gene            451913..453232
FT                   /locus_tag="Ssed_0388"
FT   CDS_pept        451913..453232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0388"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /note="KEGG: slo:Shew_3478 amino-acid N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35001"
FT                   /db_xref="GOA:A8FQ78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ78"
FT                   /protein_id="ABV35001.1"
FT                   /translation="MRTTELVDGFRHSASYVNSHRGKTFVVMLGGEALAQNQFRSIIND
FT                   IALLHSLGIKIVLVHGARPQIDEALADKCIVPEYYNGVRITEEDAFKVIKQVVGGLQLD
FT                   ITARLSMSLSNTPMQGAQINVVSGNFVIAQPLGVDDGVDYCLSGKVRRIDVQGLKAQLG
FT                   NNGIVLLGPIAASVTGESFNLTAEEVATQIAVKLKADKMIGFSSQKGILDSFGEVLAEL
FT                   MPNEAQQILNNLNQESHVCLGTKAFLKASIDACRNGVSRCHFVSYLDDGSLLQELFSRD
FT                   GVGTQIVTESAERLRRAGIGDIGGILDLIRPLEEKGILVRRSREQLEMEIEQFMLIERD
FT                   SLVIGCAAFYPFEEDNAGEFACLVVHPEYRDADRGSILLNNIIGQARVRGYSRLFALTT
FT                   RSIHWFLEHGFEIVEVDELPDKKKQLYNYQRKSKILALEL"
FT   gene            complement(453603..454499)
FT                   /locus_tag="Ssed_0389"
FT   CDS_pept        complement(453603..454499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0389"
FT                   /product="rarD protein"
FT                   /note="KEGG: son:SO4243 rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35002"
FT                   /db_xref="GOA:A8FQ79"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ79"
FT                   /protein_id="ABV35002.1"
FT                   /translation="MLDSEHRKGIAFALCAYTLWGFAALYFKLLDHVSATEILIHRVIW
FT                   SFVFVTMLMFIFGGFSRLRQVLKRPKQLAVLTLTSVLIAGNWLLFIWAVNNDHMLDASL
FT                   GYFINPLVNVMLGMVFLSERLRKLQWCAVALAGAGVLVQLISFGSIPLVSLGLAFSFGL
FT                   YGLLRKKVNVDAKTGLLVETAILFPIAMIYLFANMGDALTNLMTNTLSNNLLLMAAGIV
FT                   TTIPLLCFAAAAVRIPLSMLGFFQYIGPSIMFILAVTLYKEPFDLEKGITFAFIWSALI
FT                   LFSIDMLYKRKKPLRES"
FT   gene            complement(454745..455209)
FT                   /locus_tag="Ssed_0390"
FT   CDS_pept        complement(454745..455209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0371 uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35003"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ80"
FT                   /protein_id="ABV35003.1"
FT                   /translation="MTNPIQEQTLRRVAEVFDKQVPFHNLLGLDIKRYDLDGVEVVINM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTVFAGLVASREDWSIEDLQSRLQTLGTIDLR
FT                   VDYLRPGRGMQFTGTGTVIRAGNRVSVCRMELHNEQGSHIAFGTGTYMVG"
FT   gene            455509..457332
FT                   /locus_tag="Ssed_0391"
FT   CDS_pept        455509..457332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0391"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: slo:Shew_3474 ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35004"
FT                   /db_xref="GOA:A8FQ81"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ81"
FT                   /protein_id="ABV35004.1"
FT                   /translation="MEQAIDEPQLDPLSSSLQSVFGYRTFREGQREVIEQSCSGYDCLV
FT                   IMPTGGGKSLCYQLPALQLPGLTIVVSPLISLMKDQVDSLTQMGVSAAYLNSSLPREES
FT                   ARILQQMHKGEIKLLYVSPERLLQGHFIDRLHELHISLFAIDEAHCISQWGHDFRPEYA
FT                   ALGKLREVFPHVPIMALTATADQATRKDICDRLTISPFSLLTSFDRPNIRYTVAEKLNA
FT                   ANQLRQFVTDQKGTSGIIYCSSRRRVDEVAERLRLQGHNAEAYHAGKTQEERADVQDRF
FT                   LKDQLDIVVATVAFGMGINKSNVRYVVHYDIPKSVEAYYQETGRAGRDGLDSEALMLFD
FT                   PADIGRVRHLIEQSEPGPQQQVEFHKLNTMAAFAEAQTCRRQVLLHYFDESALEPCGNC
FT                   DICLDPPKRYNGMQDAQKVLSCIYRLDQRFGVNHLIEVLRGSKAATVLERGHDKLSTWG
FT                   IGKDKSHEYWLSIIRQIIHLGFASQDITRGSSVKLNPSARSVLKGEVELLLAEPRIVLQ
FT                   TTKRRGSSTRAPLNYDRKLFARLKQLRRQLAEELDVPPYLVFNDASLAEMAAMMPTSPG
FT                   EMLAVNGVGERKLSRFGGEFLDEIANYLADS"
FT   gene            complement(457338..459089)
FT                   /locus_tag="Ssed_0392"
FT   CDS_pept        complement(457338..459089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0392"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: slo:Shew_3473 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35005"
FT                   /db_xref="GOA:A8FQ82"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ82"
FT                   /protein_id="ABV35005.1"
FT                   /translation="MDFRIVVLSLTFWLAPVWASTSVPLDTIDTLIYQYPSAALIEIND
FT                   LEAISSPVKLSETEKLRLALFRCETFLQLGENEAAINLARISEAKAKILKLEQARPYFL
FT                   NCMAGAFTNYGDFRQALPILDSSILLSRELKQPQSLVNGLRLRGIIDTQVDSYSSAFED
FT                   LSLAIDIYPDAQNQEQGWTLPPLIYIQIPLSKLLAKKTKIRQAFEIIERAADSKEFQGK
FT                   VRVVLTTHMAKMAQLNQYSSSDNLIQQAKTLLPELGTAFELAISYTEMAQLEYKRKNFI
FT                   RAIQLLEISLNTFKKQKKTIEELRAQRLLGEVLLASGNTDKALKLINKSISAGLRTSHY
FT                   AELILSYQVLGSYYASIGDFKQAHLYQLKRFDAAENSFNFIKDTRLLQLNARVSRQQQV
FT                   FKTELLQSNSSINVGQGFKSGYIAILLTLLFGFILGVITIRYKKRTIQAPLAIEPQSRE
FT                   HKIERLISNSKQAGYPLSLVVIHTADVYQTNLPLLISRIENLLRDQDLVINREDGELLL
FT                   LLPHTKEGGTLRVIEQIKEIITPLLNGNKTKIGYARMQQHDSLSSLIKRAHIQQLRQTK
FT                   IDKEPTG"
FT   sig_peptide     complement(459030..459089)
FT                   /locus_tag="Ssed_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.973 at
FT                   residue 20"
FT   gene            459605..461176
FT                   /locus_tag="Ssed_0393"
FT   CDS_pept        459605..461176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0393"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="KEGG: slo:Shew_3472 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35006"
FT                   /db_xref="GOA:A8FQ83"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ83"
FT                   /protein_id="ABV35006.1"
FT                   /translation="MSNRVIIFDTTLRDGEQALAASLTVKEKLQIALSLERLGVDVMEV
FT                   GFPVSSPGDFNSVQTIANTVKNSRVCALARALEKDIDAAAQSLSVADQFRIHTFISTST
FT                   IHVESKLKRSFDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEEAIKAGA
FT                   RTINIPDTVGYTIPSEFGGIIETLFNRVPNIDQAIISVHCHDDLGLSVANSITAVQQGA
FT                   RQIECTVNGIGERAGNCSLEEIAMILSTRKDSLGLETGINAKEIHRTSNLVSQLCNMPV
FT                   QANKAIVGANAFTHSSGIHQDGMLKSQNTYEIMTPESIGLHRNNLNMTSRSGRHVIKHR
FT                   MEEMGYGNKDYDMDTLYEAFLQLADKKGQVFDYDLEALAFMEAQVDEEADYKLAQLVVH
FT                   SDSTEGNATATVKLEIDGKTVTEAATGNGPVDAAYNAIARASQCEVNITSYKLSAKGEG
FT                   QNALGQVDIEANYNEQSFHGVGLATDVVEASVQALVHVMNLTSRADKVADCKEKIQKDR
FT                   SELGGV"
FT   gene            461233..462327
FT                   /locus_tag="Ssed_0394"
FT   CDS_pept        461233..462327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0394"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: slo:Shew_3471 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35007"
FT                   /db_xref="GOA:A8FQ84"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ84"
FT                   /protein_id="ABV35007.1"
FT                   /translation="MSYQIAVLAGDGIGSEVMAEARKVLSAVEERFELAIEYSEYDIGG
FT                   AAIDNHGCPLPEVTLKGCEAADAILFGSVGGPKWEHLPPNDQPERGALLPLRGHFELFC
FT                   NMRPAKLHAGLEHMSPLRSDISGKGFDVLCVRELTGGIYFGKPKGRQGEGEEEEAFDTM
FT                   RYSRKEIRRIAKIAFEAAQGRRKKVTSVDKANVLACSVLWREVVEEVAKDYPDVELEHI
FT                   YIDNATMQLLRRPDEFDVMLCSNLFGDIISDEIAMLTGSMGLLSSVSMNSKGFGLYEPA
FT                   GGSAPDIAGQGIANPVAQILSAALLLRHSLKLESAAVAIEAAVGKALSDGYLTGELLPA
FT                   SQRANAKSTSEMGDYITKLVKEGI"
FT   gene            462332..463732
FT                   /locus_tag="Ssed_0395"
FT   CDS_pept        462332..463732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0395"
FT                   /product="3-isopropylmalate dehydratase"
FT                   /EC_number="4.2.1.33"
FT                   /note="KEGG: slo:Shew_3470 3-isopropylmalate dehydratase,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35008"
FT                   /db_xref="GOA:A8FQ85"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ85"
FT                   /protein_id="ABV35008.1"
FT                   /translation="MAKTLYEKVWDSHVVVENEGQAPLIYVDRHLVHEVTSPQAFSGLK
FT                   VAGRKLRAPEKTFATMDHNTSTKSASLDALSPMARIQVETLQDNCKEFGVRLYDIHHKN
FT                   QGIVHVMGPELGITLPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVMATQTLRQNKA
FT                   KTMKIEVRGHVAAGITAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSMEGRMTVCNM
FT                   AIEMGAKAGMVAPDGITAEYLKGREFAPKGESWEQAIAAWAELKTDEDAIFDASVVLEA
FT                   SDIAPQLTWGTNPGQVVAIDGLVPNPEDESNATVKASIEKALEYVALSAGTCMTDVSIN
FT                   KVFIGSCTNSRIEDLRDAALHAKGRKVAAGVTAIVVPGSGLVKEQAEAEGLDKIFLEAG
FT                   FEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPAMAAAAAVAGH
FT                   FVDIRKAY"
FT   gene            463746..464351
FT                   /locus_tag="Ssed_0396"
FT   CDS_pept        463746..464351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0396"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: slo:Shew_3469 3-isopropylmalate dehydratase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35009"
FT                   /db_xref="GOA:A8FQ86"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ86"
FT                   /protein_id="ABV35009.1"
FT                   /translation="MNPFTSHTGLAVMIDSANVDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDEAGDEPNPGFSLNLPRYKGASILISKENFGCGSSREHAPWALADFGLRAIIAPS
FT                   FADIFYGNSINNGLLPVRLTDVEVQQLMDEVEASEGAEITVDLEELTVTSPSGAVFNFE
FT                   IAGSARHNLLNGLDAIGLSLACADQIARYEAQLPTWKA"
FT   gene            464841..466178
FT                   /locus_tag="Ssed_0397"
FT   CDS_pept        464841..466178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0397"
FT                   /product="long-chain fatty acid transport protein"
FT                   /note="KEGG: son:SO4232 long-chain fatty acid transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35010"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ87"
FT                   /protein_id="ABV35010.1"
FT                   /translation="MTLKMRETMNKRILSMAVAAAIVGSVTQVQAAGFQLAEYSATGLG
FT                   RAFAGEAAMADNAAAQFRNPAMMTYLSGTQVAGGAILVMPNIDINGEVTFVDGTNPTSA
FT                   NDIADDAVVPNFYVTHQLNEQWFLGLALGSNFGMATELDDSFRGTQFGNEASVTTIEIN
FT                   PNIAYRINEQFSVGAGVRFVIGEGSIGAKSSADSVLPTPMGNLPVPKGTTLKYMEGDDT
FT                   SWGWQLGAAWQINDSNRIGVNYRSAVDQNLEGEANGLAFNPMDPTLKMDGAMELSLPAT
FT                   AELASFHQLTEKLAIHASINWTDWSSFEKLEAVIPALSEPTQLVKQENWKDSYRFALGT
FT                   TYDLSQKSTLRAGVAYDRSAVSDANRTLTIPEMDRLWLSAGYGYHYSDNLDLDFGVTYI
FT                   FADESPVVEPRPGIESDRSSALFGGTFSGTTSGNIMLVGVQASYRF"
FT   sig_peptide     464841..464936
FT                   /locus_tag="Ssed_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            466420..466917
FT                   /locus_tag="Ssed_0398"
FT   CDS_pept        466420..466917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35011"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ88"
FT                   /protein_id="ABV35011.1"
FT                   /translation="MRSYLLAASLTFLSFTSQAAPTPTEVVESFIQAYNKHDVELMVQH
FT                   TSETVRWMHITGTKVEVETSDRTEFGAAMTDYFETLKDANATILQIIDSGSYVSTVERV
FT                   TWDNDGEHLSQCSIGTFRVKAGKLAEFWYFPAHACDEQPPQEMIEQDVVEPEIGVLQET
FT                   QQ"
FT   sig_peptide     466420..466479
FT                   /locus_tag="Ssed_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            466976..468463
FT                   /locus_tag="Ssed_0399"
FT   CDS_pept        466976..468463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0399"
FT                   /product="glycerol kinase"
FT                   /note="KEGG: slo:Shew_3466 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35012"
FT                   /db_xref="GOA:A8FQ89"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ89"
FT                   /protein_id="ABV35012.1"
FT                   /translation="MAKKYVVALDQGTTSSRAIIFDHDANIVSVSQREFPQIYPQAGWV
FT                   EHDPMEIWASQSSTLIELLARSGIHGSEVAAIGITNQRETTVIWDKLTGKPVYNAIVWQ
FT                   CRRSSHICDELKAQGLEDYVRETTGLLLDPYFSGTKIKWILDNVAGVRERAEKGELLFG
FT                   TIDTWLVWKLTEGKVHVTDPTNASRTLLFNIHTQQWDSKLLEALNIPESLLPEVKPSCA
FT                   VYGKTRIAGEGGEISIAGIAGDQQSALFGQLCIDEGMAKNTYGTGCFLLMNTGKQAVKS
FT                   THGLLTTVAIGADCEVNYALEGAVFMGGATIQWLRDELGLIRDAQDTEYFASKVEDTNG
FT                   VYLVPAFVGLGAPYWDPNARGALVGLTRGSNRNHIIRAALEAIAYQSRDLLDAMAKDSG
FT                   VMLKQLKVDGGAVSNDFLMQFQADITNVEVQRPAITETTAMGAAFLAGLAVGFWSSTSE
FT                   LKHKADIERTFIPSISAEKCDELYCGWNRAVTQTIKS"
FT   gene            complement(468533..468835)
FT                   /locus_tag="Ssed_0400"
FT   CDS_pept        complement(468533..468835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ90"
FT                   /protein_id="ABV35013.1"
FT                   /translation="MVGLDSLYAMLARPVPPVIKRKRVVEETEYMKGIAADSHEAPQSQ
FT                   LPPSLERRHAIEDRRDSPRGDRRGQKEKEKEQEEELAKAQQEAIESPLPHIDIDV"
FT   gene            469277..469735
FT                   /locus_tag="Ssed_0401"
FT   CDS_pept        469277..469735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0401"
FT                   /product="MraZ protein"
FT                   /note="KEGG: slo:Shew_3462 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35014"
FT                   /db_xref="GOA:A8FQ91"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ91"
FT                   /protein_id="ABV35014.1"
FT                   /translation="MFRGASAINLDTKGRIAIPKRYREPLHAEFNSQIVITVDFQSPCL
FT                   LLYPFDEWSKIEAKLLLLSDTRATERAMKRLLLGYAHECELDGNGRILLPPPLRQYANL
FT                   EKRAMLVGQLNKFELWDETAWQKQIEQSRETIQSEEFADNERLADFSL"
FT   gene            469763..470707
FT                   /locus_tag="Ssed_0402"
FT   CDS_pept        469763..470707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0402"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="KEGG: slo:Shew_3461 S-adenosyl-methyltransferase
FT                   MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35015"
FT                   /db_xref="GOA:A8FQ92"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ92"
FT                   /protein_id="ABV35015.1"
FT                   /translation="MMSQEFAHLSVLLTETVAGLNIKEDGIYIDGTFGRGGHSREVLKH
FT                   LGENGRLIAIDRDPQAIAAAEQFADDARFSIVHGGFGQLATYVEDLGLKGKIDGVLLDF
FT                   GVSSPQLDDAERGFSFLRDGPLDMRMDNSQGETAADWIARAEIEDMAWVFKTYGEEKNS
FT                   RHIARCIAADREKTPFLRTKELADLIARISKNKERNKHPATRVFQAIRIYINSELEQID
FT                   QALEGALSVLAPHGRLSVISFHSLEDRMVKRFIRRHCQGESVPHGLPITEAEINKSRLL
FT                   KGIGKAIKPSEEEVERNTRARSSVLRIAERLEY"
FT   gene            470784..471098
FT                   /locus_tag="Ssed_0403"
FT   CDS_pept        470784..471098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0403"
FT                   /product="cell division protein FtsL"
FT                   /note="KEGG: slo:Shew_3460 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35016"
FT                   /db_xref="GOA:A8FQ93"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ93"
FT                   /protein_id="ABV35016.1"
FT                   /translation="MSKSQLNLPRIVLLDLWHHKWVLLLAIAVMVNAIAVVYTSHVSRK
FT                   YITQWDQMLQERDRLDIEWRNLLLEEQSQSEHSRITRIASKELEMSRPLPKEEIVVRVP
FT                   "
FT   sig_peptide     470784..470891
FT                   /locus_tag="Ssed_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.909 at
FT                   residue 36"
FT   gene            471175..472911
FT                   /locus_tag="Ssed_0404"
FT   CDS_pept        471175..472911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0404"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: slo:Shew_3459 peptidoglycan
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35017"
FT                   /db_xref="GOA:A8FQ94"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ94"
FT                   /protein_id="ABV35017.1"
FT                   /translation="MSKQAKRKQKPQLIEWRLYVVVAFVCLLFTSLIGRAAYIQIIEPE
FT                   KLRHESDMRTLRTTSREVQRGLITDRNGEMLAVSVPVKAVYADPKVVHDRNGFVDMRRW
FT                   QALADILHEPKEKILKRVQSNPKKRFTYLKRQVTPAVAEYISKLKLPGVYLKSESRRYY
FT                   PTSEISAQLVGITNIDDIGIEGIENSYNDWLTGTPSKQKVRKSRDGHVVERLDIVQDGD
FT                   SPNDLVLSLDQRIQQLAYRELKKATEINQATSASIVVLDVHTGEVLAMANTPSYNPNSR
FT                   DNLQAFRMRNRALTDSYEPGSTIKPFVVAAALEAGTIKSDQVIKTYPGRMRIGGKVVRD
FT                   SRYYGDLSLADVLVHSSNVGMAKISLSMPVQELLGAYQTMGLGNYSGINLAGESAGLIH
FT                   DRRRWSEFERATLSFGYGLMVTPLQLARLYATLGSKGVLYPVSILKLKQQPEGEQVISP
FT                   EIAQSVMEMLIGVTEKGGTATKAHIEGYPVAGKTGTARKAVAGGYGEDYVAIFAGVAPV
FT                   HNPELAIVVVVNEPKGDRYYGGDVAAPVFASVMSGALQMLNIEPISSREKVRLAGTTRR
FT                   TE"
FT   sig_peptide     471175..471285
FT                   /locus_tag="Ssed_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.851 at
FT                   residue 37"
FT   gene            472911..474392
FT                   /locus_tag="Ssed_0405"
FT   CDS_pept        472911..474392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0405"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="KEGG: slo:Shew_3458 UDP-N-acetylmuramyl-tripeptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35018"
FT                   /db_xref="GOA:A8FQ95"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ95"
FT                   /protein_id="ABV35018.1"
FT                   /translation="MLLRDLLAPWFHYAGSESFNKLTLDSRAVGPGDLFIAIPGHQADG
FT                   RKYIRSAVQQGAVASLVHTDDPESHGKCVDDEGKQILFFQLNRQLSALAAQAYPLSAER
FT                   LKLVGVTGTNGKTSITQLMAQLVTLLGKQSAVMGTLGNGLWGDLVDSGNTTADAITMMA
FT                   QLQEFDAQGAELCAMEVSSHGLIQGRVEAVPFDVAVFTNLSRDHLDYHGTMQAYGDAKK
FT                   RLFNFPSLSSGLINLDDEIGKQWLAEHDTGKYTSFSIHGEPASIENSKAIYTQNNHFHH
FT                   QGVDAKLVWPGGHADLCSPLLGSFNLSNLIAALGALYLLGFDMHSLVAVVPKLQAVAGR
FT                   MERFTTPDDVTIVVDYAHTPDAIEQALKALRGHCDGELWCLFGCGGDRDKGKRPLMAQA
FT                   AEKYADRVVVTSDNARSEQPDVIINDILEGLTAPDKALTQVDREVAIRQVVANAKAGDL
FT                   VLLAGKGHETYQEIAGVRRQYDERALARELSEAQV"
FT   gene            474389..475756
FT                   /locus_tag="Ssed_0406"
FT   CDS_pept        474389..475756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0406"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /note="KEGG: slo:Shew_3457
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35019"
FT                   /db_xref="GOA:A8FQ96"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ96"
FT                   /protein_id="ABV35019.1"
FT                   /translation="MIPLTLLQLSHRLDARLIGPDTEIAYVCSDSRSIPPQTLFVALKG
FT                   ERFDGHDFAHLAVENGANALLVTHELPLDLPQLIVKDTQKAMGEIGAYLREVIQPKSIA
FT                   LTGSNGKTSVKEMVATILSQRHKVLYTAGNFNNEIGVPLTLLRLEEGDEFGVFELGANH
FT                   RGEIDYTSSLVKPDVALVNNVASAHLEGFGSLAGVAAAKSEIFNHLSPDGTAVINADDS
FT                   FARVMKEAASEHKQLTFAIEAAADLQGSGLEPDLLGRYCFKMSYLNQEVSVTLPLSGRH
FT                   QVSNALAAAGICLTLGLPLSEIVSGLSLLEPVKGRMLPTQLGRVRVIDDSYNANPASVS
FT                   AAIDWLQEIDGYRCLVLGDLGELGDNASLLHTELGELAKIRGIEALFSLGELSANASTA
FT                   FGGVHHQELEQVVNNLVNHINQLQGDVTVLVKGSRSAKMERVVEALIVAYGRGEFV"
FT   gene            475756..476838
FT                   /locus_tag="Ssed_0407"
FT   CDS_pept        475756..476838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0407"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: slo:Shew_3456
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35020"
FT                   /db_xref="GOA:A8FQ97"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ97"
FT                   /protein_id="ABV35020.1"
FT                   /translation="MLVYLAEYLTQFYSGFNVFSYVTFRAILGLLTALIFSLWWGPKMI
FT                   ERLQMLQIGQVVRNDGPESHFSKRGTPTMGGILILAGVFISVLLWGDLASRYVWVVLFV
FT                   LASFGLIGFIDDYRKVVRKDTKGLIAKWKYILQSLAALVIAFYLYASADLVGETQLVVP
FT                   FFKDIMPQLGGFFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHV
FT                   QFANYLHLPYLPGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGVIA
FT                   VLVRQEILLVIMGGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLFLVLLGLATLKLR"
FT   gene            476911..478242
FT                   /locus_tag="Ssed_0408"
FT   CDS_pept        476911..478242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0408"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /note="KEGG: sbl:Sbal_0400
FT                   UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35021"
FT                   /db_xref="GOA:A8FQ98"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQ98"
FT                   /protein_id="ABV35021.1"
FT                   /translation="MVNHKSHLILGLGATGLSVVRYLHGLGITPLVMDSRQQPPGADKL
FT                   AAEFPDVELISGGFDCRYLVQATQIIVSPGIAIDTPEIRAAIDMDIEVIGDVELFARAV
FT                   KERDACVIGITGSNGKSTVTTLVAEMAKAAGINYAVGGNIGIPVLDLLQSDIELYVLEL
FT                   SSFQLETTHSLNCISATCLNISEDHMDRYSDIEAYRQAKLRLYSQTRFALFNREDELTK
FT                   PKDPMNQNSFGLSLPDNDEWGVCEGKIVHGSVEVISLQDVALVGSHNHANLIAAMALAY
FT                   QAGIEKAAMVEVASSFTGLEHRFEMVVNRNGVAYINDSKATNVGATVAAIEGISEHLGD
FT                   IILIAGGDGKGADFKPLVPVLKAVSHLITLGKDGDKIAALSDSSIRVDSMADAVNKAAQ
FT                   LAIAGDIVLLSPACASLDMYKNFMERGDDFRRLAEGLSAEALNA"
FT   gene            478235..479467
FT                   /locus_tag="Ssed_0409"
FT   CDS_pept        478235..479467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0409"
FT                   /product="cell division protein FtsW"
FT                   /note="KEGG: slo:Shew_3454 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35022"
FT                   /db_xref="GOA:A8FQ99"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQ99"
FT                   /protein_id="ABV35022.1"
FT                   /translation="MRSEERQLNLFGTSVNWSWPNLFKEREAPGMQLYDRALLFAVLSL
FT                   ICFGFVMVMSASMPEAQSLTGNPYHFAIRHFAYLVGCAVIAAVVLRIEMSRWQQFSPLL
FT                   LLIVGIMLVAVLLVGTSVNGATRWLSVGPIRIQVAELAKFAFTIYMAGYLVRRHQEIRE
FT                   NAKGFYKPIAVFAVYAFLILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALILTGVMA
FT                   FVALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYL
FT                   PEAHTDFIFAVIGEELGFIGIVVVLSVLLFVALRAIKLGNLCIEIDKPFEGYLAYAIGI
FT                   WFCFQTVVNVGASIGMLPTKGLTLPFISYGGSSLWVMTAAAMILIRIDHERRLSSIQAV
FT                   QGKKVNDNREY"
FT   gene            479448..480545
FT                   /locus_tag="Ssed_0410"
FT   CDS_pept        479448..480545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0410"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: slo:Shew_3453
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35023"
FT                   /db_xref="GOA:A8FQA0"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQA0"
FT                   /protein_id="ABV35023.1"
FT                   /translation="MTTVNTDKRILIMAGGTGGHVFPALAVAKYLCQQGWQVRWLGTAE
FT                   RMEARLVPQHGFDIDFIDIKGVRGNGLLRKLAAPFKVIRSIMQAQAVIKEFKPDVVLGM
FT                   GGFASGPGGVAARLSGLPLVLHEQNAIPGMTNKILARIASQVLCAFEDTFDNVEAEVVG
FT                   NPIREELIALGDSNVDPVTDDALKVLVVGGSLGAKVFNDLMPSVTAAVSKTHSITVWHQ
FT                   VGKGNLQGVKAEYQHLGQDGSVNVAEFIDDMEAAYRWADVVLCRSGALTVSEVAAVGLP
FT                   SLLVPYPHAVDDHQTKNAQVLVQAGGAFLLPQTILDANKLIGKLQILASDRNELAQMGL
FT                   RAKSAAVLDATQKVASVCIRLAGKD"
FT   sig_peptide     479448..479528
FT                   /locus_tag="Ssed_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.959 at
FT                   residue 27"
FT   gene            480547..482016
FT                   /locus_tag="Ssed_0411"
FT   CDS_pept        480547..482016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0411"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /note="KEGG: slo:Shew_3452 UDP-N-acetylmuramate--alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35024"
FT                   /db_xref="GOA:A8FQA1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQA1"
FT                   /protein_id="ABV35024.1"
FT                   /translation="MSKNQEKYSQLRSIIPEMRRVKHIYFVGIGGAGMGGIAEVLVNEG
FT                   YKLSGSDIAENAVTQRLASLGAKIHIGHREEQVHGADVVVVSTAISADNPELLEAQALR
FT                   IPVVQRAEMLAELMRYRHGVAVAGTHGKTTTTSLIASVYGQAERDPTFVIGGLLNSAGT
FT                   NARLGHSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYEGDFEKLKSTFIDFLHN
FT                   LPFYGVAVMCIDDPVVRELLPKVGRKIVTYGFSEDADVQALNFVQEAYLSRFTLRRAGV
FT                   EDMEVVVNLPGQHNVLNALAAIAVATEDEIDDAAIIQALADFQGIGRRFEQLGCFDTNK
FT                   GEMVLVDDYGHHPSEVAATIKAAKAGWPEKRLVMVYQPHRYSRTRDLYDDFVEVLSQVD
FT                   CLLLLDVYAAGESPVPGADSRALCRSIRQRGQLDPIFVSDSEQLLSLLPDVLQAGDLVL
FT                   TQGAGNIGAIAKQLSLSSLGFDLAASGTGKE"
FT   gene            482148..482912
FT                   /locus_tag="Ssed_0412"
FT   CDS_pept        482148..482912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0412"
FT                   /product="polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="KEGG: slo:Shew_3451 polypeptide-transport-associated
FT                   domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35025"
FT                   /db_xref="GOA:A8FQA2"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA2"
FT                   /protein_id="ABV35025.1"
FT                   /translation="MSWAEVGQRWKLRLVQVDWYLCLGLLFLLLVVISLSMGAWKLNLI
FT                   VNDADALPIEAVAIRGERARTSDEEIQVALQDLMKRSFFSADVNQVQDALEALPWVYQA
FT                   SVRREWPAKLKVYLVEQQVVAHWNGDAWLNIHGQIFDAPKRSDIGALPLLAGPEGQSKV
FT                   VLTTYRQVSELLKINGFKLDSLSLSPRHAWHGSLDNGIMLELGREDKMARIQRFINVYP
FT                   TLVKQSKPVAKVDLRYDTGLAVGWENAQKESQ"
FT   gene            482916..484151
FT                   /locus_tag="Ssed_0413"
FT   CDS_pept        482916..484151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0413"
FT                   /product="cell division protein FtsA"
FT                   /note="KEGG: slo:Shew_3450 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35026"
FT                   /db_xref="GOA:A8FQA3"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA3"
FT                   /protein_id="ABV35026.1"
FT                   /translation="MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISVVGLGNHQSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLGISGKHIDCQNENGMVSINDEEV
FT                   TQDDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIKSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSAIASADSVLTNDEKDLGVCLVDIGGGTTDLAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPLSHAEQIKVQFASARSAMVSREDSIEVPSVG
FT                   GRPSRTMSRHTLAEVVEPRYQELFELVLKELRDSGLEDQIAAGIVLTGGTSSIEGTVDV
FT                   AEATFGMPVRVATPLPVKGLFEYVDQPIYSTGVGLLHYGARRVVERQFERPERQGVTSL
FT                   WNRVQSWFKGEF"
FT   gene            484228..485403
FT                   /locus_tag="Ssed_0414"
FT   CDS_pept        484228..485403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0414"
FT                   /product="cell division protein FtsZ"
FT                   /note="KEGG: slo:Shew_3449 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35027"
FT                   /db_xref="GOA:A8FQA4"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA4"
FT                   /protein_id="ABV35027.1"
FT                   /translation="MFEIMDSHTDEAVIKVIGVGGGGGNAIEHMVKHNIEGVEFVATNT
FT                   DAQALRKSSAGSTIQLGRDITKGLGAGANPEIGRLAAEEDKENIRNAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAEVAKEEGILTVAVVTKPFPFEGKKRMSYADQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVASGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKKPDIQLVTKPAPRPEPIVTP
FT                   EVRPETASEEMIAQPMVTGNVVPVAQTAPAPAPKNEADYLDIPAFLRKQAD"
FT   gene            485604..486524
FT                   /locus_tag="Ssed_0415"
FT   CDS_pept        485604..486524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0415"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="KEGG: slo:Shew_3448 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35028"
FT                   /db_xref="GOA:A8FQA5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQA5"
FT                   /protein_id="ABV35028.1"
FT                   /translation="MIFQRTVKEMVKTTGVGLHSGNKVTLSIKPAPVNTGIVLVRTDLE
FT                   PAVAIPAKADLVRETTMCTALVNDEGVRISTIEHLFAALAGLGIDNAVIEVDAPEIPIM
FT                   DGSASPWVFLLQSVGIQEQASAKKYLRIKNTVRVEDGDKWAELKPFKGFRVDFAIDFNH
FT                   PEIARSQQHMVMDFSTSAFVRDISRARTFGFMRDIEYLRANNLALGGSMENAVVLDEYR
FT                   VLNPDGLRYEDEFVKHKILDAFGDLYVAGYAIVGEFCAFKTGHALNNQLVRALLAQQDA
FT                   WELVSFEKDEAPVSFSVPTGAAVFT"
FT   gene            complement(486566..487018)
FT                   /locus_tag="Ssed_0416"
FT   CDS_pept        complement(486566..487018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35029"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA6"
FT                   /protein_id="ABV35029.1"
FT                   /translation="MKKPPQDLSQLLHQQGQMPNLAEKAELLLHLNHYVKQVLAGPVSQ
FT                   QLKVANLRQGVLVIETTSAAWAARINFQKAKILQQLQAETLPMLTAIEVKVNPSLVLYE
FT                   TKPKIPQHHISETAASHIEALAEHTEGSLAEKLKRLAALASRSRQS"
FT   gene            487046..487945
FT                   /locus_tag="Ssed_0417"
FT   CDS_pept        487046..487945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0417"
FT                   /product="peptidase M23B"
FT                   /note="KEGG: slo:Shew_3446 peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35030"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA7"
FT                   /protein_id="ABV35030.1"
FT                   /translation="MSVTVFIQGRNGASRWQPGKRWLLLPVLLIAAGSGLYQHSAKQIL
FT                   QQQTNVDNERVAREAQKNELIELKGATEAQLAMLVTHVARIQAKVTRLEALGQQVAKNN
FT                   QLEDQFDFSSEVGVGGLSELGANIELDQLIADMDKLVSRIDNNNVQLSILETVSSNLHI
FT                   DEERYISGRPIQKGWLSSPYGLRNDPFNGRRTLHKGIDFAGKEGTNVVATAGGVITWAG
FT                   KMFGYGELVEIDHGNGLRTRYGHNKSLLVTVGDVIAKGENIAKMGSTGRSTGPHVHYEV
FT                   LRGGQQIDPQKFVYRKAG"
FT   gene            488005..490728
FT                   /locus_tag="Ssed_0418"
FT   CDS_pept        488005..490728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0418"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: slo:Shew_3445 preprotein translocase, SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35031"
FT                   /db_xref="GOA:A8FQA8"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQA8"
FT                   /protein_id="ABV35031.1"
FT                   /translation="MFGKILTKLFGSRNDRTLKSLGKTVTKINALEDEYEKLTDEELKA
FT                   KTTAFRGRLESGETLDDVMSEAFAVVREASKRVFEMRHFDVQMLGGMVLDSNRIAEMRT
FT                   GEGKTLTATLPAYLNGLTGKGVHVITVNDYLARRDAENNRPLFEFLGLSVGINVAGLGQ
FT                   QEKKAAYDADITYGTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYTKINTLIPHLVRQDKEDTEEEIGDGDYSIDEKAKQVHMTERGQEK
FT                   VEVLLTERGMLAEGDSLYSAANISLLHHVNAALRAHTLFEKDVDYIVQDNEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNFFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVIPTNRPMVRKDHADLVYLTPDEKYAAIIEDIRGCRERGQPVLVGTVS
FT                   IEQSELLARLMKQEKIPHEVLNAKFHEREADIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWAMEIEVLTNPTDEQKAKIKTDWQVRHDEVVAAGGLHILGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSSMMKKLGMEKGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIQDTIVNIQADVVNGLVDQYIPQ
FT                   QSVEELWDVPGLQTRLEQEYGLKMPVQEWLDKEDDLHEETLRERIVDTWVKSYQAKEEM
FT                   VGEQVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QMLETLKHDVISVLSKVQVQAQSDVEEMEERRRQEDAKIQRDYQHASAEAIVGAEEAES
FT                   LSAHTPVVREGEKVGRNDPCPCGSGRKYKQCHGKLT"
FT   gene            491508..493042
FT                   /locus_tag="Ssed_R0010"
FT   rRNA            491508..493042
FT                   /locus_tag="Ssed_R0010"
FT                   /product="16S ribosomal RNA"
FT   gene            493117..493193
FT                   /locus_tag="Ssed_R0011"
FT                   /note="tRNA-Ile1"
FT   tRNA            493117..493193
FT                   /locus_tag="Ssed_R0011"
FT                   /product="tRNA-Ile"
FT   gene            493264..493339
FT                   /locus_tag="Ssed_R0012"
FT                   /note="tRNA-Ala1"
FT   tRNA            493264..493339
FT                   /locus_tag="Ssed_R0012"
FT                   /product="tRNA-Ala"
FT   gene            493682..496577
FT                   /locus_tag="Ssed_R0013"
FT   rRNA            493682..496577
FT                   /locus_tag="Ssed_R0013"
FT                   /product="23S ribosomal RNA"
FT   gene            496718..496833
FT                   /locus_tag="Ssed_R0014"
FT   rRNA            496718..496833
FT                   /locus_tag="Ssed_R0014"
FT                   /product="5S ribosomal RNA"
FT   gene            498850..500384
FT                   /locus_tag="Ssed_R0015"
FT   rRNA            498850..500384
FT                   /locus_tag="Ssed_R0015"
FT                   /product="16S ribosomal RNA"
FT   gene            500734..503629
FT                   /locus_tag="Ssed_R0016"
FT   rRNA            500734..503629
FT                   /locus_tag="Ssed_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            503768..503883
FT                   /locus_tag="Ssed_R0017"
FT   rRNA            503768..503883
FT                   /locus_tag="Ssed_R0017"
FT                   /product="5S ribosomal RNA"
FT   gene            503973..504048
FT                   /locus_tag="Ssed_R0018"
FT                   /note="tRNA-Thr1"
FT   tRNA            503973..504048
FT                   /locus_tag="Ssed_R0018"
FT                   /product="tRNA-Thr"
FT   gene            504068..504183
FT                   /locus_tag="Ssed_R0019"
FT   rRNA            504068..504183
FT                   /locus_tag="Ssed_R0019"
FT                   /product="5S ribosomal RNA"
FT   gene            505889..507423
FT                   /locus_tag="Ssed_R0020"
FT   rRNA            505889..507423
FT                   /locus_tag="Ssed_R0020"
FT                   /product="16S ribosomal RNA"
FT   gene            507763..510658
FT                   /locus_tag="Ssed_R0021"
FT   rRNA            507763..510658
FT                   /locus_tag="Ssed_R0021"
FT                   /product="23S ribosomal RNA"
FT   gene            510797..510912
FT                   /locus_tag="Ssed_R0022"
FT   rRNA            510797..510912
FT                   /locus_tag="Ssed_R0022"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(512380..512769)
FT                   /locus_tag="Ssed_0419"
FT   CDS_pept        complement(512380..512769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0419"
FT                   /product="mutator MutT protein"
FT                   /note="KEGG: slo:Shew_3444 mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35032"
FT                   /db_xref="GOA:A8FQA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQA9"
FT                   /protein_id="ABV35032.1"
FT                   /translation="MKRIHVAVGVVLNNQNQVLLAKRPSHLHQGGKWEFPGGKVESGET
FT                   GSQALIRELREEVNLIVIATSPLMTISHDYPDKEVLLDIHTVNGYSGLAEGLEGQQVLW
FT                   ANVDKLGEYDFPEANTPIIDKLQSL"
FT   gene            complement(512773..512985)
FT                   /locus_tag="Ssed_0420"
FT   CDS_pept        complement(512773..512985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0420"
FT                   /product="protein of unknown function DUF329"
FT                   /note="KEGG: slo:Shew_3443 protein of unknown function
FT                   DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35033"
FT                   /db_xref="GOA:A8FQB0"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQB0"
FT                   /protein_id="ABV35033.1"
FT                   /translation="MTTTVKCPTCQKEVIWNSESKFKPFCSDRCKLIDLGDWASEKHAI
FT                   PVKSEFDPETLDGLGYDEADFFKDQ"
FT   gene            complement(513065..513799)
FT                   /locus_tag="Ssed_0421"
FT   CDS_pept        complement(513065..513799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0421"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="KEGG: slo:Shew_3442 protein of unknown function
FT                   DUF1342"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35034"
FT                   /db_xref="GOA:A8FQB1"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB1"
FT                   /protein_id="ABV35034.1"
FT                   /translation="MTELIYEQPLNEKTRSYLRLEYLEQQLQTNLAHDHQHRCFYPLFS
FT                   LCELTERCDYRGEVLKDIDKQILQLSNWQNLPHIDSRQVSIYLSKLADAREALSVCERP
FT                   GSQLKLNRFLAALRQRFNMPGACCNFDLPQLHYWLAKPWDIRQYEYSEWIGHFTALLVP
FT                   IKLLLDLTRQTTEYSNAVATAGFFQGNSNQALSLIRVKLDSQQGCYPTISGHKNRYAIH
FT                   FVQFDQQKHSDRSIEFKLATCS"
FT   gene            complement(513808..514413)
FT                   /locus_tag="Ssed_0422"
FT   CDS_pept        complement(513808..514413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0422"
FT                   /product="Dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: slo:Shew_3441 dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35035"
FT                   /db_xref="GOA:A8FQB2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB2"
FT                   /protein_id="ABV35035.1"
FT                   /translation="MSKFIVGLTGGIGSGKTTVANMFAELGVELVDADIIAREVVEVGS
FT                   KGLNEISAHFGNTILNKDKSLNRATLRELIFSQPDERQWLNDLMHPMIRSKILKCIEST
FT                   TSPYAILVAPLLFENGLDRLVNLSLLVDISPEQQLDRTIDRDSVSSEQIKNIIDSQAPR
FT                   AERLSKADDVIDNHGKISALKGKVITLHNNYLKLANNT"
FT   gene            complement(514459..515370)
FT                   /locus_tag="Ssed_0423"
FT   CDS_pept        complement(514459..515370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0423"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="KEGG: shn:Shewana3_0417 peptidase A24A domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35036"
FT                   /db_xref="GOA:A8FQB3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB3"
FT                   /protein_id="ABV35036.1"
FT                   /translation="MSEFISILSQNLWLFSIISFIFSAVIGSFLNVVIHRFPVMLKREW
FT                   QQECNQYLNEYHEKLIAPISEQLNNPIDDYPERYNLVVPASACPKCKTNIKPWHNLPIV
FT                   GWLMLKGKCAACGTSISPRYPIIELLTGLAVALLAYHFGPGWEFIFATVLTFVLIALTG
FT                   IDLDEMLLPDQLTLPLLWLGLLINLNGTFASPTDAMIGAAAGYLSLWSVFWAFKLLTGK
FT                   EGMGYGDFKLLAVFGAWFGWQMLPLIILLSSLVGAIVGIGLIVTKKINKTNPIPFGPYI
FT                   AAAGWIAMIWGSDITNWYLSTL"
FT   gene            complement(515443..516708)
FT                   /locus_tag="Ssed_0424"
FT   CDS_pept        complement(515443..516708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0424"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: slo:Shew_3439 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35037"
FT                   /db_xref="GOA:A8FQB4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB4"
FT                   /protein_id="ABV35037.1"
FT                   /translation="MATATAGKAKKSKKKSAKAQPKVFTFEWKGVNRDGKKTSGELRGT
FT                   SAIEIKSQLKLQGVKPKAVRKKANSLFKSEKKITAMDIAMMTRQVATMLSAGVPIVTTL
FT                   ELLGRGHEKPKMRELLATIVGDVQSGIPLSDSLKPHRQYFDDLYVDLVAAGEHSGSLDA
FT                   VFDRIATYREKAEALKSKIKKAMFYPAAVVVVAIAVTALLLLFVVPQFEEIFQGFGAEL
FT                   PAFTQMIVDISRWLQASWYIFVIAIIIAVFSFKRAHLHSQSFRNRVDEFVLKIPAIGDI
FT                   LDKGAMARFARTLSTTFAAGVPLIDGLESSAGASGNYVYRSALLKVRQEVMAGMQMNVA
FT                   MRTTGLFPDMLIQMVMIGEESGGLDEMLNKVANIYEMQVDDAVDGLSSLIEPIMMVVIG
FT                   TLVGGLIVGMYLPIFQMGNVVG"
FT   gene            complement(516774..518483)
FT                   /locus_tag="Ssed_0425"
FT   CDS_pept        complement(516774..518483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0425"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="KEGG: slo:Shew_3438 type IV-A pilus assembly ATPase
FT                   PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35038"
FT                   /db_xref="GOA:A8FQB5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB5"
FT                   /protein_id="ABV35038.1"
FT                   /translation="MPTTGLHLGLSTLFIRKQLLSEEQIASAIAKSRQSKRPLVSTIIS
FT                   EKLISGREIAELCYEEYGTPLLDLDEFDIASIPENFLNKKLIEKHKCLPLFKRGNRLYI
FT                   GTSDPTNIAALEDFQFSAGLHAEAILVEDDKLTKALEKVLEEDISALDIGDIDEDSLAG
FT                   IEIEDTSKRDDDQNGDSSDDAPIVIYINKILTDAIRKGASDLHFEPYEKRYRIRFRIDG
FT                   ILHEVSEPPVNLSNRISARLKVMSKLDIAERRVPQDGRIKMKLSRTKSIDFRVSTLPTI
FT                   WGEKIVMRILDSSSAQLGIEKLGYEDDQRELYEEMLAKPQGMILVTGPTGSGKTVSLYT
FT                   GLNILNTEERNISTAEDPVEINLEGVNQVHINLKAGLTFASALRSFLRQDPDVVMVGEI
FT                   RDLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRLINMGVPGYNIASSVNLIIAQRLAR
FT                   RLCPECKQPEEVPKHELEKLGFNPTHIEAGITVYKPIGCDLCSGGYKGRVGIYEVMRMS
FT                   DEIARTIMEGGNSLQIANQAKEQGMRDLRGSGLLKVIQGVTSIAEINRVTSF"
FT   gene            complement(518556..518966)
FT                   /locus_tag="Ssed_0426"
FT   CDS_pept        complement(518556..518966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0426"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: sfr:Sfri_3782 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35039"
FT                   /db_xref="GOA:A8FQB6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB6"
FT                   /protein_id="ABV35039.1"
FT                   /translation="MKGLNLNKSMKNAKGFTLIELMIVVAIIGILAAIALPAYKDYVAK
FT                   ADASAGVGTLAGSKTKVSEVYSIDGSIGCTDSNGDGIPYCAAADGILATQNEAGTVIIT
FT                   LTPDIASTPGSIEWGCVLSGANAVAIKGCTAP"
FT   sig_peptide     complement(518844..518966)
FT                   /locus_tag="Ssed_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.535 at
FT                   residue 41"
FT   gene            complement(519719..520624)
FT                   /locus_tag="Ssed_0427"
FT   CDS_pept        complement(519719..520624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0427"
FT                   /product="Nicotinate-nucleotide diphosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: shw:Sputw3181_0522 nicotinate-nucleotide
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35040"
FT                   /db_xref="GOA:A8FQB7"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB7"
FT                   /protein_id="ABV35040.1"
FT                   /translation="MLENDIRLSVKTALEEDLGYQDNAAVSGRDKANSDITAQLIPADR
FT                   YAQATLITREEGVFCGKAWAEQVFNQLGGEVALHWHVDDGDLLVPNQLLCELSGPARAI
FT                   LTGERTAMNFIQTLSGVATHTKHYIDKIADTHTKLLDTRKTIPGLRTAQKYAVTCGGGK
FT                   NHRIGLFDAFLIKENHIMACGSISKAISAARALHPDKPVEVEVESIQELQQALEARSDI
FT                   VMLDNFDVTMMLEAVELNNQFFDQLNADKTASKTKLEVSGDVTLDTIANYAKTGVDYIS
FT                   VGALTKHVRALDLSLRLKNT"
FT   gene            520949..521566
FT                   /locus_tag="Ssed_0428"
FT   CDS_pept        520949..521566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0428"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="KEGG: slo:Shew_3434 N-acetylmuramyl-L-alanine
FT                   amidase, negative regulator of AmpC, AmpD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35041"
FT                   /db_xref="GOA:A8FQB8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB8"
FT                   /protein_id="ABV35041.1"
FT                   /translation="MSSHIKTSPPVTAQERSPTDNDICLEKRCADGWINDARRCESPHF
FT                   NHRPLNEVSLLVIHNISLPAGCFGESYIDQLFKGCLDVSADASFIDLKGLEVSAHFLIR
FT                   RDGELVQYVSCGDRAWHAGVSSYGSREGCNDFAIGIELEGTDTLAYTEQQYRELKILTL
FT                   ALFDAYPMLNIDRVVGHCDIAPGRKTDPGESFDWQRFKKDLS"
FT   gene            521706..522557
FT                   /locus_tag="Ssed_0429"
FT   CDS_pept        521706..522557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0429"
FT                   /product="signaling modulator of AmpD, AmpE"
FT                   /note="KEGG: slo:Shew_3433 signaling modulator of AmpD,
FT                   AmpE"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35042"
FT                   /db_xref="GOA:A8FQB9"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQB9"
FT                   /protein_id="ABV35042.1"
FT                   /translation="MALFSLLVAIIVERLKLLPKSWQLESFLSVYSNSLFGEKQLNSEV
FT                   MMALALVLPAVAVQVATWAVAGLFWGALSLLLWVAVSILCFSHLKQRQTFKRYMQAACR
FT                   GDSQACYHFAEELDCNRSIEAVSEGDLGAKVGQSVAWLNYRFYGAVALFLIFFGPAGAV
FT                   FYCTVRYFSDENHQKLLEQPLVGQVLTLLDWLPSRVFAFGYVLSGQFSQAFASWREFGF
FT                   SLKYGAREVVTQVALAAEPSPEPSAKPICVQATLALLQLSKRNFILLLTTLSLLTIFGV
FT                   VA"
FT   gene            522956..523708
FT                   /locus_tag="Ssed_0430"
FT   CDS_pept        522956..523708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0430"
FT                   /product="regulatory protein GntR, HTH"
FT                   /note="KEGG: shn:Shewana3_0425 regulatory protein GntR,
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35043"
FT                   /db_xref="GOA:A8FQC0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC0"
FT                   /protein_id="ABV35043.1"
FT                   /translation="MAYSKINQPKISDVIMGQLEQMILEGSLQPGQKLPPERELALQFE
FT                   VSRPSLREAIQKLEAKGLLLRRQGGGTYVKEQLWQSLADPIVELMHSDSESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRTIMEVDAASEIEQQAEAIVKFYRAVAEASHNVAM
FT                   LHLVLSLAPVLHKNVAQNLELLNRREEASKMANDHRLALLAAIVRRDPEAAREASNEHL
FT                   SYIEEVMLSVREEDSRLQRSLRRLKSGV"
FT   gene            523795..526461
FT                   /locus_tag="Ssed_0431"
FT   CDS_pept        523795..526461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0431"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: slo:Shew_3431 2-oxo-acid dehydrogenase E1
FT                   subunit, homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35044"
FT                   /db_xref="GOA:A8FQC1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC1"
FT                   /protein_id="ABV35044.1"
FT                   /translation="MSEHMLQDLDPLETQEWVDSLQAVLEQEGPERAHYLLEKLIDKAR
FT                   RNGTHLPYKATTAYLNTIPAGQEPHVPGNQEMERRIRAIVRWNALAMVLRGSKKDLELG
FT                   GHISSFASSATIYDVCFNHFFRGPNEKDGGDLVYFQGHIAPGIYSRSFLEGRLTEDQMN
FT                   SFRQEVDGKGLPSYPHPKLMPDYWQFPTVSMGLGPIQAIYQARFLKYLTDRGLKDCSEQ
FT                   TVYCFLGDGECDEPETLGAIGLAAREELDNLVFIVNCNLQRLDGPVRGNGKIIQELEGE
FT                   FRGAGWEAVKVIWGRYWDPLLARDTSGKLLQLMEETVDGEYQNCKAKGGAYTREHFFGK
FT                   YPETAEMVANMSDDDIWRLNRGGHDPVKIFAALQHAKDTKGRPTVILAKTVKGYGMGDA
FT                   GEGKNIAHNVKKMGVESLKYFRDRFNIPISDDQLEDIPFYHPGADSEEVKYLKARRAEL
FT                   HGAMPARREKFSEELEVPSLKIFDSVLKGSNGREISSTMAFVRILTALLKDKKIGKQIV
FT                   PIIPDEARTFGMEGLFRQVGIYAHEGQKYVPQDSDQVAYYREDKSGQVLQEGINELGAM
FT                   SSWVAAATSYSVNDTPMIPFYIYYSMFGFQRIGDMAWAAGDMRARGFMVGGTSGRTTLN
FT                   GEGLQHQDGHSHVLANTIPSCVSYDPTYGYEIAVVVQDGIRRMYGEQQEDIFYYLTTMN
FT                   ENYEQPAMPEGAEEGIVKGIYKLETVEGSGKGKVQLMGCGTILEQVRKAAQALAKDFGI
FT                   SADVFSVTSFNELTRDGQAAERYNMLHPTETPQEAYISQVISSESPAIVATDYMKIYGE
FT                   QLRAYIPTDYKVLGTDGFGRSDSRENLRHHFEVDAKFIVIASLKSLVDRNELPVDVLTK
FT                   AISEYGIDVDKINPQYA"
FT   gene            526474..528111
FT                   /locus_tag="Ssed_0432"
FT   CDS_pept        526474..528111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0432"
FT                   /product="Dihydrolipoyllysine-residue succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="KEGG: slo:Shew_3430 pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35045"
FT                   /db_xref="GOA:A8FQC2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC2"
FT                   /protein_id="ABV35045.1"
FT                   /translation="MSELKEVLVPDIGGDDVQVIEICVAVGDQLAAEESIITVESDKAT
FT                   MDIPAPFAGTLAELKIAVGDTVSEGTLIAMMSAQGASTEVTAATAAPEPTPVAPAAPVD
FT                   AAPVPASTATQVIEVKVPDIGDAADVEIIEVLVAVGDSIDVDTGLITLETDKATMEVPA
FT                   PSAGVVKELKVAVGDKVSEGSLVLMLEVGASAPAAIVAPVEAPVVAPVAQPAQAATSKP
FT                   PVPHHPSAGSKPVTGAVHASPAVRRLAREFGADMTLVKGTGRKGRILKEDVQAFIKYEL
FT                   SRPKASAATAVAGGAGGLNVIAAPKVDFAKFGEIEEVPLTRIQKISGPNLHRNWVTIPH
FT                   VTQFDEADITEMEAFRKQQNELAAKRKTGIKITPLVFMMKAVAKTLQAFPVFNASLSAD
FT                   GESLIKKKYYHIGVAVDTPNGLVVPVVRDVDKKGIHELTQELTEISIKARDGKLKSADM
FT                   QGSCFTISSLGGIGGTAFTPIVNYPDVAILGVSKSEIKPKWNGKDFEPKLMLPLSLSYD
FT                   HRVIDGAMAARFSVTLSSMLSDIRTLIL"
FT   gene            528266..529693
FT                   /locus_tag="Ssed_0433"
FT   CDS_pept        528266..529693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0433"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: slo:Shew_3429 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35046"
FT                   /db_xref="GOA:A8FQC3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC3"
FT                   /protein_id="ABV35046.1"
FT                   /translation="MSNEIKTQVLVVGAGPAGYSAAFRAADLGLEVIIVERFNTLGGVC
FT                   LNVGCIPSKALLHVSKVIEEAKAVASHGVVFGEPQIDLDKLRSFKETVISQLTTGLGGM
FT                   SKMRKVDVVNGFGKFTSPNTIEVTGEDGVKVIRFEQAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPGKLLVMGGGIIGLEMGTVYSSLGSEIDVVEMFDQVIPAADKDIVRVY
FT                   TKKIKKKFNLILQTKVTAVEAKEDGIYVSMEGKKAPAEPVRYDAVLVAIGRTPNGKLID
FT                   AEKAGVNIDERGFINVDKQMRTNVPNIYAIGDIVGQPMLAHKGVHEGHVAAEVISGLKH
FT                   FFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGVAYETATFPWAASGRAIASDCSDGMTKL
FT                   IFDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEI
FT                   YEGSITDLPNPKAKKKK"
FT   gene            529824..534281
FT                   /locus_tag="Ssed_0434"
FT   CDS_pept        529824..534281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0434"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: slo:Shew_3428 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35047"
FT                   /db_xref="GOA:A8FQC4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC4"
FT                   /protein_id="ABV35047.1"
FT                   /translation="MQIAYVKKILFPLLLLLTCLAPVMAGDLVSRVFNEREGLTNSQIN
FT                   DISFDEYGFVWLATDEGLYRLSNSKVRRIDKVEFDLRLSDEYINIVEPLSQKHLLVSNY
FT                   SENYLYDILANRFIKFGSDELFPEFKGESIVAQVKRADGSYLFLTREGEMLQYSYQPSS
FT                   LERIIFLPNNADVLWHNLVALDDGRIMVGTEYELQLRDSKGRRIAVLPWEEKNGLMKWL
FT                   FKDSKGRVWLSSSNGLYRVDVDNLQINPVKELPYYTTKIAEDNNGDLWISSHIGLIKWP
FT                   PGSTEHKLFQKQLKQSADIDYINDIAIDNTGVIWVGGSGDGLAVLADDPGFLIDRFTMS
FT                   EPYHLSNEMIWTIFAEDENIWLGTDNGLIVIDKKNKQSRTLVPDGIELNDSIYKIDPLD
FT                   SHHLLLSTTTGLFVVDKRNFTSQRFAQWAQGDYSLEHKVVYTSYNDPLIEGRWWFLTMT
FT                   GLYFWEPGMLNPQERLISGERTQAGIRDLRALFRDESGRLWIGGGDFFGFLDSEGQFHS
FT                   RINIFSDEDIDIEVNYIKQVESGVFWLGTSPSGLFEYAPASGRVKALDKKWLTDCSSVF
FT                   FIHQTDKHRVIGCPYSIIRQEIESNNILVIDEDDGLIGDELNDGAYFYDPAYGLYLGTP
FT                   DGAMALNIDDLSNRIQRDKVFLEAVSVFYDDDTQIDLIPQADTVILPGARLISFQVTSL
FT                   DYLDDTPMTLQYRLRREGDRSESHYLLLEGQSQLNITGLSSGKYHLDILSQENGIWSKV
FT                   PHTFEFRVKQFWWQTQWFNGLILFTVLCIGIGVIVYRQRQVKAFKLVNSALVESEDRLR
FT                   QSLKGSDSELWEWRHDTQMFSLENRGAKRKEDRKNKLLKLKDFPVHRDEKDKVLASWNN
FT                   MIEGYSDRFDVEYRYRREDKTWGWTRVRGRPVELDPASGKILRVAGIYSDITAQRQLED
FT                   DVKLLAQAFGNTSEGVLILDASERIKVSNKAAQTIIGSDARVLTHKYFSDLMVAKEGRS
FT                   DEIAHLLDQGVSWTGEREFVCTNGSSCPVWLNVSTMLGGKGDITHYVAVFSDITERKRT
FT                   EADLRRLANYDVLTGLPNRSLFSTRLAQSIHRAEHSGEKLALIFLDLDRFKHVNDSYGH
FT                   SMGDALLVEAASRLQSCISEEHTLCRFGGDEFVLLIRDADNIDKINHVCTELLVQIEAP
FT                   FELFGREFFISTSIGVSLWPDDTRQPEVLIKNADQAMYHAKEEGRGNFQYFSSERNAEA
FT                   LYHLRLEGELRKAIERDEFELHYQPQVDILRGDKLIGMEALLRWRHHKDGLVRTDVFIK
FT                   VAESCGLIIDIDRWVLRQACVQGALWANSYKENFKLSVNISAVHFRQPDFIDGVRSILE
FT                   ETKIPPSALGFEITEGVLMKELHIAKDHLRDLRELGIDVAIDDFGTGYSSLAYLRHFDV
FT                   DTLKIDRSFLIDIATNETDQAIASSIIELARNLKLNVVAEGVETKDQLEQVFSRGCYVI
FT                   QGYYFSKPLTVSDMESYMGLKKAE"
FT   sig_peptide     529824..529901
FT                   /locus_tag="Ssed_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            534359..536614
FT                   /locus_tag="Ssed_0435"
FT   CDS_pept        534359..536614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0435"
FT                   /product="patatin"
FT                   /note="KEGG: slo:Shew_3427 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35048"
FT                   /db_xref="GOA:A8FQC5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC5"
FT                   /protein_id="ABV35048.1"
FT                   /translation="MPALYQLIIKNQYPMIRNLIFLLVVSFIAAPVMADVRPKVGLVLS
FT                   GGGAKGAAHIGVLKVLEENKIPVDYIAGTSIGAYVAGMYALGYSAIEIEKIMMTESWSD
FT                   GYSDTIPRESLSYRNKQQRDRFNIPVNMGYSDDEMKMPNGLLRGQTMSKLLQRSTGLVH
FT                   QFGHFNELAIPYRAVATDLVTSKAVVINNGSVVKAMQASATVPGALQPVEYEGKLLVDG
FT                   GIANNMPIDVVMGMGADIIIAVDIGSSLVKKEELNSTVAVLNQLSTMLTNASSERQKLL
FT                   LGKGDILIRPKVGDMSTTDFSIMPQAYALGESAALEHIDLLKQLSVTESQYASYQQAKK
FT                   RISKTWLNEVDHPLVDIVFNNESRVSDSLLREAFGIHPGEVVTTERLEQGIANVYALDK
FT                   FELVNAEFSDTEQGRVLTLNTKSKSWGPNYFQLGFSWEDDFSLDSVVSLDLAYTLTDIT
FT                   DTGGEWRNELRLGFEKLIATEFYLPLDYDQEFFSRAKLAYEQKDWDFYEQNAKTLQLSQ
FT                   TQYRADIGIGYNFVKEGMVELGITGEKGVLENKAIIDELKYETYGAYFKFGFDDLNSIN
FT                   FPTSGNRFTLNLYYRNESAPDFLGFDTNENSFQIEADWRGALSFGNHAFVGIASLATVD
FT                   KDDSFSVHVSELGGFLNLSGYHKNALVGAHKVFGAFVYQYDLGRDVLGMTDYPLYLGTS
FT                   IEAGNVWEYRDGVDLDDLIYSGSLYFGTDTSMGPAALGFGWADDGEMTIFIFIGKNW"
FT   sig_peptide     534359..534463
FT                   /locus_tag="Ssed_0435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 35"
FT   gene            536775..538829
FT                   /locus_tag="Ssed_0436"
FT   CDS_pept        536775..538829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0436"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="KEGG: slo:Shew_3426 endothelin-converting enzyme 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35049"
FT                   /db_xref="GOA:A8FQC6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC6"
FT                   /protein_id="ABV35049.1"
FT                   /translation="MNRVSKLAIGIALSLGLAACSSNEPTTTVAEEVTKVSGVEQENFD
FT                   NAVRHQDDFYYSVNGHWLANTPIPADKSNYGAFSVLYEQSQNALKKIIDEAAAKQDKVA
FT                   GSSEQKVGDFYASYMNTDVIEKLGISPLSDLLSDISSAKTHKDIAGLMGSLLNSGVQMP
FT                   FGFYVNNDAKNSSQYAVYLYQSGLTLPDRDYYLKDDEKFVANRAALNAYVADIMAQAGS
FT                   QDAERVAASVAKIEHFIAQSQWSRVESRDANKSYNMMDSAELQATVSSFDFAQFAANAN
FT                   MSSVKEAVVRQPSYFEKFGAQFNEFTVSEWQDYLSFHLVDSYGELLSKNFVDLHFAFHS
FT                   KTLMGIEAQKPRWKKAVDAADQVIGELVGKEYVKQHFKPEAKEKMEELIQNLIKGFEVS
FT                   INELEWMTPETKIAAQEKLSKFTYKIGYPDKWKDYTDLSIKADQLVGNIQRYSKFEYKT
FT                   MLNKLGKPIDRTEWHMTPQTVNAYYSPVMNEIVFPAAILQPPFFNMDADDAINYGGIGA
FT                   VIGHEISHGFDDQGAKYDGDGNLRDWWTDKDREEFQKRGAQLSAQYSSYEALPGKHVNG
FT                   DLTLGENIGDLGGLTVAARSYHLSLNGKESPVIEGLTGEQRLFIGWSQVWRRNYRDEEL
FT                   GRRLMTDSHSPSHFRAMGTPRNIPAFYQAFDLKEGDKMFLSPEDRVKIW"
FT   sig_peptide     536775..536843
FT                   /locus_tag="Ssed_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.348 at
FT                   residue 23"
FT   gene            complement(539133..539798)
FT                   /locus_tag="Ssed_0437"
FT   CDS_pept        complement(539133..539798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0437"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: shm:Shewmr7_3593 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35050"
FT                   /db_xref="GOA:A8FQC7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC7"
FT                   /protein_id="ABV35050.1"
FT                   /translation="MTSSRLSAIIFDMDGILIDSEPTWQKAEFQTMRELGLEISFDDTL
FT                   QTTGLRIDQVVSYWYQRFPWDNYDNREVSRKIVDQVVSYINKDGIAMAGVISALDYCQE
FT                   KNLKIGLATSSSHAIVDAVLNKLDISHYFNSTQSAEHLAYGKPHPEVYLNCALELGISP
FT                   TKCIAVEDSFNGLVAARAANMQTLAIPAPEQRLESKWIIAHQQLADLTKLPEYLDGKI"
FT   gene            540214..542811
FT                   /locus_tag="Ssed_0438"
FT   CDS_pept        540214..542811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0438"
FT                   /product="aconitate hydratase"
FT                   /note="KEGG: slo:Shew_3424 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35051"
FT                   /db_xref="GOA:A8FQC8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC8"
FT                   /protein_id="ABV35051.1"
FT                   /translation="MLEAYRKHVEERASEGVVPKPLDAHQVAELVELVKNPPAGEEEFI
FT                   LDLLENRIPPGVDEAAYVKAGFLDAVAKGEAKSSILSSARAVELLGTMLGGYNIQPLIA
FT                   QLDVAEQAPLAVTALSKTLLMFDAFHDVAEKMQAGNEFAKQVVHSWAEAQWFLNRPKLE
FT                   EKISLTVFKVSGETNTDDLSPAPDAWSRPDIPLHALAMLKNTREGIVPDEAGVIGPIKE
FT                   IDQLKTKGFPLVYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRAGGFCLGGKIAPI
FT                   FFNTMEDAGALPIELDVSKMNMGDVIDIYPYQGVVKRHDSDEVISEFALKTDVLMDEVR
FT                   AGGRIPLIIGRGLTARAREVLKLEASTVFVLPQDVADTGKGYTLAQKMVGKACGVTGIR
FT                   PGQYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGEMQPGITLRDLVHAIPHKAIELGLLTVEKQGKINFFSG
FT                   RVLEIEGLESLKVEQAFELSDASAERSAAGCSIKLDKEPVIEYLNSNIVMLKWMIAEGY
FT                   GDRRTIERRIIAMQEWLENPELMEADSDAEYAAVIEIDLNDIKEPILCAPNDPDDAVLL
FT                   SEVKDTKIDEVFVGSCMTNIGHFRATGKMLDKFATTLPTRLWITPPTKMDRDQLTEEGY
FT                   YAIFGRVGARVEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVYLASAELAA
FT                   VAALLGRLPSSDEYQEYAKQLDATAADTYRYLNFDKMSSYTEKAGEVIFQSAV"
FT   gene            complement(542997..543464)
FT                   /locus_tag="Ssed_0439"
FT   CDS_pept        complement(542997..543464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0439"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="KEGG: slo:Shew_3423 regulator of RpoD, Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35052"
FT                   /db_xref="GOA:A8FQC9"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQC9"
FT                   /protein_id="ABV35052.1"
FT                   /translation="MLRQLEKAEQKWGGSNTLIDHWLNNRRKLLVNYCQIAGIPPYEPT
FT                   EKSLPAITAIKEFCDLLMDYVSEGHFEVYDRVVTACEKHGISSQTLAQNLVPRISETTD
FT                   SALDFNDKYTEFVDDKVLFQLDKDLSSLGHAMETRFELEDQLLEVLHTKHS"
FT   gene            543991..545055
FT                   /locus_tag="Ssed_0440"
FT   CDS_pept        543991..545055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0440"
FT                   /product="Uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: sdn:Sden_0468 uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35053"
FT                   /db_xref="GOA:A8FQD0"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQD0"
FT                   /protein_id="ABV35053.1"
FT                   /translation="MAELKNDRYLRALLKQPVDRTPVWMMRQAGRYLPEYKATRAEAGD
FT                   FMSLCKNQDLACEVTLQPLRRYDLDAAILFSDILTVPDAMGLGLYFETGEGPRFQRPTD
FT                   TIDSIKKLCIPDPEDELGYVMRAVSTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKT
FT                   FEKIKKMAYEEPATLHLLLDKLADSVILYLNAQVANGAQSLMIFDSWGGALSHHAYREF
FT                   SLRYMQKIVDGLTRHADGRQVPVTLFTKGGGLWLESMAETGCDALGLDWTVDIGDARRR
FT                   VGHKVALQGNMDPSVLYASPERIHQEVDQILSSYGEGTGHVFNLGHGIHQHVDPEHAGS
FT                   FINSVHELSAQYHK"
FT   gene            545598..548210
FT                   /locus_tag="Ssed_0441"
FT   CDS_pept        545598..548210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0441"
FT                   /product="sensory box protein"
FT                   /note="KEGG: son:SO0437 sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35054"
FT                   /db_xref="GOA:A8FQD1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD1"
FT                   /protein_id="ABV35054.1"
FT                   /translation="MRIGKKLIVFIVGFCLPAVISVSYCLSMWFDHRVDTFKNSAVNIE
FT                   LSTIKTQIEKDINQLQLLANVYALPLSKLAIEERKLLDEAWRDSQLAEHLSLFYLNNGE
FT                   LQPFSPIYDDIMSFEFDTVPVQLKHATQPLSGIYMLQDKSFIVSLVPVSQSRSIILARQ
FT                   LTPEYLSSYGLKGLVSHINLVPGESSLVYDVNSDKPISSIKVPSLVFESPVHLEIQFAE
FT                   NAFNQVKLKYDLVTFSIVGVGLLILIIGYIWLKLGLIRPFRRLMTQVADIDPIAKTYTP
FT                   LVGSGCSELVIMAERVNTLLARIFQQKERFKTTLESIAEAVILTDIGAKVVYLNPQAER
FT                   LLGVKGESAIGVSVDSLVKTDKSIKDDLFEFMFSQAQQPVLSKLKLKTDKTRILERSIS
FT                   NLLNQQRIVIGTVIVLRDITREELLKRQLRQKANFDSITSLLNRRAFEERLEKFSHDAQ
FT                   SIAICYFDLEQFKLINDSCGHSAGDTMLAMVAKAMQSCLSKDEMLARLGGDEFGLAIRD
FT                   HNASEVAQLVKRIVSSVSMQVLRDNGCHYKVGVSAGVAIARAPYISPKELIKDADVACI
FT                   AAKRKGSNQVHFYDDNDKESIYQRNAPMWAVRIGQAIEHNELLLYYQPIKGMGPGEHKQ
FT                   RMEILLRIQEPCGRILSPAQFIEAAERFKLMNDVDKEVIRKAFLWLSLHEEIWDDHCIS
FT                   INLSGNSLGAEGMVEYIAEQFKRFEIPSKCICFEITETSAIQNRNRAMDMLNYLRKLGF
FT                   SFALDDFGTGFASYGYLKELPVDYVKIDGCFVKSLATNAKDFAIVKSIHDVCDVMGIET
FT                   VAEFVENQDIIDRLEDIGINYAQGYAIGRPKPLETYIELRRSRGQPLQAKPALELISA"
FT   sig_peptide     545598..545681
FT                   /locus_tag="Ssed_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.820 at
FT                   residue 28"
FT   gene            complement(548378..551380)
FT                   /locus_tag="Ssed_0442"
FT   CDS_pept        complement(548378..551380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35055"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD2"
FT                   /protein_id="ABV35055.1"
FT                   /translation="MRYLLLMITFLITACGGGGDDDTTTPTQEKLTHPGLSALDIRVDY
FT                   SPDGSLTPVLSGSQGNISFSLADGAANDVVRVNQNSLTILNVGQTKLIVTDSGNSQYKA
FT                   TSRSLNVSVDRASRDPLLTNNYSYPYAAGAIHQVGVSGAKGQLLYELSTGYPDDVVKID
FT                   IAGSLIVWGEGQTQVTVKDDGGRNYQASESQFSITVEAANSQFASYRDITNKPLVFGGT
FT                   LLPVYSGSPTSEISYAIAENASQDVVQIHPITGVMNIKGAGETEIVVSQTAEDNHQDIA
FT                   KQTFKVRINKADNTDFIANDLTLPYGFDDEPRLQTIGAQGTLTFEIVDGESTDVINFIN
FT                   SETGQYRFSGIGETKVKITDSGNRNYLSKTVITTVNVERVQSVPLSSVNLESAYQQNKV
FT                   ISAQVASRQGKLSFSLAKDSATDVVSIDALSGEMTVLKPGKAEITVTDDGDLFYIPQTT
FT                   SFFVTINKLVNDQFSVDDDLYDNVANTVYTPVAKGSQGPVTYAISANSTANVLSQDPTT
FT                   KVITLTGAGRGWITATDHGNDYYQSQTTDFIVDVGYADGTLKPLAISAGYAPNKVVTIP
FT                   VSGVVGQLSSQLERGQPDDVVNIDIVNRTVTIKNAGTTYYTLTDSGSAAIAPRRVQLRV
FT                   TIAKAAANVDLSLTSTLIDTIYEEGKQLSSPAVSGSATESTIKYYVDYSDRQVVTADSS
FT                   SGALTIKGAGSAQVQVTEVSRNFEDTTRSFTVNVGKAKHPGLTVAKQVPGASYYPGLEM
FT                   APAELGNQFGELSFKFTHTEKPETYELTRNGTLRVLKYAASRTNTSVRITVTDDGGDDY
FT                   LPSSVDYDVYVNPIEEGTGEKSVFTFDGTELSITSPIDVAAGDVTYFSASDTRSEAETM
FT                   GDNLQKSGGYATQRVTVCHDPSVLTTCTLVTVRLQNTSHCPDGSKIAYPVGAKIRYECP
FT                   GLKQPINSEVMVSFDKTDLFNPSLAVGTYQALEPITLVHFAKPYRAGGVIEMGDIQARA
FT                   WWLIKVNLTVN"
FT   sig_peptide     complement(551321..551380)
FT                   /locus_tag="Ssed_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.458 at
FT                   residue 20"
FT   gene            complement(551686..552978)
FT                   /locus_tag="Ssed_0443"
FT   CDS_pept        complement(551686..552978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0443"
FT                   /product="Phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: slo:Shew_3413 phosphoribosylamine--glycine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35056"
FT                   /db_xref="GOA:A8FQD3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD3"
FT                   /protein_id="ABV35056.1"
FT                   /translation="MNVLVIGGGGREHALAWKAAQSAQVEKVFVAPGNAGTSLEPKLEN
FT                   VAINVEEISALVAFAQEKAIEITIVGPEVPLALGVVDAFNEAGLPIFGPTQGAAQLESS
FT                   KAFTKDFLARHNIPTAAYSNFTEIAPAKAYVTEVTAMTGFPIVIKADGLAAGKGVIIAE
FT                   DQAAADAAIEDMLAGNKFGEAGSRVVIEEFLKGEEASFIVMVDGKNILAMATSQDHKAR
FT                   DNGDHGPNTGGMGAYSPAPVVTQAVHDWTINNVIRPTVDGMAAEGNVYTGFLYAGLMIA
FT                   PDGSAKVLEYNCRFGDPETQPIMMRLKSDLVELCLAATRGELNKVTAEFDERAAVGVVL
FT                   AAGGYPEAYRKHDVIDGLDLGNNNAKVFHAGTCMKDGHVVTNGGRVLCATALGNNVTEA
FT                   QQAAYGLVDKIHWDDVYFRTDIAYRAISRES"
FT   gene            complement(553060..554664)
FT                   /locus_tag="Ssed_0444"
FT   CDS_pept        complement(553060..554664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0444"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: slo:Shew_3412
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35057"
FT                   /db_xref="GOA:A8FQD4"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQD4"
FT                   /protein_id="ABV35057.1"
FT                   /translation="MNNARPIRRALLSVSDKTGILEFAKSLHAQGVELLSTGGTARLLA
FT                   DNGVPVIEVSDHTGHPEIMDGRVKTLHPKVHGGILARRGIDELVMEQNNIKPIDLVAVN
FT                   LYPFAETVAKEGCTLADAVENIDIGGPTMVRSTAKNHKDTTIIVNASDYDRVIVEMNAN
FT                   EGSTTLETRFDLAIAAFEHTAAYDGMIANYFGTQVPAHSKDECHHDSKFPRTYNTQLVK
FT                   KQDLRYGENSHQTAAFYVDSPSFNGQGDEASVASAIQLQGKALSYNNIADTDSALECVK
FT                   EFSEPACVIVKHANPCGVAIGSDLLDAYNRAFKTDPTSAFGGIIAFNGELDAATASAIV
FT                   ERQFVEVIIAPKVSQAARDIVAAKANLRLLECGEWNTKTTSLDYKRVNGGLLLQDRDQG
FT                   MVGLDDVKVVSKRQPTAAEMKDLMFCWKVAKFVKSNAIVYAKDSMTIGVGAGQMSRVYS
FT                   AKVAGIKAADEGLEVQDSVMASDAFFPFRDGIDAAAAAGISCIIQPGGSIRDEEIIAAA
FT                   DEHGMAMVFTGMRHFRH"
FT   gene            555335..555814
FT                   /locus_tag="Ssed_0445"
FT   CDS_pept        555335..555814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0445"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: slo:Shew_3411 transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35058"
FT                   /db_xref="GOA:A8FQD5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011788"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD5"
FT                   /protein_id="ABV35058.1"
FT                   /translation="MYRIGELAKLCEVKADTLRFYEKHGLLAPSSRSDSGYRLYSESDA
FT                   ERLRFILRAKAVGFTLAEITELLSIELDKSNWACADVKGLVDSKLAQVNEKISELNHFQ
FT                   VSLQRLSDACCGGPESAEHCSILEALETNTDNIKCENHAHHHDKSQYTKNCQSKG"
FT   gene            555817..557118
FT                   /locus_tag="Ssed_0446"
FT   CDS_pept        555817..557118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0446"
FT                   /product="permease"
FT                   /note="KEGG: slo:Shew_3410 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35059"
FT                   /db_xref="GOA:A8FQD6"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD6"
FT                   /protein_id="ABV35059.1"
FT                   /translation="MLLANFIDLFLDSAPWLLLGLVLAGMLKMFVPMVWMQKQLGGHGF
FT                   KTVVKAAVLGAPLPLCSCGVIPAAVGLRRSGASKAATTSFLVSTPETGVDSVTVSYVLL
FT                   GPFMAVVRPIAAVISAIVAGLLVGRDDDTPTEVKPKVKESGEVSGSCCGSKNEASKKAV
FT                   TMTPMAATEPLLSGVKPASTSCCSSKEKAKEPEVSPCCSSKIKVEEPKASCCSSQKSDA
FT                   SDKSESCCESTKDVATELKGTSVISRIGKGLHFAATDLVRDTTVWLLIGLFFAALVQTY
FT                   VPGDFMAKWGDGILAMLVMVLISIPMYICATASTPIAAGLLLAGVSPGAVLVFMLAGPA
FT                   TNIATLGVVTKELGKRALFGYLGGVLGVALVSGILVNYLVATFGFEVMPQIGEQHNLLP
FT                   SVVVYTSGVVLAILMLKVLLEKLPKNWWRRDCCS"
FT   gene            557633..559471
FT                   /locus_tag="Ssed_0447"
FT   CDS_pept        557633..559471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35060"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD7"
FT                   /protein_id="ABV35060.1"
FT                   /translation="MKVLNKRYLALVVAGAMGLSACGSDGKDGEDGTTPPPPTVGGSQV
FT                   TNVEMLSHTLEEGLVRFEFEITNEEGVLITGLEEASAEVAALTEKGIQRSRDGSVGGSA
FT                   NVSTEGASLTMTQDGRYEFIAPMAAVNAGTEGLIRLAVGGGDNIAKSRYIVVDKTENIH
FT                   TTSTATCQSCHVDFLASSIKHSSYTAINAEGETDLVAGCMACHNHVPRDVDDSGSSLNT
FT                   GGYAKNSLQKIGHINHQKFEKDFAPSNCYTCHAEPIETVYSQQTCIDCHDTANVETSNL
FT                   AATFNSFNEGSDMRLFHKKIAEKKAVHEEHSLATSQVYNNELGEFCTDISLFKGEEQLD
FT                   LEGLTSDGTISYIGAYLHGYENASIVGRAARSYSATFDAAGSATLCFSSLDELFPEIIA
FT                   SSRVTFNFGEDAGYDGVTLHGYSDALSGTEYARRHSVTADSCTTCHTNGSNYHKNGSYN
FT                   DGGLGCVACHNNGQDRNAKSSAPGFGPMVHSMHWGVGNTATDPDGEANSAAKLNAENCV
FT                   ACHAEGIDIDAIPNQYILSKAYNGGESGVMTSPVTANCFACHNDDSAKNHMLQQGGEIN
FT                   VEKLEDWYTLPTSESCSTCHAEGKSYGIEKFHVFER"
FT   sig_peptide     557633..557704
FT                   /locus_tag="Ssed_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.802 at
FT                   residue 24"
FT   gene            559788..561824
FT                   /locus_tag="Ssed_0448"
FT   CDS_pept        559788..561824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0448"
FT                   /product="peptidase"
FT                   /note="KEGG: pha:PSHAa1953 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35061"
FT                   /db_xref="GOA:A8FQD8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD8"
FT                   /protein_id="ABV35061.1"
FT                   /translation="MDFLTNDFELKIWDIKEGNMKTSLHLSALALAVTLGLGLTGCSNT
FT                   AKSSNELVASEPSNVQTSVQKYDAKTFFETTTYFGSSFSADGRSILMGSDETGIFNLYK
FT                   MDVASGNKVALTNFKDTTYPISWFPNDDRVLLTQDNGGNELYHLFVREIDGTITDLTDS
FT                   ENTRANFVNFTNDGEFFYATTNERDPKFMDLYRYDAKTYKRTLVFKNELGFEISEVSPD
FT                   GYFLSLAKTHTNRDSDTYLLDFRKRTLKPTLISEHQDPANYSPMTFSSDSQFLYYSTDA
FT                   KGEFAQVWQYDIASGEHVLAVKDDWNVSFVYFSESGKYRVSGVNADASTRISILDTESG
FT                   KKVSLPQLPGGDLRSVNFSKDESTLSFYINSDTSPSNLFVWKMDSESAKQLTQALNPKI
FT                   NPQDLVASEVVRFKSFDGLEVPGLLFKPKGASADNKRPAVVFVHGGPGGQSRTGYSAMR
FT                   QHLINHGYAVFAVNNRGSSGYGKTFFHLDDKNHGENDLQDIVYGKRYLQGLDWVDADKI
FT                   GIMGGSYGGYMTAAALAFEPEEFKVGIDIFGVTNWVRTLESIPPWWESFKKALYDEMGD
FT                   PATDAERHRAISPLFHAQNITKPLMVIQGANDPRVLKIESDELVEKVKQNGVPVEYVVF
FT                   DDEGHGFSKKNNRITASEAYVKFLDTYLKGDGSQLPGERVATK"
FT   gene            complement(561951..562967)
FT                   /locus_tag="Ssed_0449"
FT   CDS_pept        complement(561951..562967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0449"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: slo:Shew_3409 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35062"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQD9"
FT                   /protein_id="ABV35062.1"
FT                   /translation="MKHTKTILAITLTSLLAACGGSDDNSSPDPESGIFNLGVSDNPAD
FT                   AEIVNIAFKQVVLKNDEGSISFDAIEGGGLKHVDLLTVQGAEVATLVSGESVPVGEYQM
FT                   CIYMQNNEAAASGSSYVETADGIAGLTTNSNGSCGGVGAEDPDTGRLFLNKTFTIEEGS
FT                   NTFVAEFNLAKGLQAPHGNKDYWTLKPTSVQLVNAAEIGGISGQVSSATFSECQSAAVG
FT                   LELPDEYSQAVYLYPIDTILTNMADFRAENEPYLLTEVAPLASARVNPIFDEGGTETGQ
FT                   GYEFGFLDAGTYSLGYTCVAQQDDSDENDIDKTPPFFIHIDEQGVVVELGEVTERNF"
FT   sig_peptide     complement(562905..562967)
FT                   /locus_tag="Ssed_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.298 at
FT                   residue 21"
FT   gene            complement(563331..564059)
FT                   /locus_tag="Ssed_0450"
FT   CDS_pept        complement(563331..564059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0450"
FT                   /product="protein of unknown function DUF28"
FT                   /note="KEGG: slo:Shew_3408 protein of unknown function
FT                   DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35063"
FT                   /db_xref="GOA:A8FQE0"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE0"
FT                   /protein_id="ABV35063.1"
FT                   /translation="MGRAYQNKKESMAKTAGQKTRIYSRYGKELYVCAKNGGFDPDGNL
FT                   PLRQLIAKAKKDQVPAHVIERAIEKAKGGGGEDYETARYEGFGPGGCMVIVDCLTDNGK
FT                   RTFTEVRQAFVKNDAKLGGPGTVGHMFEHQAIFVFAGEDEEEVLEMLMMADVDVTDVEV
FT                   EDGMISVYAPNTEFYKTKTALNEAMPEVEFVVEEITFVPQTMTDISDPEVIEQLEKFLA
FT                   ALEDCDDVQNVYHNAEFAEN"
FT   gene            complement(564174..565103)
FT                   /locus_tag="Ssed_0451"
FT   CDS_pept        complement(564174..565103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0451"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: sbl:Sbal_0481 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35064"
FT                   /db_xref="GOA:A8FQE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE1"
FT                   /protein_id="ABV35064.1"
FT                   /translation="MDLNRVQMFAQVVEQGSFTGAAKALGLTKATVSRKIAELEADAGV
FT                   QLLFRTTRSLKLTEAGSAYYNRVHHILIDLKNAEDLLSASQQLIKGKLKIVCPIEMGQL
FT                   FFGRIFARFLKQYPDISIEAELSNRKVDVIEEGVDVLFQITSSSDTRLQTYSLLNTSKT
FT                   LMASPEYLAQYGTPQTPQDLNKHRAVKLESAHIDGSWTLFDGKEWITVEPEAQLTVNNV
FT                   TLAREAAIEGLGITSVPSLIAQQAIDKHLLIPLLEDFPMAQTKITMSLPQRAYLPRKYR
FT                   VFIEFIYRAMSENPDNHLLDIPDFVSLE"
FT   gene            565201..566259
FT                   /locus_tag="Ssed_0452"
FT   CDS_pept        565201..566259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0452"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="KEGG: shm:Shewmr7_3509 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35065"
FT                   /db_xref="GOA:A8FQE2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE2"
FT                   /protein_id="ABV35065.1"
FT                   /translation="MSKSKLFIAVPLIFAALAGGAYYWWTQVRFFESTDNAYVEADISH
FT                   ISVKVPGYVVMTDITDNQHVNAGQLLAQLEDNQYEAKLAQSQAELDSSQAELQTLSAKV
FT                   ELQHALIAQAQAGVAAAGSDRLRSEQQLRRSKKLKEKNYSSQDDVDQMQASFESSVAHL
FT                   DEANAALVAKQRELAVFNAQLLQADANVVKAKAGLELAKIQLADTQVRAPFSGVIGKRG
FT                   ALKGQYVQPGQALYSLVPDGAVWITANFKETQIQHMQPGQSVQVNLDAFPDKTFTGVID
FT                   SLSPASGAKFSLLPAENATGNFTKIVQRIPVRIRLELGEERERLVPGLSAIVKVDTTTL
FT                   SLDSALAANIGH"
FT   sig_peptide     565201..565257
FT                   /locus_tag="Ssed_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.758 at
FT                   residue 19"
FT   gene            566263..567843
FT                   /locus_tag="Ssed_0453"
FT   CDS_pept        566263..567843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0453"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: sbl:Sbal_0483 drug resistance transporter,
FT                   EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35066"
FT                   /db_xref="GOA:A8FQE3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE3"
FT                   /protein_id="ABV35066.1"
FT                   /translation="MSAIVNGAVNLSIETKPQGYERGSRRAWIAVFGGLIGAFMAILDI
FT                   QITNASMKEIQGSLGATLEEGSWIATAYLVAEMIAIPLSGWLSQGLSVRRYLLWTTSAF
FT                   IFASLLCSISWNLESMIAFRAMQGFFGGALIPLAFRLILEFLPDEKRAVGMALFGITAT
FT                   FAPSIGPTLGGWLTEQFSWHYLFYINVPPGLIVMAMLAYGLERKGVIWEKLRNVDLSGI
FT                   ITMAIGMGCLEVVLEEGNRKDWFGSALIQYLSIIAVINIGLFIYIQLKKSEPLVNLRLL
FT                   GQRDFALSTVAYFLLGMALFGAIYMIPLYLSQIHDYSPLEIGEVIMWMGFPQLLVLPLV
FT                   PKLMERFDGRYLAAFGFLMFSLSYYMNSHMTADYAGEQMIASQIVRALGQPFILVPIGI
FT                   IATMHIKPHENASASTVLNVMRNLGGAFGIALVSTLTDNLSREHLAHIKETLPAVSPIA
FT                   NDYLMQTANVFTQAGSDPVTAAAQANALLGQTMTQQAYISAYNDVFFIISCLLLIAVVA
FT                   VLSIRKRSD"
FT   gene            567971..568426
FT                   /locus_tag="Ssed_0454"
FT   CDS_pept        567971..568426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0454"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: slo:Shew_3397 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35067"
FT                   /db_xref="GOA:A8FQE4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE4"
FT                   /protein_id="ABV35067.1"
FT                   /translation="MQWSVLTFNELSVDELYELLKLRVDIFVVEQNCPYPELDEKDRHN
FT                   ETRHLLGRNDAGEIVAYARLLAPGVSYADASIGRVVVAEQARGGGVAHSLMTQAIGLTK
FT                   RCWPDQNIQLGGQEYLKAFYQKLGFEPVSEVYLEDGIPHLDMLYRRS"
FT   gene            complement(568499..568744)
FT                   /locus_tag="Ssed_0455"
FT   CDS_pept        complement(568499..568744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35068"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE5"
FT                   /protein_id="ABV35068.1"
FT                   /translation="MQIAQQLKDRRETDLHHDVHWDSMTAEQKIALYNLHRFGYRLLFV
FT                   RHMHSGPLAVISQQNHLATISSHGEVDYRTDVQLRD"
FT   gene            569096..570025
FT                   /locus_tag="Ssed_0456"
FT   CDS_pept        569096..570025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0456"
FT                   /product="radical SAM domain protein"
FT                   /note="KEGG: shm:Shewmr7_3501 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35069"
FT                   /db_xref="GOA:A8FQE6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE6"
FT                   /protein_id="ABV35069.1"
FT                   /translation="MHDADYCLFFSRECQPLNYIEPLFRPPSEWKSLILQVTNGCSWNR
FT                   CTFCDMYTAPQKRFRAQKLDKIAADIIAVAETGRSVHRVFLADGDAMSLPFDRLEAICL
FT                   LIREHLPDVTRISSYCLPRNLKNKTSEELSRLKALGLSLLYIGCESGDDEVLRRIEKGE
FT                   SFDSSLAALKKIKAAGIKSSVMILNGLGGTELSTQHAINSAKLMNASQPEYLSTLVVTL
FT                   PLGTERMDASFDGHFQLPDQHGLFVEMHTLLKHLELDKTIFRSDHASNYLVLKGTLGKD
FT                   KEKLIAQVEQAMTKPQSSGLRQEWQRGL"
FT   gene            complement(570088..570921)
FT                   /locus_tag="Ssed_0457"
FT   CDS_pept        complement(570088..570921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0457"
FT                   /product="MscS mechanosensitive ion channel"
FT                   /note="KEGG: slo:Shew_3394 MscS mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35070"
FT                   /db_xref="GOA:A8FQE7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE7"
FT                   /protein_id="ABV35070.1"
FT                   /translation="MKEDQLAQELEQLQNVYTLITEFLVQYSFRLVGALLIFLIGLWLA
FT                   SKVAKLVTRQFEKHNIDITLSNFVSNLVRIIIVVMVAIIALGKLGISVTPMIAAIGAAS
FT                   LGAGLAIQGMLSNYAAGITIIVTRPFIIGNTITVKEVTGVVQDIHLGLTVLTNEEGEQI
FT                   SIPNKHIVGEILHNSFANKLVETKFNINYQSDPEAVIELTTKILAESPQVNQDKPAHIG
FT                   INGFNTVGIEIGIRYWVPTERYYQNKYQTNLAIYKALHSAGIEIPCPVREVHIER"
FT   gene            571153..571617
FT                   /locus_tag="Ssed_0458"
FT   CDS_pept        571153..571617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35071"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE8"
FT                   /protein_id="ABV35071.1"
FT                   /translation="MRTLLFVICTLLTSFAQASSYAEGDLVSQIQLQDQFENEITVSEG
FT                   TQTLLFSRNMKGGDIIKEALEVLTAEQKQASDKLVYVADISGMPSLIAKFVAIPQMKDL
FT                   PFSMALDREGETTRLLPSEKDQATLIKLDHLKVMSVSTFDSSAALIKALR"
FT   sig_peptide     571153..571209
FT                   /locus_tag="Ssed_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.690 at
FT                   residue 19"
FT   gene            complement(571698..571919)
FT                   /locus_tag="Ssed_0459"
FT   CDS_pept        complement(571698..571919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0459"
FT                   /product="protein of unknown function DUF465"
FT                   /note="KEGG: slo:Shew_3391 protein of unknown function
FT                   DUF465"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35072"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQE9"
FT                   /protein_id="ABV35072.1"
FT                   /translation="MFPEYRELITKLKSEDTHFLKKFNKHNALDDEIKELEQHSSSGFT
FT                   NEVHELKRKKLHLKEEIHTILKNTPQMI"
FT   gene            571921..572160
FT                   /locus_tag="Ssed_0460"
FT   CDS_pept        571921..572160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35073"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF0"
FT                   /protein_id="ABV35073.1"
FT                   /translation="MVISSFFFILFISKLARFVTAKCDSGQQLITRHKYLLEGKRLKCD
FT                   LWLSDGGKDNGRYNSLFFKATYTGTEPIYLDLCL"
FT   gene            572328..573086
FT                   /locus_tag="Ssed_0461"
FT   CDS_pept        572328..573086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0461"
FT                   /product="uridine phosphorylase"
FT                   /note="KEGG: sfr:Sfri_3403 uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35074"
FT                   /db_xref="GOA:A8FQF1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF1"
FT                   /protein_id="ABV35074.1"
FT                   /translation="MSDVFHLGLTKKMLDGANLAIVPGDPERVKRIAELMEGATFLASH
FT                   REYTSYLAYIDGKAVVVCSTGIGGPSTSIAVEELAQLGVTTFLRVGTTGAIQPQVNVGD
FT                   VIVTQASVRLDGASLHFAPMEYPAVANFECTTAMVEATRDAGLEPHIGITASSDTFYPG
FT                   QDRYDTVSGRVTRQYRGMMQEWQDLGVLNYEMESSTLFTMCASQGWRAACVAGVIVNRT
FT                   QQEIPDEATMKKTEVSAVSIVVAAAKKLLA"
FT   gene            complement(573219..573971)
FT                   /locus_tag="Ssed_0462"
FT   CDS_pept        complement(573219..573971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35075"
FT                   /db_xref="GOA:A8FQF2"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF2"
FT                   /protein_id="ABV35075.1"
FT                   /translation="MNKKWLLLALFAAPQAMADDMIHWWDASVTALYGDNYDLAPSDKQ
FT                   TTFTFETAGAWQYGDWFAFQDLIYFNGSNVSSDSTTYGEISTRLSAGKISGKEIGFGPV
FT                   TDLSLAMTFEEGEGPVKSFLYGLGMDIAIPYFSYFQLNTYRREAISSGNISDGWQITPA
FT                   FRMDFPVGNSNIVFDGFFDWVFSADNQGYEENFHFNPQLKYDLGAVIFGSHEKNKFLVG
FT                   VEYDYWKNKYGVKGVDQNTYSVIAKYHF"
FT   sig_peptide     complement(573915..573971)
FT                   /locus_tag="Ssed_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            574310..574783
FT                   /locus_tag="Ssed_0463"
FT   CDS_pept        574310..574783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0463"
FT                   /product="protein of unknown function DUF107"
FT                   /note="KEGG: shw:Sputw3181_3627 protein of unknown function
FT                   DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35076"
FT                   /db_xref="GOA:A8FQF3"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF3"
FT                   /protein_id="ABV35076.1"
FT                   /translation="MELSNPIIIWGCIGLALMLAEIIIPGGIVILLGGACLVVASALAV
FT                   GLVEGIVQSLTLWFIVSIVFLLGFRQLTQKLVGGDSHVDNTDEELDIYNQTAVVKETIG
FT                   PAQHQGRIEFQGIEWSALGDGSEIAAGTRVRIICRDNIALVVEPCPDEVNMSN"
FT   gene            574914..575861
FT                   /locus_tag="Ssed_0464"
FT   CDS_pept        574914..575861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0464"
FT                   /product="band 7 protein"
FT                   /note="KEGG: slo:Shew_3387 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35077"
FT                   /db_xref="GOA:A8FQF4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF4"
FT                   /protein_id="ABV35077.1"
FT                   /translation="MFVFTIFVLFIFFILYKLLLIVPMREVNVIERLGKFRAVLKPGFH
FT                   FLIPFFDRVAYKHEIREQVLDVPPQSCISKDNTQLEVDGLVYLKVMDGKLASYGIENYR
FT                   LAAVNLAQTTMRSEIGKLSLSQTFSERDSLNESIVREIDKASDPWGIKVLRYEIKNITP
FT                   SRKVIHTLEKQMEAERSKRAEITLANAEKAAMINLSEGERQEAINISEGQKLKRINEAK
FT                   GTAQEISIIAKAKAEGMELVSTALALDGGHEAMNMQLKEQFIGQVGKILNEAEISVVPA
FT                   EMAKLEGFFEGMEQVTHAVSSSSTGSNSVKGGRS"
FT   gene            575858..576793
FT                   /locus_tag="Ssed_0465"
FT   CDS_pept        575858..576793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0465"
FT                   /product="band 7 protein"
FT                   /note="KEGG: slo:Shew_3386 band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35078"
FT                   /db_xref="GOA:A8FQF5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF5"
FT                   /protein_id="ABV35078.1"
FT                   /translation="MIAGINTDLIVLGIWGLIFALFIIKLFQSIRLVPTKSAYIVERLG
FT                   KYHSTLDAGFHALVPFVDKVSYIHDLKEETIDVPPQECFSSDEVNVEVDGVIYISVVDP
FT                   VKASYGVTDYRYAAIQLAQTTTRSVIGTLDLDRTFEERDVISAKVVEVLDQAGAMWGIR
FT                   VHRYEIKNITPPETVKNAMEMQVNAERERRALLAKSEGDKQSKINRSEGIKAEMINLSE
FT                   GEMQKRINEAEGKGEEILTIAKATAESIELMATVIAAPGGKNVVRMQLGAQYLKQLDGL
FT                   SNGASRVVLPGNMMDFDHWMDSIGLEESKS"
FT   gene            577508..577861
FT                   /locus_tag="Ssed_0466"
FT   CDS_pept        577508..577861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0466"
FT                   /product="endoribonuclease, L-PSP family"
FT                   /note="KEGG: cps:CPS_4240 endoribonuclease, L-PSP family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35079"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF6"
FT                   /protein_id="ABV35079.1"
FT                   /translation="MTIERLETGARMSRIVKHNGTIYLCGQVCKDAEQGITEQTQTMLD
FT                   KVDALLEQAGSDREHILSATIYVKDMSYFAEMNAVWDAWVPEGHAPARACVAAKMAREA
FT                   LLVEISVVAAEKD"
FT   gene            577962..580127
FT                   /locus_tag="Ssed_0467"
FT   CDS_pept        577962..580127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0467"
FT                   /product="DNA helicase II"
FT                   /note="KEGG: slo:Shew_3385 DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35080"
FT                   /db_xref="GOA:A8FQF7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF7"
FT                   /protein_id="ABV35080.1"
FT                   /translation="MDVSSLLDGLNDEQREAVGAPQSSMLVLAGAGSGKTRVLTHRIAW
FT                   LMQVEQQSPYSILAVTFTNKAAAEMRERVEKVSGSNMGRMWIGTFHGLAHRLLRTHYKD
FT                   ANLPQTFQIIDSDDQLRLIKRILKSLHLDEKQYPPRQAQGYINGKKDQGLRPKHIDAGG
FT                   FPIEQNLLQIYQVYQESCDRAGLVDFAEILLRAHELWLNKPHVLQHYQDRFKNILVDEF
FT                   QDTNAIQYAWIRVLAGDSANVMIVGDDDQSIYGWRGAQVENLHKFLVDFPKAETIRLEQ
FT                   NYRSTGHILKASNELIANNPERLGKKLWTEDKDGEQISLYCAFNEMDEARFIVGRINDW
FT                   HDMGGDLSSCAILYRSNAQSRVLEEALLHKGLAYRIYGGLRFFERQEIKDAMSYLRLIN
FT                   NKDDDAAFERVVNTPARGIGGRTLDILRSTARQQELTLWQTCLRALEEKLLSGRAANAV
FT                   RGFMDLIVEMQQDTDEMTLHRTTDHVIRESGLKAMYEAEKGEKARSRVENLDELVTAAR
FT                   TFIMPEDSEDMGELNAFLSHAALEAGEGQADAFTDAVQLMTLHSAKGLEFPVVFMSGVE
FT                   EGIFPSQMAMDEGDRLDEERRLCYVGMTRAMEKLYITYAETRRIYGRENFARPSRFIKE
FT                   IPTEHVEEIRLKTQVTAPQRAKPSFSRSTVVNDTGFKIGQSVMHQKFGEGKVTGTEGSG
FT                   AQARVQVNFFDVGSKWLVVAYARLETC"
FT   gene            580211..581071
FT                   /locus_tag="Ssed_0468"
FT   CDS_pept        580211..581071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0468"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="KEGG: sbl:Sbal_0442 4-hydroxybenzoate polyprenyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35081"
FT                   /db_xref="GOA:A8FQF8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQF8"
FT                   /protein_id="ABV35081.1"
FT                   /translation="MNLRDKLDVYLRLARMDRPIGTLLLLWPCLMALLLAAGGMPDLKV
FT                   LTIFIFGVVVMRACGCIINDYADRDLDAHVDRTKSRPLASGEVTGREALILFAVMGLFA
FT                   FGLVLMLNPLVVKLSVVGIILTIIYPFTKRFTNMPQMFLGVVWSWSIPMAYAAQTGEVP
FT                   AEAWWLFAANWCWTVAYDTMYAMVDREDDLKVGIKSTAILFGKYDRQIIGLFQLAALAC
FT                   FITAGWAADRGLVYGLGIITFVGFSMYQQKLIHERERAPCFKAFLNNNWAGLSLFIALG
FT                   VDYLI"
FT   sig_peptide     580211..580321
FT                   /locus_tag="Ssed_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.636) with cleavage site probability 0.387 at
FT                   residue 37"
FT   gene            581370..582482
FT                   /locus_tag="Ssed_0469"
FT   CDS_pept        581370..582482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35082"
FT                   /db_xref="GOA:A8FQF9"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQF9"
FT                   /protein_id="ABV35082.1"
FT                   /translation="MRQVVKFRLIFLSVAILCYAAGFQFLPETLEISNGQEISIAFALL
FT                   YFAFLPLLYWLCIIKLGKQKLWKLLLIVSLSCLMARLSFPVEIASYFEFIIWLRFPIIA
FT                   ILLGIELFLIVSVIKALWQARNLSGDPRINILEQFGQEDDRKRSMALALAMEPASWFYA
FT                   IPRFSRKHPPSVTHINLLSASRWHWLLLACATVLLAGASYVVIQPWSEITAIIVSSFIL
FT                   YGLILITANYRVSRHFSVYRHGDQLIINNGVWGFSLVKFDQIHRVMVSPPPCENRTGVI
FT                   NFGQGESSNIILKFKHPQTYFGGLGWLPEEVKAIAMVVDKPEALADLIFDISDERELEV
FT                   RRAELTPSWKESISQEVFEGNADMPTELTS"
FT   sig_peptide     581370..581432
FT                   /locus_tag="Ssed_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.555 at
FT                   residue 21"
FT   gene            complement(582559..583368)
FT                   /locus_tag="Ssed_0470"
FT   CDS_pept        complement(582559..583368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0470"
FT                   /product="transposase"
FT                   /note="KEGG: har:HEAR2247 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35083"
FT                   /db_xref="GOA:A8FQG0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG0"
FT                   /protein_id="ABV35083.1"
FT                   /translation="MLCDVLDVSRSGYYSWLNREPSERSKANKVLSDFLKEKIDEHNGI
FT                   AGYRKLWLDALANGFACNKKRVQRLLQTFGYRSRACKRKFGVVKPKLIETRAPNYLNRE
FT                   FEVAKPNTIWVSDITQVRCKEGWQYLCVIIDLYSRKVVSWATSYINSSELVMKSLKQAW
FT                   AERRPNGSELMFHSDQGVQYRSFEVLKCLTKREVTVSMSRKGNCWDNACSESFFAQLKK
FT                   EWFSNLEELSRREMTTQCRFYIDDYYNMVRRHGTLNGVSPITFESRI"
FT   gene            complement(583416..583730)
FT                   /locus_tag="Ssed_0471"
FT   CDS_pept        complement(583416..583730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0471"
FT                   /product="transposase IS3/IS911"
FT                   /note="KEGG: mta:Moth_1610 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35084"
FT                   /db_xref="GOA:A8FQG1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG1"
FT                   /protein_id="ABV35084.1"
FT                   /translation="MKIRSQRVHTEAFKLAAVQQSLNSPDTVKALAGKLGIHPALLSKW
FT                   RAQLTSKKHTSKPIDNIGPNKSLTELEREIRELKKRLERAELENDILKKAKEFFDKHQG
FT                   "
FT   gene            584339..585871
FT                   /locus_tag="Ssed_0472"
FT   CDS_pept        584339..585871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3419 kap P-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35085"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG2"
FT                   /protein_id="ABV35085.1"
FT                   /translation="MDPVIDEAQLARMERAKTFASKYEDWQPEYNWGNCKTNRQEYGKF
FT                   LCSFLTNSKDGLVVNLNGSWGTGKTQLLRRLYVELAEQNHPVVYINAWESDFCNDALSV
FT                   VSSEFLNQLGFIFSSNADKSITEKFNELKDGFGTCMKLLSGGASLVGEPVTAATASAAG
FT                   SVVDTLPKAESNSVVSNNVELVDKISQAHANRVLAMQDIKKQITALSLLMNEIHDLEAP
FT                   IVVLVDELDRCRPIYAIEMLEVIKHFFEAKGCVFLVATDTEALQHSVNAVYGAKFNSAS
FT                   YLKRFFARKIALSEISSLRYLKSKEFDFEKYSELGIRLHPFTKNQNYNIKYMAAVAKLI
FT                   GFELRDIDQVIQKFFASLDFIAKTRMNHKSDVINTVVLFTGIAEHHNGMTCFYNRESNV
FT                   HIDSEIRCVGNVLDGISVNDLMQSQLNAVVKVMSREVHSGGGSSISRGDNSNIECLKIQ
FT                   SYNFIRHATKRYDDFVFHEEMRSLIQLSESTVDRYWLWDDYKMLIELSGHIE"
FT   gene            complement(586226..586804)
FT                   /locus_tag="Ssed_0473"
FT   CDS_pept        complement(586226..586804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35086"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR033653"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG3"
FT                   /protein_id="ABV35086.1"
FT                   /translation="MKLTALTQPLYDHLYRDILQFRSTFDLPSEDETTLDDKADTLHTS
FT                   LAIEELTELAEADTRMEQADAIVDSVYVLMGRLVHLGATGVNDRIEISYVIDLLLHVAK
FT                   NREIDFVTCWDEVHSSNMSKVCRNEQELTETIEFYAKQGVEIVGSKKGDFIIAKCAKDV
FT                   DMAGKVVRQGKVLKSVYYRPADLAKLVKA"
FT   gene            complement(586959..587186)
FT                   /locus_tag="Ssed_0474"
FT   CDS_pept        complement(586959..587186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35087"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG4"
FT                   /protein_id="ABV35087.1"
FT                   /translation="MKNNHHILSPFLLALLLCDCSSTEVIDTGITFGKETVKASQRRQE
FT                   RTNPSFRDDKVNSDDVANGLLNTIIKSVNN"
FT   gene            587565..589082
FT                   /locus_tag="Ssed_0475"
FT   CDS_pept        587565..589082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0475"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="KEGG: slo:Shew_0344 Na+/H+ antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35088"
FT                   /db_xref="GOA:A8FQG5"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG5"
FT                   /protein_id="ABV35088.1"
FT                   /translation="MPSKNELQQSPPDEPEKVSQHKPASLLDALTPIIALVAMLTTAVY
FT                   LFSSDSSSGANQIALIMAACIALVIGAKNGYSWKEMEAGIVHSVSMATGALLILFSVGS
FT                   LIGTWILAGTVPTMIFYGMKVLNPEYFYAASCLLCAVVAISIGSSWTVAGTLGIALIGI
FT                   AGAMGLSVEITAGAIISGAYFGDKMSPMSDTTNLAPAVAGTDLFSHIRHMVWTTTPSII
FT                   IALIGFVILGFSTQSSGGSSDLESTLNILQSQYAPGVHLLLPLLVVLLLAYKKVPAFPT
FT                   VILGTFAGAICAAIFQFDNIIEFVGDDNLLPAVALLKGIWIAMFDGYTANTGDTVLDSL
FT                   LSRGGMSSMVNTVWLILCAMAFGGVMERTGLLKRILQSILGVVTSSSSLIITTLASCIG
FT                   ANLITGDQFIAILLPGRMLKVEYTKRGLAPVNLSRALEDSATITSPLVPWNTCGAYMAS
FT                   TLGVATIAYLPYAFFNLVCPLISASYAYFNFKIEKLEEVSEAEEVIA"
FT   gene            complement(589131..591197)
FT                   /locus_tag="Ssed_0476"
FT   CDS_pept        complement(589131..591197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0476"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="KEGG: shn:Shewana3_0482 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35089"
FT                   /db_xref="GOA:A8FQG6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG6"
FT                   /protein_id="ABV35089.1"
FT                   /translation="MKTHKILPSVLSTALAASLFITGCSQTPSPTNLSDRATIQDQSQQ
FT                   VQLLPVEAFFNEQGISGLKSSSDGKWLAFFKEYQGAKNIYLMATGTDLDEAFPITTSKD
FT                   PIYSFRWSHQGNEIFFLKDTGGNENTQIYKLSLDTSQIKPVPNITALTSNTDIRYDLLK
FT                   QPKDKPNTLVVMSNQDNPQQMDLFRLNIDSAKITNIFSNTYGFSSIETNQQGVPVLGTS
FT                   SNPDNTSDLYAKISGKWTSLIKTQFGEDIDILSFDEDNNLAYLRANIQGRDKLQLLRLN
FT                   MTTGKIVTLHQDPQDESDVYDVLFNDEGAPLAVSYYGGRLRTYPLDETFADNWQKINDH
FT                   FTQDVEITITDRNEKTGLWQLHIASDVDMGSDYRFDANTGLVSLLLEQEASISPELLSK
FT                   RQSITYQARDGVTIQAYLTLPKGQTQNLPTVILPHGGPWSRDYWTLSSGYFNPIAQLLA
FT                   NRGYAVLQPNFRASTGFGKRFLNAGNKNWGTGSMQDDLTDGAHYLIKEGIADKQRLGIM
FT                   GASYGGYAALAGATFTPDLYQAVISYVGPSSLITLLESFPPHFRPYLGQFYSAVGDPEI
FT                   DTDRVDMKARSPINFVDNIRAPLMLVQGANDPRVTQIESDNIARVMYNRKLPVEYILAK
FT                   DEGHGFRKRDNKLAYIVAMEQFFGKHLGGRVDNAVTPALTAHLDTLKVDVSRL"
FT   sig_peptide     complement(591126..591197)
FT                   /locus_tag="Ssed_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.508 at
FT                   residue 24"
FT   gene            591383..591898
FT                   /locus_tag="Ssed_0477"
FT   CDS_pept        591383..591898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35090"
FT                   /db_xref="GOA:A8FQG7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG7"
FT                   /protein_id="ABV35090.1"
FT                   /translation="MNANMQKLMKISGFFRLLVLIATTIMMVYLGYSFFVNGDIRFGAS
FT                   HLFHELWQDERASRGILLGLQSPLFIILLVGVYWLQKLLSHYQQGQFFGHEAMRCYLWL
FT                   VWLKVFDFGIEIIQHLGTGYYHKQFFEHTSIQLTIDFGDVTTILLMLLIVYLLKAAREL
FT                   EAENREFI"
FT   sig_peptide     591383..591499
FT                   /locus_tag="Ssed_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.698 at
FT                   residue 39"
FT   gene            591917..592129
FT                   /locus_tag="Ssed_0478"
FT   CDS_pept        591917..592129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0478"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: shn:Shewana3_0484 transcriptional regulator,
FT                   XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35091"
FT                   /db_xref="GOA:A8FQG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG8"
FT                   /protein_id="ABV35091.1"
FT                   /translation="MEIIVNLDVMMAVRKVSSKELAKAIGITEANLSLLKRGKVKGVRF
FT                   ETLASICDYLACQPGDILEYRKAAE"
FT   gene            complement(592264..592854)
FT                   /locus_tag="Ssed_0479"
FT   CDS_pept        complement(592264..592854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0479"
FT                   /product="thioredoxin, putative"
FT                   /note="KEGG: son:SO0476 thioredoxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35092"
FT                   /db_xref="GOA:A8FQG9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQG9"
FT                   /protein_id="ABV35092.1"
FT                   /translation="MVTPMNKTLILTCLLALSSVFIPADAKSNKVYNTGEAINKPMIMS
FT                   RFIEMQSAREVPDVTFTDTEGGEINLKQYKGKVVMVNLWATWCAPCIKEIPQMENIRQT
FT                   NIDKDLVVLPISIDEESEKVKPFLARHGLSHYKTWLDPNKDIDQVMPADVVPATYVFDG
FT                   SGNLIGFLRGYLDWGDKEVQPYLEKLIAKYAKR"
FT   sig_peptide     complement(592774..592854)
FT                   /locus_tag="Ssed_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            complement(592835..593263)
FT                   /locus_tag="Ssed_0480"
FT   CDS_pept        complement(592835..593263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0480"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="KEGG: shw:Sputw3181_0575 cytochrome c biogenesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35093"
FT                   /db_xref="GOA:A8FQH0"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH0"
FT                   /protein_id="ABV35093.1"
FT                   /translation="MMRILFLMLLFSLSMSAMAATTTTGENSYTQDQIRDIGFEISYEL
FT                   RCPMSINQNLFDSQAPIANELKAQIFLMLEQGESKEAIIEFLVQRYGEKIKYQPSFSVA
FT                   TAMLWFGPLFLLLIIIAVAAMLIREQHKHQRTNGNSYE"
FT   sig_peptide     complement(593204..593263)
FT                   /locus_tag="Ssed_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(593260..595230)
FT                   /locus_tag="Ssed_0481"
FT   CDS_pept        complement(593260..595230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0481"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="KEGG: shw:Sputw3181_0576 cytochrome c-type
FT                   biogenesis protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35094"
FT                   /db_xref="GOA:A8FQH1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH1"
FT                   /protein_id="ABV35094.1"
FT                   /translation="MIPELGLILLIISTVSSLLLAVIPLVALHTKNHYLFSYVKTLTGL
FT                   MTFTITASILCLLISFITDDFSVAYVANHSNTQLALLYKVAAVWGSHEGSMLFWVVAIA
FT                   IWGCIIVFSSKYRDRLFIGRLIAILASVIAGFNLFMLFTSNPFARLLPNFPIEGRDLNP
FT                   ILQDIGLIFHPPLLFLGYVGLTVTFAAAIAALLGGKLTRTHAGYLRPWALLAWVFLTGG
FT                   NAFGSWWAYNELGWGGWWFWDPVENASFIPWLVATALLHSVVLSHRRDSFKVTTLLLCL
FT                   LAFSLSLLGTFLVRSGIVQSVHAFASDPTRGMSILFLLGVFVCGALTLFALKANQIKSE
FT                   LNFTLVSRDSVILLGNIVLVVAAISVLLGTFYPLLFELLDIGTLSVGAPYFNSIFIPLT
FT                   FMAVLLMGAAPLISWKREKFSALRPLIVLFIIALAIAETLSMLTGSGFNIWLFLGATSA
FT                   TWLILCLGYLLFRLRHQGIEGLARKSAMLIAHLGVAISIIGATSVSNFEQQELLRMGPA
FT                   QGKVVAGYTFVYEDTVNVDEKSYTAIQANIRVTDADDNFIGYITPQRQTFKTNAMEVSK
FT                   AGIMRNIFRDLYVSSGLQLSDTEYLIRISYKPLACWIWLGGLLMMLGGTIAALTGLYRL
FT                   RVQKAAYSNSNPIATRIEGLA"
FT   sig_peptide     complement(595165..595230)
FT                   /locus_tag="Ssed_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.906 at
FT                   residue 22"
FT   gene            595777..597813
FT                   /locus_tag="Ssed_0482"
FT   CDS_pept        595777..597813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0482"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: slo:Shew_0348 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35095"
FT                   /db_xref="GOA:A8FQH2"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR032897"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH2"
FT                   /protein_id="ABV35095.1"
FT                   /translation="MKNWKLKTAAGLLFCFTAAANVNAAGGKYNSVPEMGESAKAAIAN
FT                   YQGTEETKGVKSLHDYVVQESELFDFLFQNHPMFKYHEEGNLIGEYHISDRGEEYFDTG
FT                   NSPKYSERVGRPSAVQYRLGAKSTLDFPNNFVGPEKCGECHAVQYEKWQRSRHANVVRF
FT                   PSEITDKEVPNGDLTARLYGSEAAMLPDGIQPDDVYAIIGTPRTKYGLLDSYLVRGTYH
FT                   IRDGLLSEGTGKMVAGANQFSRGWAEWLTPEMAKKINKVIPEFPTTIEGFGASGSHQWG
FT                   MSSYGAKYEKEMLFQPASSYCEMCHTFKFDFQNKEEYFAALGDSKKLQEHTISKGIACE
FT                   ECHGAGGHLDGGTGGMQSNCERCHQRFNFVDELADTEKGQEKMEYAFGVKMKSACPSCG
FT                   TEGSQMFASAHYEKGMRCTTCHDPHEVTDGDFLSGFTKPKLKKDCVDCHEAQATIADNT
FT                   DTHSNQTCQSCHMPAMGSCENFTAVQFPDMAGFDAVRKSHMWKIDIHPERKTLNPPEGK
FT                   PRDSAVKGWTVAKNEEDRNYLDLMWSCARTSVSDHDNVENKGCHSPFQSELETGMHYND
FT                   QMEIYGEVMKWQTPVKEVYAQVEQALVRIDQLLEVTKLPTEEKTQVLMLAEKAQEAVDL
FT                   IKKDGSWGVHGFRYSQKRLDAALTYVTQAQKILDGNGYSAKAN"
FT   sig_peptide     595777..595851
FT                   /locus_tag="Ssed_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            597859..598314
FT                   /locus_tag="Ssed_0483"
FT   CDS_pept        597859..598314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0483"
FT                   /product="rhodanese domain protein"
FT                   /note="KEGG: shw:Sputw3181_0578 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35096"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH3"
FT                   /protein_id="ABV35096.1"
FT                   /translation="MVEANKRIIMNKVLGIIILTFFLAALSPNSFAGGGSDMAPAKHHE
FT                   FQLNHITMVEAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNVRDWKKILPENKDAVM
FT                   VFYCANRLCNASEIAARAVMKLGYTGVRQMPDGIYGWRLSNRQTERP"
FT   sig_peptide     597859..597957
FT                   /locus_tag="Ssed_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            598369..599157
FT                   /locus_tag="Ssed_0484"
FT   CDS_pept        598369..599157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0484"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="KEGG: slo:Shew_0350 peptidylprolyl isomerase,
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35097"
FT                   /db_xref="GOA:A8FQH4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH4"
FT                   /protein_id="ABV35097.1"
FT                   /translation="MKTFKKSIIAISCLPLFLSVQCMAETELLADSNKESYSIGASFGS
FT                   YISSQLYSQSQLGAEVDVDIVVEGLLDALKGQSKLSNEDIVSYLNIRAEQLNTAKEEKD
FT                   KDLALKNLVAGEKFLAENKKSADVRTTESGLQYEVISQGSGAKPQANDVVTVHYKGYLI
FT                   DGTEFDNSYTRDEANRFSLVTVIEGWQEGLQLMKEGAKYKFNIPSELAYGERQVGMISP
FT                   NSALVFEVELVKVEAPGENAHGMGLSGMGMGGMMGANPHK"
FT   sig_peptide     598369..598443
FT                   /locus_tag="Ssed_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            599191..599898
FT                   /locus_tag="Ssed_0485"
FT   CDS_pept        599191..599898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0485"
FT                   /product="Cytochrome c biogenesis factor-like protein"
FT                   /note="KEGG: shn:Shewana3_0492 formate-dependent nitrite
FT                   reductase, NrfG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35098"
FT                   /db_xref="GOA:A8FQH5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH5"
FT                   /protein_id="ABV35098.1"
FT                   /translation="MNILLISIVALCVLLLMTFFGHHTLYRIKHTSFFSDCNELDSNRT
FT                   KYSRSSFSFVLLLNVTVITSVVTVYSYLGRYNEIDLARADVNVDYLLAAEINRARKQAN
FT                   EQPNDKSVLMGLARASMDGGLYLEAIEALDELLFYMGDDAEIIGLKATALYYKNHRSMT
FT                   SEVKLLTQSALALYPHDFNTRVLLANDAYINHKYQEAISHWQILLKNTKQPFNRNAIEF
FT                   AINNAKKNLFAKK"
FT   gene            599949..600653
FT                   /locus_tag="Ssed_0486"
FT   CDS_pept        599949..600653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0486"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH6"
FT                   /protein_id="ABV35099.1"
FT                   /translation="MSENLERRRFLKCLGASSLIIAPLGCSSVEEEGESDQPHYTMVFD
FT                   QNKCTGCGECKLACTTANNLPEGKSRLLLEQQSGGVVGEVCPHCGKTDCDCQRKYVRVS
FT                   CQQCKNAPCVTVCPTGAAHRDEKTGIVTMDASKCAGCKYCIGACPYDARFINKETDVAD
FT                   NCDFCLNSKLSKGELPACVQACRYDALIFGDLNDPNSYVSKLLRVKDAVRMKPGFGTEP
FT                   SLRYIPIVKLGV"
FT   sig_peptide     599949..600035
FT                   /locus_tag="Ssed_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.516 at
FT                   residue 29"
FT   gene            600656..601603
FT                   /locus_tag="Ssed_0487"
FT   CDS_pept        600656..601603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0487"
FT                   /product="polysulphide reductase, NrfD"
FT                   /note="KEGG: slo:Shew_0353 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35100"
FT                   /db_xref="GOA:A8FQH7"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH7"
FT                   /protein_id="ABV35100.1"
FT                   /translation="MDGSIEFTMGLSQGIAWPWPIAVYLFFAGISGGALSVALFIRFYK
FT                   QQTENTAFLKAASLMSLVTISLGMLCLVLDLTNPLFFWRILVFYNLNSVMSIGVIALSA
FT                   YIPLVALVTLFALEDEIRKFPALRFLLPVIAKLRGVRAPSEKVVLLLALSVCAYTGFLI
FT                   SALIRFPIINTSVLPALFVASGLSAGAAAAKMLAVGLFKEELHSSDMKVLHGIEWPIMA
FT                   AEILFIFMLAMSLFTGNAGMQSAFTAFHSGTWASVFWIGIIGIGFVGPLLLNFATSKAF
FT                   SHSAKALYMSGMCAVVGMMCLRLFIIYAGQNHGI"
FT   gene            601920..602420
FT                   /locus_tag="Ssed_0488"
FT   CDS_pept        601920..602420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0488"
FT                   /product="NosL family protein"
FT                   /note="KEGG: she:Shewmr4_0494 NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35101"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH8"
FT                   /protein_id="ABV35101.1"
FT                   /translation="MKKIICLLFLLPLLLACTQGAEDVPQAKAEAIEKHERCHLCGMMI
FT                   TKYPGPKGQVHLKGQSVVPKFCSTRDMFNFSLQAENKRQISALFVHDMGATDWEQPGDD
FT                   AFIDAFIDAKTAWYVYGTSKKAVMGPAVASFKRQSQAVKFAQEFGGAVLPFEQVDLALL
FT                   SGE"
FT   sig_peptide     601920..601985
FT                   /locus_tag="Ssed_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.753 at
FT                   residue 22"
FT   gene            602567..603799
FT                   /locus_tag="Ssed_0489"
FT   CDS_pept        602567..603799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0489"
FT                   /product="periplasmic copper-binding"
FT                   /note="KEGG: shw:Sputw3181_0582 periplasmic copper-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35102"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQH9"
FT                   /protein_id="ABV35102.1"
FT                   /translation="MSFAAAYSVSDSEGLKAQLAQSRPGDSILLRAGIYSGQFEIHHGI
FT                   TLTGEKGAVIDAQGLGSAITIFVSDVTISNLEIQNWGGDLYERDSGILIQDLAHRTKIE
FT                   SNRLTGRGFGVCAENSANITVSDNIISGDPERHKLDRGDGIHLKRVESPVIEGNKIFHV
FT                   RDGVYIEAGKHSLIFDNQFSEQQYGIHYMYSKRDEAYGNEAVDVDGGYALMSSENINLY
FT                   HNRVSRAKEFGVLLNMTHNSVVSSNRVSDAHNPQGKVELGNEGKGIFVYGALDNEIRHN
FT                   LFSTSDIGIYMAMGGEGNLVYGNQFVNNRTQVKYVGEQLLEWSRDSRGNYWSGYMGWDS
FT                   NRDGIADNPYRPNDGLDKLFWLYPEARFLMNSPVVALLRWVQSQFEFGEPNGIVDSFPL
FT                   ISADMELCVLC"
FT   gene            603793..604701
FT                   /locus_tag="Ssed_0490"
FT   CDS_pept        603793..604701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0490"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35103"
FT                   /db_xref="GOA:A8FQI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI0"
FT                   /protein_id="ABV35103.1"
FT                   /translation="MLSEVPIKLTDIVLKYDDFTALDGVSFEVEAGQTMALLGHNGAGK
FT                   SSIIKVILGLIAPSSGSVKIMGKSAQSSHLQHKVNLGYLPEDVSFYDKLTGREVLNYFA
FT                   ALKRVRPTRVADLIDEFGLGYAQDRQLKTYSKGMKQRLGVAQAILSEPGILLLDEPTVG
FT                   LDPQASQFLYGKINQLKNSGCAVVVSTHELPLVESHMDSALIMSKGRRLAQGTSSELSA
FT                   GSSLKAKIDFGELTSLVERDHYLRRFFIDGRLQVESGQKQHMIKYLVSQCQIFDFTIDE
FT                   PKLEDIYHDLMVHPLLDQPAQ"
FT   gene            604714..605553
FT                   /locus_tag="Ssed_0491"
FT   CDS_pept        604714..605553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0491"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35104"
FT                   /db_xref="GOA:A8FQI1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI1"
FT                   /protein_id="ABV35104.1"
FT                   /translation="MNRFTSPVLIIASKEICDSSRNRWLAFMGSIFLLLSLSVTFAGSA
FT                   VTGSLYLPELASLMSSLSTISVFIIPLAAILLSYDSFVGEDESGTLLLLLSYPLTRLQI
FT                   LCGKLLGHMTVMLLATSFAFGVTAILLLLIGEQYQVAELIGAFAQFLLSSNLLALTFIL
FT                   FSYIVSLKSTEKAKAVGTLLLVWFLFVLIYDLLLLTILVSDLSFANQYVVNILIALSPT
FT                   DLYRAINLMAIEGGDGRGSLAMLTETDWGLPGMYVLMLLWIALLSWISHGIFKRKRL"
FT   sig_peptide     604714..604857
FT                   /locus_tag="Ssed_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.401 at
FT                   residue 48"
FT   gene            605844..607127
FT                   /locus_tag="Ssed_0492"
FT   CDS_pept        605844..607127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0492"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="KEGG: shw:Sputw3181_0585 transcriptional regulator,
FT                   CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35105"
FT                   /db_xref="GOA:A8FQI2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI2"
FT                   /protein_id="ABV35105.1"
FT                   /translation="MLKITPYLELDTEANHLVDHVNGKNISLTFSESAVLNCLLLSSNS
FT                   VCSKDELLGAGWPDRVVATTSLTQCISTLRKKLDPYREVQLKTVARRGYQLHIATQSHV
FT                   KMLAVNDAESMRAAIVDVSLVVKVSGILLALFLVLLVWYFSDYHKVSQKLSLWSADKRV
FT                   ELKIGGITGDARLLYKDDAPHLHPSMWEKHLDSDGDYLASYPGFNAFVATDGTNYSMAI
FT                   CPDSDKEQCSGNGLINITSVDSEPAGLNMKDFAELSKKMEQRIRYNRIMLPEGEEGVGA
FT                   LIEHHYHADVYFPVKGELLIRSDISMSLIYDSDTTGEFHSSTCITDEDCLTTPIKYKIR
FT                   GKFKQYSETIDNLKIDAFQVSVQQKDLIKPERLNASAVPFYRDLRKRDIKDEELYFFRI
FT                   YQDDKTAVWITPLFGQVTAWYKYDQVDI"
FT   gene            607731..609761
FT                   /locus_tag="Ssed_0493"
FT   CDS_pept        607731..609761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0493"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: slo:Shew_0348 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35106"
FT                   /db_xref="GOA:A8FQI3"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR032897"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI3"
FT                   /protein_id="ABV35106.1"
FT                   /translation="MRRWKHKVALSVLFCFGAIANANAAGKYDSIPQMGKTAKESIANY
FT                   QGTERINGVKTLQDYIVQEEELFDFLFENHPMFKYQESGNLVGDYHISDRGEEYLDTGH
FT                   SPSYSKGVGKPRAVQYRLGAKSILDYPNNFVGPEKCAECHATQYEKWQRSRHAKTIRFP
FT                   GEHPEVDNDLEQTMYGTKDTSILPDGVTPDAIYATVGTPRTKYGFIDAWLVRGTYHIEG
FT                   GLLKDGTGKMVAGANQFSRGWAEWLTPEMAKKINDVIPAFPTTIEAFGASGSHQKGMSS
FT                   YGAKYREAMLFQPASSYCEICHTFKFDFQSKQEYFDALGDPKKLQEHTISKGIACEECH
FT                   GAGGHLDGGTGGMQSNCERCHQRFQYDPTLQDTPEAQEKGEYAFGVKMKSLCPSCGTEG
FT                   SQMYNSEHYEKGMRCTTCHDPHEVTDGTWMSGITKPKLKKDCQDCHEAQTLIASNTDTH
FT                   SEQTCQSCHMPNMGSCENFKAMQFPDQAGFDAVRKSHMWKIDVDPVRKTINPPEGEPRT
FT                   QGPDGGKGWTVAKNEEGRSYLDLMWSCARTAISDHDVVENKGCHSQFQSELEVGLHYED
FT                   QKEIYGEVMKMQTPVKEVYAKVEQALERIDQLLEVTKLSVEDKTQVLMLAEKAEETVNL
FT                   VKKDGSWGVHGFRYTQKRLDAALTYVTQAQNILDGTGYAAK"
FT   sig_peptide     607731..607805
FT                   /locus_tag="Ssed_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 25"
FT   gene            609839..610267
FT                   /locus_tag="Ssed_0494"
FT   CDS_pept        609839..610267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35107"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI4"
FT                   /protein_id="ABV35107.1"
FT                   /translation="MKKALGQIVVSLTLLLSAATCFAGGGSDMAPAPHQDVQLNPISMT
FT                   EAETLVGKEGVYFFDVNTLELWAEGYIPGAIYFNVKDWKKLLPENKDTVMVFYCANRLC
FT                   NASEIAARAVMKLGYTGVRHMYDGIYGWRLANRVTEKP"
FT   sig_peptide     609839..609910
FT                   /locus_tag="Ssed_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            610330..611121
FT                   /locus_tag="Ssed_0495"
FT   CDS_pept        610330..611121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0495"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="KEGG: slo:Shew_0350 peptidylprolyl isomerase,
FT                   FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35108"
FT                   /db_xref="GOA:A8FQI5"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI5"
FT                   /protein_id="ABV35108.1"
FT                   /translation="MKKFTKSSLAVITGLSLFVSGYSIADDDTSSDVQQQSYSIGASLG
FT                   KYVSSQIYSQKQLGAEVDVDLVVKGVIDALKGEQKYSDEEILTFLNQRAEQLNAAREAE
FT                   DARIALKNMTEGSAYLASNKKSDKVTVTESGLQYEVITMGEGRKANPEDVVTVHYKGLL
FT                   IDGTEFDNSYERDEPNRFALMSVIEGWQEGIPLMPEGSTFKFTIPSELAYGKKQVGIIP
FT                   PSSILVFEVELVKVEEPGENSHGMGLSGMGMGGMMGGGKAH"
FT   sig_peptide     610330..610407
FT                   /locus_tag="Ssed_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            611182..611904
FT                   /locus_tag="Ssed_0496"
FT   CDS_pept        611182..611904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0496"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0351 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35109"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI6"
FT                   /protein_id="ABV35109.1"
FT                   /translation="MNSLAIGIGVTLCAFIALIWRHHLRCLNQGVIHIAKQSNACDSEV
FT                   ITPSLDIKIPVLLSIVLLFSSVSLYSQLGHFSDWDKGSVDEHIDYLITADINKNAKTVN
FT                   EQPNNEIALLNLAQSYADGGLYSDSVKTFDELLQLTGDDAGILGMKANAMYYRDNRAMS
FT                   LDIDLVIARALAIDEYEFQSRLLLATHGYLNGNYEEAIKQWELLLKSDSQSFNRDSINN
FT                   AILRAEQKIANRSVTASE"
FT   gene            611968..612678
FT                   /locus_tag="Ssed_0497"
FT   CDS_pept        611968..612678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0497"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: she:Shewmr4_0492 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35110"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI7"
FT                   /protein_id="ABV35110.1"
FT                   /translation="MSENIERRRFLKCLGASSLIIAPLGCSSVKEKESDANKPHYAMVF
FT                   DQNKCTGCGECKEACNLANNLPEGKSRLLLEQHSGGLEGQPCPHCGKTTECGCERKFVR
FT                   VSCQQCKNAPCVTVCPTGAAHRDEKTGIVTMDASKCAGCKYCIGACPYDARFINKETDV
FT                   ADNCDFCLHSKLAIGELPACVQKCRYDALIFGDINDPTSYVSKLLRVKDSVRVKPGFGT
FT                   EPSLRYIPIVKLGV"
FT   sig_peptide     611968..612063
FT                   /locus_tag="Ssed_0497"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.628 at
FT                   residue 32"
FT   gene            612681..613628
FT                   /locus_tag="Ssed_0498"
FT   CDS_pept        612681..613628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0498"
FT                   /product="polysulphide reductase, NrfD"
FT                   /note="KEGG: slo:Shew_0353 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35111"
FT                   /db_xref="GOA:A8FQI8"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI8"
FT                   /protein_id="ABV35111.1"
FT                   /translation="MDGSMEFTMGLSDGIAWPWPIAVYLFFAGISGGAIATAIFIRFYK
FT                   GQTENTPFYKAAALISFVTISLGMLCLVLDLTNPLFFWRILVYYNLNSVMSIGVIALTA
FT                   YIPLVALITLFAFEDEIRKIPALGMLLPVIDKLKGVRRPCEVAVLILAMAVCAYTGFLI
FT                   SALIRFPIINTSVLPALFIASGISAGAASAKMLAVSMFKEEMHSQDMKLLHGAEWPIMA
FT                   AEILFIFMIAMSLFTGNAGMQSAFSAFHIGDWAGVFWLGVVGVGFCGPLLLNFATSKRV
FT                   SHSAQAFYASGVCAVTGMMCLRLFIIYAGQNFAI"
FT   gene            613800..614288
FT                   /locus_tag="Ssed_0499"
FT   CDS_pept        613800..614288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0499"
FT                   /product="NosL protein"
FT                   /note="KEGG: son:SO0485 NosL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35112"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQI9"
FT                   /protein_id="ABV35112.1"
FT                   /translation="MKKLILILLVIPVLFACSRGDAVTKSVEAQAIHDHERCHLCGMMI
FT                   TKYPGPKGQLQLKSEEIVPKFCSTRDMFNFSLQPENQRQITALMVHDMSATDWAHPDDK
FT                   HFIDATQAWYVYGTSRKAVMGPAVASFATEEGAVQFAKEFGGAVLGYEQITLELLLGE"
FT   sig_peptide     613800..613868
FT                   /locus_tag="Ssed_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.611 at
FT                   residue 23"
FT   gene            614295..615584
FT                   /locus_tag="Ssed_0500"
FT   CDS_pept        614295..615584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0500"
FT                   /product="periplasmic copper-binding"
FT                   /note="KEGG: shw:Sputw3181_0582 periplasmic copper-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35113"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ0"
FT                   /protein_id="ABV35113.1"
FT                   /translation="MFRICLLAVIFGFSALSQAGSATVFDTESLRLELEHANPGDHIIL
FT                   NPGLYEGRFDIEKPLSLSSRGGSTIDAQGEGSAITIHSSGVEISGLTIEHWGNDHYERD
FT                   SGILVMAGSDDVSINNNRLSGDGFGIRADELNRIKINDNIVTGNASLYKLDRGDGIHLD
FT                   HVVGAEVWGNVISHVRDGVYIESGSHSKVAGNRFFEQQYGIHYMYSSMDEAFNNQSYRV
FT                   DGGYALMSSKQIHLHSNQVWDAVDFGILLNMSQDSVIEGNRVEQILNPDENPVQGKEGK
FT                   GIFIYGARDNRVVGNRFSLCDIGFYMAMGGEGNLVYENQFVDNFSQVKYVGDKLLEWSK
FT                   DGRGNHWSGYLGWDHSSDGIGNSPYRPNDNIDRLFWLYPEANFLMGSPIVMVLRWVQRQ
FT                   FEIGEPSGIIDSYPLLNFTPPFDFEFGVPH"
FT   sig_peptide     614295..614354
FT                   /locus_tag="Ssed_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 20"
FT   gene            615611..616513
FT                   /locus_tag="Ssed_0501"
FT   CDS_pept        615611..616513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0501"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0356 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35114"
FT                   /db_xref="GOA:A8FQJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ1"
FT                   /protein_id="ABV35114.1"
FT                   /translation="MNTAVSARNISHNFGADVALDDVSFEMKQGQTMALLGHNGAGKST
FT                   LIKILLGLITPTGGVINILGRNIRKNTSRSDLKLGYLPENVSFYDKLTGEEILTYFAEL
FT                   KGVGKNRVCELIEEFGLGYAKDRALKTYSKGMKQRLGFAQAILCEPELLLLDEPTVGLD
FT                   PVASQFLYGKIDELKRLGCAVIVCTHELSLIENNIDTALILGKGRCLASGNLGELRYES
FT                   RLKTRLTSPSLAALVNDSERLASLYTDNALLLDSESKQDVVQYLTAECGLFDFALKEPG
FT                   LAEIYHFHMQKYSQLGVVS"
FT   gene            616515..617345
FT                   /locus_tag="Ssed_0502"
FT   CDS_pept        616515..617345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0502"
FT                   /product="copper ABC transporter, permease protein"
FT                   /note="KEGG: slo:Shew_0357 copper ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35115"
FT                   /db_xref="GOA:A8FQJ2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ2"
FT                   /protein_id="ABV35115.1"
FT                   /translation="MLFHSSVLVIAKKEIRDSLRNRWVTFISLIFLLLSLSVTFAGSAV
FT                   VGQLALPKLDALISSLSTISVFIIPLAAMLVSYDAFIGEDESGTLLLLLSYPLSRFQIL
FT                   SGKLIGHSVIMSFTISFAFGLTAVLLLIFGDNYDVAATVGQFSQFILTSILLAITFILL
FT                   GYIVSLKATEKAKAVATVLFVWFLFVLIYDLLLLTLLVADISFFNQYIINVLIALNPTD
FT                   LYRAINLIGTDASKGSLATLSASGWGKIALYLVMGLWVSGLMLVANFVFKRRQL"
FT   sig_peptide     616515..616655
FT                   /locus_tag="Ssed_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.535 at
FT                   residue 47"
FT   gene            617625..618908
FT                   /locus_tag="Ssed_0503"
FT   CDS_pept        617625..618908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0503"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="KEGG: shn:Shewana3_0499 transcriptional regulator,
FT                   CadC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35116"
FT                   /db_xref="GOA:A8FQJ3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ3"
FT                   /protein_id="ABV35116.1"
FT                   /translation="MLKITPYLELDEEAKQLVDHANNVTVTLTVSESAVLHLLLLSSSS
FT                   VCTKEDLLAAGWPDRVVAATSLTQCVSTLRKKLEPYPEVMLRTIAGRGYQLNVSTRSHI
FT                   KMLAVNDAESVRAAIVDVSLLVKFSGIVIALMIGLSVWYFSDYHGVVQDTASWNADKSI
FT                   ELNIGGVKQDVQLLYKDNVAHLHPSMWQKHLAPEVNHLTHLNKFNGFALTDGNYYSMAV
FT                   CPDADDKSCSGKGLINITAIDPTPAGLNMKNFAALTKKMEQRIRYNRVIIPHNEPGTSG
FT                   FVEHHYHADVYYPVQGNMLVRSDISLSLIYEGEDSGKFYSAACITDEECATTPIKYKIK
FT                   GKFKQYAEQINGLDVDVFHVRVGQKELIKPDKVSSSAMHFYREIRKHEIVEEDLYFYRV
FT                   YKDTDTAVWIVPILGNLVAWYEYDKVKL"
FT   gene            complement(619041..619751)
FT                   /locus_tag="Ssed_0504"
FT   CDS_pept        complement(619041..619751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0504"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="KEGG: sbl:Sbal_0464 oxidoreductase
FT                   FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35117"
FT                   /db_xref="GOA:A8FQJ4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ4"
FT                   /protein_id="ABV35117.1"
FT                   /translation="MKTIRCKIEQVTPFNEAVYQIILKPETAFDFKAGQYLCVVMDEKD
FT                   KRPFSIASAPDAEHIELHIGAAVSESYPMQVVDRMQECLQNNATIEVEVPGGDAHLRHE
FT                   SQRPRLMIAGGTGFSYIKSIVEHQIALDLQVETTFYWGCRTQDAMYYETIAREWHDAHP
FT                   WMHFVPVLEQANDDWKGKQANLLDQIRTDFVSLNGYDIYIAGRFDMVGTARELFRTMGL
FT                   EEDHLYGDAFAFIK"
FT   gene            complement(619832..621313)
FT                   /locus_tag="Ssed_0505"
FT   CDS_pept        complement(619832..621313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0505"
FT                   /product="UbiD family decarboxylase"
FT                   /note="KEGG: slo:Shew_0360 UbiD family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35118"
FT                   /db_xref="GOA:A8FQJ5"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQJ5"
FT                   /protein_id="ABV35118.1"
FT                   /translation="MSFKDLRSFISHLEANGELKRISHPVDPHLEMTEIADRVLRAKGP
FT                   ALLFENPVGNEMPVLANLFGTPKRVAMALGKEDPLALREVGELLAFLKEPEPPRGFKDA
FT                   ISKIPMFKQALNMPPKTVRNAPCQEVIKTGSDVDLTKLPIQHCWPGDVAPLVTWGLTIT
FT                   KGPRQKRQNLGIYRQQLLDKDKLIMRWLDHRGGALDFKDFKEKFPGERYPVVVALGADP
FT                   VTILGAVTPVPDSMSEYAFAGLLRGERTDVCKAISCDLEVPATSEIILEGYIDPEEMAE
FT                   EGPYGDHTGYYNETDKFPVFTVTHITHRKDAIYHSTYTGRPPDEPAMLGVALNEIFVPI
FT                   LRKQYPEIIDFYLPPEGCSYRMAVISIRKEYPGHAKRVMMGAWSFLRQFMYTKFIIIVD
FT                   EDVNCRDWNDVIWAITTRMDPKRDTVMIENTPIDYLDFASPVAGLGSKMGMDATNKWEG
FT                   ETDREWGTPIVMDEAVKQRIDTIWDDLGIDDAPTL"
FT   gene            621781..622272
FT                   /locus_tag="Ssed_0506"
FT   CDS_pept        621781..622272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35119"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ6"
FT                   /protein_id="ABV35119.1"
FT                   /translation="MSQLSRVRRAVILCGLLSLSSLSAQASDRFNWSSNVWVQPTWSSS
FT                   WGHHYPNYNSGWRWGVGVSTGSPYWNNHGYYWNRPWYRPYWRNNWGYPYRYDRREYKRP
FT                   EPKVIAPPQRVTTSVQYASGLKSLPENARVMQRDGRTIYEWQGIEYVFDWSSETYRELR
FT                   "
FT   sig_peptide     621781..621861
FT                   /locus_tag="Ssed_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            622689..622946
FT                   /locus_tag="Ssed_0507"
FT   CDS_pept        622689..622946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0507"
FT                   /product="toxin secretion, membrane fusion protein"
FT                   /note="KEGG: son:SO_A0050 toxin secretion, membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35120"
FT                   /db_xref="GOA:A8FQJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ7"
FT                   /protein_id="ABV35120.1"
FT                   /translation="MTGIFRRQAVEAQKNKLHGDISLAQPLSIYSVVLALLAIVVATSI
FT                   FLSFSNYARKETVRGYIVPDKGVIKTHASRSGNVMLIILS"
FT   gene            623989..624969
FT                   /locus_tag="Ssed_0508"
FT   CDS_pept        623989..624969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0508"
FT                   /product="putative CheW protein"
FT                   /note="KEGG: sbl:Sbal_3194 putative CheW protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35121"
FT                   /db_xref="GOA:A8FQJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ8"
FT                   /protein_id="ABV35121.1"
FT                   /translation="MNDLKKSEILTESGTNELEIIEFHLHKLLPDGGFKVCHYGINVAK
FT                   VREVILVPSTSDYPNAQPHMVGVFSLRDILIPLVDLAGWLGIPTKDDLTHKVVIVTDFN
FT                   KMINGFLIDSVRSIHRVSWEQVESPSQFLEAGEQDCVVAVVRREGHLIMVLDFEKIIAD
FT                   INPELSMDKYDVLQDKSVIIDDTMLAKREAKTILVVDDSAFIRKMIENTLRSAGYNIIT
FT                   AKDGGDALEMLLEYERLAVDEGASVNDFVSAIITDVEMPRMDGMHLVKRLRDTSAYSNM
FT                   PIVMFSSLMSEDNRSKALQLGANDTITKPEIGRMVGMMDGYVLDD"
FT   gene            complement(625017..625547)
FT                   /locus_tag="Ssed_0509"
FT   CDS_pept        complement(625017..625547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0509"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: sfr:Sfri_3606 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35122"
FT                   /db_xref="GOA:A8FQJ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQJ9"
FT                   /protein_id="ABV35122.1"
FT                   /translation="MSRIITETERLIIREFNLNDAAAVLHFNAPEEVNRYTGDAGMCES
FT                   LQDAIAIIRDIWLVEYDKFGYGRWAVVLKETGKVIGFCGFKNESRIGAVDIGYRFHPEH
FT                   WGKGYATESNMACVEYARQEMELDRVVGDAAAENRASINVLLKLGMSFDKQYREDQFTV
FT                   NRYQMFLKSAGGN"
FT   gene            complement(626137..626637)
FT                   /locus_tag="Ssed_0510"
FT   CDS_pept        complement(626137..626637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0510"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: cps:CPS_2140 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35123"
FT                   /db_xref="GOA:A8FQK0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK0"
FT                   /protein_id="ABV35123.1"
FT                   /translation="MKQLATIFMITMALTISGCASSVSETAKVEYLTYVSTGQAVPVKH
FT                   FTDSHGNSIDLTESHNAKLLILFATWCPDSQRAMKALQASDLILDPNLDIIGIGREENK
FT                   EVLDKFANEYQINFPLVADSDRSIYAKFANAGIPRLILLDGENHIVKAIIAEGDNPLAE
FT                   VRW"
FT   sig_peptide     complement(626569..626637)
FT                   /locus_tag="Ssed_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.512 at
FT                   residue 23"
FT   gene            627002..628204
FT                   /locus_tag="Ssed_0511"
FT   CDS_pept        627002..628204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0511"
FT                   /product="putative tyrosine-specific transport protein"
FT                   /note="KEGG: ppr:PBPRA2465 putative tyrosine-specific
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35124"
FT                   /db_xref="GOA:A8FQK1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK1"
FT                   /protein_id="ABV35124.1"
FT                   /translation="MNKSKIFGSMLIIAGTTIGAGMLALPLASSGLGFGVASIIMLLIW
FT                   SLMTYTALLMIEVHQFAPADATLHTLAYKLLGRKGQLIASFSMMFLFYALCAAYIAGGG
FT                   EQIHSKLTSWFELDIPMQLGAILFTVLIGTVVAIGTRSVDMINRSLFSLKLIALVLMLF
FT                   LLLPHVSVDNLVALPVHQGLVLASLPVIFTSFGFHGSIPSIVRYLGKDTKALRWIIVVG
FT                   SALPLAVYLLWMLASQGVLTQGDLMGSQSLNGFIGSLSRLLHDPMIANTVSIFADLALA
FT                   TSFLGVSLGLYDFIADLLKRSTKPSHRVQVALVTFMPPLGFAMFYPQGFIAALGYAAFA
FT                   LVVLAIFLPVAMVSTQRRQVGLGGYRVRGGALGLGLVTLAGILIMTVQLLQMFDALPAV
FT                   G"
FT   sig_peptide     627002..627109
FT                   /locus_tag="Ssed_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.230 at
FT                   residue 36"
FT   gene            628361..628451
FT                   /locus_tag="Ssed_R0023"
FT                   /note="tRNA-Ser1"
FT   tRNA            628361..628451
FT                   /locus_tag="Ssed_R0023"
FT                   /product="tRNA-Ser"
FT   gene            629048..629992
FT                   /locus_tag="Ssed_0512"
FT   CDS_pept        629048..629992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0512"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: saz:Sama_2899 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35125"
FT                   /db_xref="GOA:A8FQK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK2"
FT                   /protein_id="ABV35125.1"
FT                   /translation="MKKIDHLDSFTLSVFVELYEQKSGTAAAAKLAITQSKVSRTLTSL
FT                   RHIFENELFIRQQHGMKPNHLADRLYPLAKTLVANYQSLAHTMEITVAENKAVNIAAQG
FT                   NFHNIIFDCLNQVTIGEGSPFSFELHTITSDFQKKLVNGVFDYCISINPAQADGITRYE
FT                   IGEIGRYFLVAKKGHPIFNSKITLENILKYKVAISNYALDEQKMPRIDKIAYQKKLPIT
FT                   VALKISDLKLLLDYLELGDCVGLVAGSVFLHTLQERPELEFLDITELSTNLFSETSTYK
FT                   ELKYYLQANDSSDHILALKLAEKLREHFSYDNQ"
FT   gene            630551..631477
FT                   /locus_tag="Ssed_0513"
FT   CDS_pept        630551..631477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0513"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: slo:Shew_0759 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35126"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK3"
FT                   /protein_id="ABV35126.1"
FT                   /translation="MNLDRRQAMGKIVGFAGAAAVSPAVFAADTCPVDGAIGLGSDGGA
FT                   DLGANLLAYVELDPFEVAKRAYEGYVRGGCMYGVFNAVVKELAAQGHEDACNFAAIPTN
FT                   ITVYGGSGVKGWGSICGCVNAAAMIVNILGGVDQVAVIGAINRYYEKTPMPRGDDKFMN
FT                   YIGAPIFHNDAGELLTPDMIGQSTADSILCHTSVSHWSAASKYGGAHKAKYERCAQVTA
FT                   EVAFKTVEFLNQALKGELTTDPELEMVAKGNDDCYGCHTGTKREPDTYIGSDVNSFMEC
FT                   QTCHAPHDVTSGLTGMHADATCSTCHN"
FT   sig_peptide     630551..630634
FT                   /locus_tag="Ssed_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            631488..632033
FT                   /locus_tag="Ssed_0514"
FT   CDS_pept        631488..632033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35127"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK4"
FT                   /protein_id="ABV35127.1"
FT                   /translation="MRKLLITASLALLLSACGSDDDVSVEPIDPVDPVVPVEPTDPISA
FT                   SVTIDQANEIDVIISSVDPQSFAIAFTLTDADNQAITDAGSDFEVMYLSMPAEITSAFS
FT                   MPWHNASKFGCDAEESDCIDTLVEVSPGSYTFTPASQPVFNMDTQTLRLSVMVAGALAQ
FT                   SKPEIVKPIGDHFWLPTS"
FT   sig_peptide     631488..631544
FT                   /locus_tag="Ssed_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.711 at
FT                   residue 19"
FT   gene            complement(633107..633397)
FT                   /locus_tag="Ssed_0515"
FT   CDS_pept        complement(633107..633397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_2184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35128"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK5"
FT                   /protein_id="ABV35128.1"
FT                   /translation="MLRILGLTFLLILSGYVLAEPIAETHAEMSGCESCHINGEPSDDM
FT                   VHENSSCVECHGPLSDFADETHQRHHDVLECSNCHLAHDEVKLNDSCVNCH"
FT   sig_peptide     complement(633338..633397)
FT                   /locus_tag="Ssed_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(633420..634361)
FT                   /locus_tag="Ssed_0516"
FT   CDS_pept        complement(633420..634361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0516"
FT                   /product="formate-dependent nitrite reductase, nrfD
FT                   protein"
FT                   /note="KEGG: son:SO4568 formate-dependent nitrite
FT                   reductase, nrfD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35129"
FT                   /db_xref="GOA:A8FQK6"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK6"
FT                   /protein_id="ABV35129.1"
FT                   /translation="MNPFHFDSLVWHWPIAIYLFLAGISAGAICFAVLLKHFKLGKSAY
FT                   KSSFVQAACLLAPLAVFAGLGILVLDLTKPFDFWKILVFYNPTSIMSVGVAVLMIYQVA
FT                   LFSWLACLFKEPISNWCDHRWPLIDRILNILDKHEPSITGLLVMLALSLGAYTGFLLSA
FT                   LTTFPMLNNPVLPMLFLVSGISSGAAGTLLGGLLLKGNPDSKEVHFIHHIEIPIILFEL
FT                   VLLFTFFIGLIISGGQSQAAALTALGEGFWGWVFWAGIIVIGLTLPLAFNLFMTASSKR
FT                   KLSYVAITASCSLLGVLLLRNFILYTGQMTVA"
FT   gene            complement(634358..635047)
FT                   /locus_tag="Ssed_0517"
FT   CDS_pept        complement(634358..635047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0517"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: shw:Sputw3181_3894 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35130"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK7"
FT                   /protein_id="ABV35130.1"
FT                   /translation="MENKRRLFLKCACATAVGAVGSTKLIAAQSDTKTDDTEAEVNYAL
FT                   IHDETKCIGCEVCVDACRETNNVPEGVSRLEIVKTGPFGEYPDQYFSFSRKSCQQCDGT
FT                   PCVNVCPTGAAYKDPKTGIVSVDSWKCVGCMYCIAACPYQVRFINPVTKAADKCDFCKE
FT                   TRLKEGKSPACVAACPTKALVFGNLKDPDSEIVKVLKTTPNYRSKTDLGTRPKLFRIAA
FT                   KNGEIKL"
FT   sig_peptide     complement(634964..635047)
FT                   /locus_tag="Ssed_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 28"
FT   gene            complement(635060..635530)
FT                   /locus_tag="Ssed_0518"
FT   CDS_pept        complement(635060..635530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35131"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK8"
FT                   /protein_id="ABV35131.1"
FT                   /translation="MSSFKKVFTLSILTLTTFISTPLSISYANTLELTINTNKQCIMCH
FT                   KKNGKMFGIHSSNSLELRCQNCHREKEGHPRKKSSLIKFSDHSLNTAEEQTAVCTTCHN
FT                   SDDLTEVDWTHAVHSNKVNCAKCHQLHTETDPVIAISTGERRQLCVNCHESR"
FT   sig_peptide     complement(635444..635530)
FT                   /locus_tag="Ssed_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.881 at
FT                   residue 29"
FT   gene            complement(635613..636107)
FT                   /locus_tag="Ssed_0519"
FT   CDS_pept        complement(635613..636107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_3155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35132"
FT                   /db_xref="GOA:A8FQK9"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQK9"
FT                   /protein_id="ABV35132.1"
FT                   /translation="MNATVIFNYAFMYFVLFLVVPSVIIVFAMTCIKFFKSEKIQTEGV
FT                   IIELTPEKTKAKFSALTARLNEIARGKYNVLYGASLGSILDVKSDNNHHTYENIKNCQL
FT                   DYVILDEQSSVKLVITDPEHNTPENSDFIDSSLAKVGVNVIHISDNKQCDDLLVRELLV
FT                   A"
FT   gene            636590..637555
FT                   /locus_tag="Ssed_0520"
FT   CDS_pept        636590..637555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0520"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: shn:Shewana3_3964 transcriptional regulator,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35133"
FT                   /db_xref="GOA:A8FQL0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL0"
FT                   /protein_id="ABV35133.1"
FT                   /translation="MNSISFSNLDLLSINILVNLYEKKSVTKVSIKLNISAPKVSRCLK
FT                   HTREVLGNELFIRKKHGLIPNEFADKVYPVAKKILVCCSELQKINCGVTNDDLCHFEIS
FT                   APDIISFPFPKLLLSMIHSEKENISFNISQWGRSSIDDVISGKTDFGICSSDSDDVVGS
FT                   SDKNLISIPLAKLDSLYLICDHNHPLLKKNINLNSIANYPYVDCNIGSIVQSRSQFQEY
FT                   CKQNTMQLDVEVEVCGAYSLFDCLRERNAVTLLPFSSIYNVINSMPDFHACRLSKVEVE
FT                   HFYTNLSIPTLYLVYNRNNQKPNLPWLVDAIKSLVSSTLN"
FT   gene            complement(637776..638084)
FT                   /locus_tag="Ssed_0521"
FT   CDS_pept        complement(637776..638084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35134"
FT                   /db_xref="InterPro:IPR024331"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL1"
FT                   /protein_id="ABV35134.1"
FT                   /translation="MPKNTLSRSLSYTDWYNIRPPFDGEVYVKENDWKFYLGDTIWAPE
FT                   HNKVGKWRMTLELKGKVIAEKTFKVHLNDELPRQTNKSIQMDDDAEKIASFWKRRGC"
FT   gene            638859..639029
FT                   /locus_tag="Ssed_0523"
FT   CDS_pept        638859..639029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35135"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL2"
FT                   /protein_id="ABV35135.1"
FT                   /translation="MTKKTVKFEYEKETKNSVRYQEVPESGQAPIMGTVYVQKWFAGDT
FT                   KRFEITIEKQD"
FT   gene            complement(639199..640302)
FT                   /locus_tag="Ssed_0524"
FT   CDS_pept        complement(639199..640302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0524"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="KEGG: vfi:VF0872 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35136"
FT                   /db_xref="GOA:A8FQL3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL3"
FT                   /protein_id="ABV35136.1"
FT                   /translation="MLFNNGLKQENAALKQQLQELKDKHDQEIKELVEELKRKDFEHNK
FT                   LHQEQQLDATLITSNLRGGRMLETIRTGLANSAEELIHENEELKQLDEMFAQTHTALSQ
FT                   LEARAQKISEQTDSTMNSATALDETAKSIGQLIVAIQDISSQTNLLALNAAIEAARAGE
FT                   AGRGFAVVADEVRTLAGNAHEASDKIERLVNRVLGQTHEIKTSISENQLYAADISASSE
FT                   QIDVIVKEVLSKSQHMQKVIHLATARSFLDTVKLDHAVWKNNVYSHLQERDYQAQVNKH
FT                   TECRLGKWYFEGAGAEQYSHLASFNGLNQPHQLVHDSGHHAIQAGQSGDQHALIKHVEA
FT                   MEDASEGVVHSIDRLLGEVTSEQRRAL"
FT   gene            640603..641556
FT                   /locus_tag="Ssed_0525"
FT   CDS_pept        640603..641556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0525"
FT                   /product="Nitrilase"
FT                   /EC_number="3.5.5.1"
FT                   /note="KEGG: pol:Bpro_3376 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35137"
FT                   /db_xref="GOA:A8FQL4"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL4"
FT                   /protein_id="ABV35137.1"
FT                   /translation="MKKVVTMPKIAIVQESPILLDRDATIEKAVTLIEEAASAGAELVV
FT                   FPEAFIAGYPAWIWRLRPGGDWGTSEALHARLFHSSVDIEAGELVPLCSAARANQVTVI
FT                   CGMNERDGLQSRATLYNTVVIIGSDGLILNRHRKLMPTNPERMVWGFGDGSSLKVVDSH
FT                   VGRISTLLCWENYMPLARYTLYSQGVEIYVAPTYDSGDGWIGTMQHIAREGRCWVICSG
FT                   VVLEHSDLPDDFPDKEKLYPDSEEWINPGDSVVVAPGGEIVAGPMRREKGILYAEVDSV
FT                   AVATSKRALDVAGHYSRPDIFTLEVNTQVQNSIKFK"
FT   gene            complement(641660..642463)
FT                   /locus_tag="Ssed_0526"
FT   CDS_pept        complement(641660..642463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_4008 transcriptional regulator,
FT                   LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35138"
FT                   /db_xref="GOA:A8FQL5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL5"
FT                   /protein_id="ABV35138.1"
FT                   /translation="MSAQQSGMVCNRIIESFLEKLAPFGIKRFYYCIIPDELSNVCIVT
FT                   DDQANILNSDGNEELHIAKMIDLKKMRFAVASDPEILKFREEFLHRFARNDEGYQLSGP
FT                   SIRKKYNPYIWPENTMPERRKRSFEQLLNLYQIRTRISFYHPVKDKKGWIGICNLFSSD
FT                   KRGQVIDNISSTPDELETLLREFAETFNALAFKTINPISNFRVLSPTCVEILSLVAQGC
FT                   SSEEVGKQLYMSERGVNYHLDRARVILTARNRTNLVSKAYQSGLL"
FT   gene            complement(642520..644379)
FT                   /locus_tag="Ssed_0527"
FT   CDS_pept        complement(642520..644379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35139"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL6"
FT                   /protein_id="ABV35139.1"
FT                   /translation="MMKRNSIIAVLALSFALGGCGSDDSPTPEPPIPPEPPIVKPDYVF
FT                   GGPTEDEQKLNKVIQFAIVKGFSPLDDSDEAKKSKAKSYSSGHEIEGVLESKMVADAAK
FT                   LGLKVDYLLPPTAINMSGVKIDSIRPDIFQDGRGSVMDLLLWAAKKYNLDIEYEKDENL
FT                   KTHFITSIEGITGLPEVVDQDNLGKTEGQGWKYLVGPSIWEHKKEGSYETESYYYKEEE
FT                   IYFRMDHHPLKNEMSIVLVAAQPGEMDIRKKKYQKEMDRLAENGGKVIIPEIVIDFKPA
FT                   KTTETGEILIPNQRAVFKDIEVTPHNLRSDIYKEGTITELDAWLSLVEQRPDLKIDWSY
FT                   WPRLSTNSNVQGYVATAISFNGRDDVGNIVNERYTNNGSCGFVHHTGEWENYMDSGAQN
FT                   GLYQWVMCSARTDMGGDEYRKACYGQIPGILGYRARNYGEGEQFENHNPKGRGYMKFGL
FT                   PFGGNDPHLTGDAMIIYGPEYINYIGAAFGNGYGNQESTSGCDAEAPEIDPTRIKDISQ
FT                   ARAPLTPSHFGWKIPDCTTCHNAANSHVVQDMAPWECAECHGNNGAPDSHGELLTCGFC
FT                   HAKTLAKHGDAYSTKDDYYSEQTNFKEPESCLTCHVEKQEGTQ"
FT   sig_peptide     complement(644311..644379)
FT                   /locus_tag="Ssed_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.601 at
FT                   residue 23"
FT   gene            complement(644770..645162)
FT                   /locus_tag="Ssed_0528"
FT   CDS_pept        complement(644770..645162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0528"
FT                   /product="protein of unknown function DUF971"
FT                   /note="KEGG: slo:Shew_0373 protein of unknown function
FT                   DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35140"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL7"
FT                   /protein_id="ABV35140.1"
FT                   /translation="MTNPESPMVTALKLKRKSRQLEITFDTGETFQISCEMLRVYSPSA
FT                   EVHGHGNPVLVTHKKNVNIKELTPVGNYAVKITFDDGHDTGLFSWQILHGLATNQVELW
FT                   ENYLARLRAAKASREPLIDMAVKYYK"
FT   gene            complement(645332..647365)
FT                   /locus_tag="Ssed_0529"
FT   CDS_pept        complement(645332..647365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0529"
FT                   /product="Methyl-accepting chemotaxis protein-like protein"
FT                   /note="KEGG: ppr:PBPRB1868 hypothetical chemotaxis
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35141"
FT                   /db_xref="GOA:A8FQL8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQL8"
FT                   /protein_id="ABV35141.1"
FT                   /translation="MDAILNLTVRLKLLLGFGLVIAIFIISSSIVYTQLQDINTTQSRL
FT                   LELRTPTVQAGMNLEAAITQTLSGLRGYLILGGDPSKAKLFKDERAQGWDKLEQSLMTL
FT                   EGFAKNWTVPRNIERLNEMKMIIRQFKQAQQQIEDIAHTDKNIPSFDILLTKAAPTAAR
FT                   TLTALTAIIESEMANPSDIEHKRFLKTLADSRAAFAMGLANIRAYLLSGELKFKNNYLE
FT                   LKGRSDSLMLDLESSIDLMSVEQREQWDSFKLARSEFAPYVIQMFGSRSSAEWNQANHW
FT                   LGTLAAPRARKIKSILEEMRTSQANLFKADQRSLTEASDTLNFVLLLSGVLTIIFGAVI
FT                   AVAISQSVTRPLGGEPAEMVNIANSIAEGDLTLRFTHAANAKGLYLSMYKMHAKLKELV
FT                   SNIAGAAEQLTDTAVQTSGMSEQTNNNVQDQFQQTELVATAVEEMTVTVNEVSLNASNC
FT                   LSVIQESETTIKEGQENVLQTVGNVEKLASDINDATGVILSLQEKSAEINSVSEVIGSI
FT                   AEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALASKTQESISSINSVILSLQQSADE
FT                   AATAMQSSQNSAENTISEARSSGESLSKIAESSRQIVDMASQISVASEEQASVTLDISQ
FT                   NVQMIRSGAEQTSIGASEMVKTSEQLSTQANSLKSMVASFRY"
FT   sig_peptide     complement(647264..647365)
FT                   /locus_tag="Ssed_0529"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.824 at
FT                   residue 34"
FT   gene            complement(647610..648935)
FT                   /locus_tag="Ssed_0530"
FT   CDS_pept        complement(647610..648935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0530"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: slo:Shew_0374 heat shock protein HslVU, ATPase
FT                   subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35142"
FT                   /db_xref="GOA:A8FQL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQL9"
FT                   /protein_id="ABV35142.1"
FT                   /translation="MSEMTPREIVHELDTHIIGQHDAKRSVAIALRNRWRRMQLDVDFR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLAKAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DSAIKMTREDQMKKCKFKAEEAAEERILDALLPKPKEDWDNEKPDDSATRQIFRKKLRE
FT                   GQLDDKEIEIDVAAPQVGIEIMSPPGMEEMTNQLQSMFQNMGPGDSKRRKMPIKEAYKL
FT                   MIEEEAAKLVNQDDMKEQAIELVEQHGIVFLDEIDKICKRGESSGPDVSREGVQRDLLP
FT                   LVEGCTVNTKHGMVKTDHILFIASGAFQMSKPSDLIPELQGRLPIRVELSALTADDFKR
FT                   ILTEPHASLTEQHVAMMGTEDVKIEFTEDGIESIAQAAWQVNERTENIGARRLHTVMER
FT                   LMEDLSYDASDKSGNTFVIDAEYVSSHLDDLVQDEDLSRFIL"
FT   gene            complement(649009..649533)
FT                   /locus_tag="Ssed_0531"
FT   CDS_pept        complement(649009..649533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0531"
FT                   /product="20S proteasome, A and B subunits"
FT                   /note="KEGG: slo:Shew_0375 20S proteasome, A and B
FT                   subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35143"
FT                   /db_xref="GOA:A8FQM0"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQM0"
FT                   /protein_id="ABV35143.1"
FT                   /translation="MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNARKVRRLYHNKVLA
FT                   GFAGGTADAFTLFERFEAKLEMHQGHLMKAAVEMAKDWRSDKMLRKLEALLAVADDTCS
FT                   LIITGNGDVVQPENDLISIGSGGNFAQSAATALLENTELSALEIAEKSLTIAGDICVFT
FT                   NQFKTIEELNY"
FT   gene            complement(649764..650330)
FT                   /locus_tag="Ssed_0532"
FT   CDS_pept        complement(649764..650330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0532"
FT                   /product="sporulation domain protein"
FT                   /note="KEGG: slo:Shew_0377 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35144"
FT                   /db_xref="GOA:A8FQM1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM1"
FT                   /protein_id="ABV35144.1"
FT                   /translation="MKNRDYANRKPAKGKGKTARRGKQAPAPRRFPVLLLLITVSLLGG
FT                   FGYFLWSINDSAETTSPDVVEQPKKTVVKKDPNALPPKPKEEWTYQRELENKQVEVDIP
FT                   EQTAPTRPYQMQCGSFRTQSQAEQMKAVIAFQGLSANVRKVKGTTGDWYKVSLGPYDRK
FT                   RLAEKHRHILQGAGINGCIILYWEG"
FT   gene            complement(650433..652178)
FT                   /locus_tag="Ssed_0533"
FT   CDS_pept        complement(650433..652178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0533"
FT                   /product="Arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: slo:Shew_0378 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35145"
FT                   /db_xref="GOA:A8FQM2"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQM2"
FT                   /protein_id="ABV35145.1"
FT                   /translation="MKSHIQSLLIQALDALKQQGVIPTDFEARVQVDRTKDKTHGDFAT
FT                   NLAMMLTKVARKNPRELAQLIIDSLPQDSQVAKVEIAGPGFINFFIDENALASQLMAAL
FT                   NDDHLGIQLPEPQTVVVDYSSPNLAKEMHVGHLRSTIIGDSVVRALEFQGHNVIRQNHV
FT                   GDWGTQFGMLLAYMEELRAENGEQAQMELSDLETFYRAAKVRFDESEDFAIRARKLVVS
FT                   LQSGDEYCNKLWREFNDISLSHCHDVYERLGVSLTRKDVRGESTYNDDLEQVVKDLDAK
FT                   GLLSESNGAKVVFQDEFKTKDGDPLPVIIQKADGGYLYATSDLAAMRYRSNVLKADRAL
FT                   YFVDLRQGLHFQQVFKLARTAEFINPDMSLEHMGFGTMNGDDGRPFKTRSGGVVKLVDL
FT                   LTEADTRALELVRSKNPDMDQAELEKIAKVVGISSVKYADLSKNRASDYIFSFEQMLSF
FT                   EGNTAPYLLYAYTRVAGIFKRATDIDLSDAKMQLDHDKEKDLGNKLAQFGEVLSRMVTK
FT                   GQPHALCGYLFELAGAFSSFYEACPVLAAESEEQKKSRLLLSQLTAKTLKQGLDLLGIE
FT                   TLERM"
FT   gene            complement(652346..654574)
FT                   /locus_tag="Ssed_0534"
FT   CDS_pept        complement(652346..654574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0534"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: slo:Shew_0379 primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35146"
FT                   /db_xref="GOA:A8FQM3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM3"
FT                   /protein_id="ABV35146.1"
FT                   /translation="MLVSIDQSCHPMPLFVEVALPVPMRQAFSYKVPDSISTLPKKGMR
FT                   VKVPFGRQQLIGLVTGISDTCNLAPQQIKSIFELLDDEPLLPDSLYKLTAWAARYYFCS
FT                   LGQMLSQAIPVALRKGAEISSNTTTFWHLTQSGRSASLDTLKRAPAQKKVMEHLLKGEL
FT                   TQDEISSLALSKSALKALNERAWITQDERVNSIDLSWREKLELDEDPLTLNPEQAIAVA
FT                   TLNQQTGYHCTLLEGITGSGKTEVYLALLESVLSKGKQALILVPEIGLTPQTISRFKSR
FT                   FKVQVAVIHSGLTDNQRLAAWQQAKTGEAAIIIGTRSALFTPMAFPGVIILDEEHDSSF
FT                   KQQEGVGYHARDLAVMRGHLEKIPVLLGTATPSLESLQNALSGRYKHLELGQRAGNAEK
FT                   VRQGIIDISNQPLNTGLSHALLNEMRIHLDAGNQVLLFLNRRGFAPALLCHECGHLHEC
FT                   DRCDAFFTVHQSLGEIRCHHCGNHYAIPKQCHNCGSTMLMGQGVGTEQLANILEKEFPK
FT                   YPVVRIDRDTTSRKGALEAHLNAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGAL
FT                   FSADFRAPERFGQLYTQVSGRAGRARKPGTVLMQTHQADNPVLRELMHKGYGEFARGQL
FT                   NERKQALLPPAWHMLLIRAEAHQALDADNFLSQVAELLPQNEESEVIGPMPAPMDKKAG
FT                   KYRRHLIFQTKSRNQLQHAFEHALPQIESLPLAKRCRWSLDRDPQDLL"
FT   gene            654629..655435
FT                   /locus_tag="Ssed_0535"
FT   CDS_pept        654629..655435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35147"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM4"
FT                   /protein_id="ABV35147.1"
FT                   /translation="MARIIQIALFSFFLISVQFLGASYANAQMTHVSINQQLFGLGDYP
FT                   KLRVNIVSGHENLDKVQFIVRQTSGDERLMVKPINNFMLLLTGVDDVVDPSAQLIVKEY
FT                   RVNQWHLIKTLALFTDEQIAKGFSAKTQPKPKPKAKQKQVKQKVEVESGVAVSTKSTQN
FT                   SKPASAALLAAQTSNTSTVAELTQDNCVLEYDGNQTLWRIGTQYSQEWEMGTYGAMLAI
FT                   FEANPKAFNKGEISGLRADVALLCPSVPLKEKYRDNQMAKRIYEKL"
FT   sig_peptide     654629..654712
FT                   /locus_tag="Ssed_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.907 at
FT                   residue 28"
FT   gene            655695..655907
FT                   /locus_tag="Ssed_0536"
FT   CDS_pept        655695..655907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0536"
FT                   /product="ribosomal protein L31"
FT                   /note="KEGG: sdn:Sden_3354 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35148"
FT                   /db_xref="GOA:A8FQM5"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8FQM5"
FT                   /protein_id="ABV35148.1"
FT                   /translation="MKADIHPAYAEITATCTCGNVIKVNSTAGKALHLDVCGACHPFYT
FT                   GTQKIVDTGGRIDKFNKRFGALGKK"
FT   gene            656060..656920
FT                   /locus_tag="Ssed_0537"
FT   CDS_pept        656060..656920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0537"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="KEGG: slo:Shew_0382 nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35149"
FT                   /db_xref="GOA:A8FQM6"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM6"
FT                   /protein_id="ABV35149.1"
FT                   /translation="MNTFQLPSSSMLLTNLFFLTLALTILPTTQAAQAKITQQEGQVLN
FT                   DGVTSALCAPTHYDEQVELKYVNDGDTITLKDGRLVRLIGVDSPELDFKSPELSEPYAK
FT                   EARHFLQKELKPGQILNLSFDQKRLDPYGRTLAYVYTENGEHLQELLLSQGFAKTRVYQ
FT                   NDYFWQCLNQVELTARDKELGLWSHPDYRAKTVDELGRSDRNRWGEVKGVVTGYERKGQ
FT                   YLWLILDEKFYVGIPRAESGKFSNILNLNLLESPVIVRGSLYYSYKKWQLISSHPSQIS
FT                   LQNRP"
FT   sig_peptide     656060..656164
FT                   /locus_tag="Ssed_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.851 at
FT                   residue 35"
FT   gene            657089..658336
FT                   /locus_tag="Ssed_0538"
FT   CDS_pept        657089..658336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0538"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="KEGG: slo:Shew_0383 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35150"
FT                   /db_xref="GOA:A8FQM7"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM7"
FT                   /protein_id="ABV35150.1"
FT                   /translation="MSDLRQQALDYHEFPVAGKTAVCLTKPAETSMDLALAYSPGVAEP
FT                   VREIAANPDDAYRYTAKGNTVAVISNGTAILGLGNLGPLASKPVMEGKALLFKHFANID
FT                   ATDIEVKHRTAEEFINTVEAIADTFGGINLEDIKAPECFEIEKALIERCNVPVFHDDQH
FT                   GTAIVTAAGMINALEIQGKEIDKAIFVCMGAGAAAIACMTMLVKCGVQRENVYMLDRKG
FT                   VIHTRREDINEYKALFANNTDKRTLQEVIKGADAFLGLSGPDVLAAEDVALMADKPVIF
FT                   ACSNPDPEIRPEIAHDVRKDLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASRINDEM
FT                   KIAAVNAIAALAREEVPASVLAAYPNVSELSFGPDYVIPKPMDPRLLSNVAKAVAQAAI
FT                   DSGVAAIETLPDNYML"
FT   gene            658641..660551
FT                   /locus_tag="Ssed_0539"
FT   CDS_pept        658641..660551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0539"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: slo:Shew_0384 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35151"
FT                   /db_xref="GOA:A8FQM8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM8"
FT                   /protein_id="ABV35151.1"
FT                   /translation="MKLTQILTRKLTGFWLLSLAAVAFIFLLTALVSFTQLTYKFQQQK
FT                   VSEIESMLVHHYEHDSNSALSSWLPSILTAYKASKFQLLENGQPIYEYQTDDAGKGHVT
FT                   YESVLIEERHLKLSMTLPQPFQMYDLSWYELLILSGGIISVAFFVRFGHQWLSVQLVGI
FT                   EDLAARSKLILNNEYEQALAEKGHGKPRMINRALTHMLLELDDAQKQRARFDQFIRSNT
FT                   FLDPETGIGNRLFLKNRLDALSNARGMMAPGVMFLLEMEDLDLLQQELADESIEALLLQ
FT                   TINDINQILDTQANSIFARRSYNQFAIVVPQISLKDAEKLAVKLLKVCLSQALPATQNS
FT                   DDFYHIGVAYFKVGETKEQLLDESERALRAAQFQGASGWFMYDKGAVDEEFAKGSVRWR
FT                   SFLEYALVNRRLVVFSQPVVDSDMETHHLEISSRIRDNQDNLIRATLYIPMAIKCGLTP
FT                   QFERQVIETVLFDLLSDRSDTTTRYSVNLSLDTLLSRAFIRWLKTTLLEYRHLTSRLIF
FT                   EVNEDIVVHHREQLKDRLDMIRKMGASLCVDRVGQEVVSTQYIKECHFDLIKLHRSIVR
FT                   QIHLRQENQLFVRSLIGGLYRTDVQVFADGIESFEEWQTLKILGVSAGQGSIFSDPIEE
FT                   V"
FT   sig_peptide     658641..658748
FT                   /locus_tag="Ssed_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.856 at
FT                   residue 36"
FT   gene            660903..661817
FT                   /locus_tag="Ssed_0540"
FT   CDS_pept        660903..661817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0540"
FT                   /product="conserved hypothetical biogenesis protein MshI"
FT                   /note="KEGG: sbl:Sbal_3839 conserved hypothetical
FT                   biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35152"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQM9"
FT                   /protein_id="ABV35152.1"
FT                   /translation="MGKSLFSRLAFWQKSNSKIKIGIYVCPDKLIVYRAIDDSENSDEL
FT                   KATYEFVFDGTDWSGVFALIAKQFAPAQIQITLCSAFYQLLLVDKPNVESEEMTQALLW
FT                   SVKDMVSQPVTDIHLDYFEPPLPGHTKLNVVVVEKASLSALVLAAKDHDMEVVGINIEE
FT                   MAVTNLFTEEAQARLVLSHTSGQELLLTVVRQGELFMQRRVRGFNQLDSVSAEDLAFGL
FT                   ADNLSLELQRSMDYFESQLRQAPVASIELLINGHVGKLAELVSANFNQKVNAIEVDSVE
FT                   AKMAALALDEFNRDESAERGMNS"
FT   gene            661814..662425
FT                   /locus_tag="Ssed_0541"
FT   CDS_pept        661814..662425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0541"
FT                   /product="fimbrial assembly family protein"
FT                   /note="KEGG: slo:Shew_0386 fimbrial assembly family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35153"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN0"
FT                   /protein_id="ABV35153.1"
FT                   /translation="MTMKTRVNLFSASLLPPELRLSFNHLTLVLLVLVGLFTIAIGGSY
FT                   ALVSALETDKAELNKQKRNLDNQKQDLETALANRAPDSALVDEVDLLSQQVELKRMLLG
FT                   ELSQREALTSHGYSPLMKDLARVANSNIWLSRIQVDNNSFIFEGFSSAPHSVPLWVDRL
FT                   KLTDTLKGHAFASMTMSRGEGKPLAFTLTSKAGDSVENNQ"
FT   sig_peptide     661814..661954
FT                   /locus_tag="Ssed_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.691 at
FT                   residue 47"
FT   gene            662422..663072
FT                   /locus_tag="Ssed_0542"
FT   CDS_pept        662422..663072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0542"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: slo:Shew_0387 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35154"
FT                   /db_xref="GOA:A8FQN1"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN1"
FT                   /protein_id="ABV35154.1"
FT                   /translation="MKQRWQALGERFDLLSQRERVMVATAAVVVIGMLCYLPLESLLLK
FT                   YNALSKQITAITAENKISLQQIELYEQRLAQDPNDEYNNRLQVLKQQSADLDDQLSFQM
FT                   VDMIPADHMPTLLSQLLGKVTGIKLQEFKSIAPTPLLALDDEKKTNLYSHGIRLTLEGD
FT                   YFSLLKFIEAVESMPNKLYWKQMDYKVEEYPGANVVLELYTISVNKDFISVAN"
FT   gene            663059..663409
FT                   /locus_tag="Ssed_0543"
FT   CDS_pept        663059..663409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0543"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: she:Shewmr4_3487 MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35155"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN2"
FT                   /protein_id="ABV35155.1"
FT                   /translation="MLQIKASSLFSVFVSLLVLVTSTLHAETLRDPTRPGRGAVITDAR
FT                   ASGHANALVLNSVLKGETSSHAVINNKIFVLGDRVQGVKIVRIDSSSVSLADGRKLKMY
FT                   QAITETKGNKFK"
FT   sig_peptide     663059..663139
FT                   /locus_tag="Ssed_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            663406..665109
FT                   /locus_tag="Ssed_0544"
FT   CDS_pept        663406..665109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0544"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="KEGG: slo:Shew_0389 pilus (MSHA type) biogenesis
FT                   protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35156"
FT                   /db_xref="GOA:A8FQN3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN3"
FT                   /protein_id="ABV35156.1"
FT                   /translation="MRAINIITPLIALLLAACQTTDRPQPIESKQVLSDSVQAEQNRTT
FT                   TPPPAVMPDAIQKELASKELLSGLSPVLRTERRFDVSANDVDAKVFFPSLVQGSPLSVA
FT                   VHPGVSGTISLSLKGVTLSEALQVVEDIYGYEVSREGRILRIFPSGMRTETFPLNYLYM
FT                   ERQGLSLTSVNSGRISDSNDSNSSGSNNSNNSSNNSNSNSSNNNSDSNGNNSSNDTTNG
FT                   TFIRSTTKTDFWGELEKTLVSIVGSTGGGRQVVVTPQAGLVTVRGYPNELRQVRTFLQT
FT                   AETHLQRQVILEAKILEVTLSDGYQQGIQWDNVLGHVGSTDITFGTSENTEGLGDLITN
FT                   AIGGVTSLSVKGSNFNTMINLLDTQGDVDVLSSPRVTASNNQKAVIKVGTDEYFVTDVS
FT                   STTVAGTTPVTTPEVELTPFFSGIALDVTPQIDGEGNILLHIHPSVIDIKEQTKVIKIS
FT                   GSSLELPLAQSDIRESDTVIKAKTGDVVVIGGLMKSENIEVESKVPLLGDIPLVGELFT
FT                   NRSKSLKKTELVILLKPTVVGADTWRKELQKSKALLDRWYPEEDENGQGQ"
FT   gene            665113..666021
FT                   /locus_tag="Ssed_0545"
FT   CDS_pept        665113..666021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0545"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: sbl:Sbal_3834 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35157"
FT                   /db_xref="GOA:A8FQN4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN4"
FT                   /protein_id="ABV35157.1"
FT                   /translation="MYLQHFGLAETPFSLTPNTEFFFGLAPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLICRKLINELPKRFHCAYLPNPYLSPAELRWAVALELGLKYSADIDQ
FT                   MQLTGLIQQQLLALCAHGHSIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFA
FT                   QPELDQRLSLHNFRQLRQRITFSYCLRALTLDEAEAYVQHRLSVAGRVGKPLFSHRDTR
FT                   LLAKASKGIPRLINILAHKALLLSFGEGSHQIEYRHVKAAIVDTEDTKLGFQTNWLWFM
FT                   GFGMMSMLAGAGLHLFYGGVS"
FT   gene            666018..667259
FT                   /locus_tag="Ssed_0546"
FT   CDS_pept        666018..667259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0546"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: slo:Shew_0391 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN5"
FT                   /protein_id="ABV35158.1"
FT                   /translation="MSVINTMLKDLDKRQQSHELENLHVAPVQYQSSTPSKLPWMLLGL
FT                   VSLVLVSGIVFSWDRLTAKVSDDEAVLSVDSKSTENKAVDIKLAENMATENKAGALDEP
FT                   GLTSVAAPSIGADNRVAPEGKPDAGVTVKSEQRLTQLPAIPEQKRSSESGVKAAAKPII
FT                   KEQQVAAEEALPVITSKKQRTTSTPVSQSVKAEAPVVRSSNNGSMAVTEVKLSDDQLAQ
FT                   KRLMLASEAEQQGGQNDAIVYYNEALTLNPKLHQARKQLAALYYGKGRLDLATDLLRQG
FT                   ISLFPAEFDYVLLLARVQLASGNKAQALSTLSQIPDSSLLARQKWVEQSSLAQEVSDFV
FT                   LAEQGYRNLLGVEANQARWWMGLAYSLDAQAKYSAAKDAYKQAVLYKSVPGKGLSAQAF
FT                   DYIENRLTQLGEIE"
FT   gene            667256..669010
FT                   /locus_tag="Ssed_0547"
FT   CDS_pept        667256..669010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0547"
FT                   /product="type II secretion system protein E"
FT                   /note="KEGG: shm:Shewmr7_0469 type II secretion system
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35159"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN6"
FT                   /protein_id="ABV35159.1"
FT                   /translation="MKPKLKMRLGDLLVQEQIISEPQLMEALTEQRSTGKKLGRTLIDL
FT                   NSISEEQLLRFLSQQLHIPFIDISKRPIPPEVVNLLPEVQARRFRALVVEDNGDSALVA
FT                   MSDPADLQAMDNLEVLLTPKRLEIAVVTEGQLLDAFDNIYRRTDEIAQIAGKLEEEYAA
FT                   DDQFDLASLTDSDSDNETTVVRLLQSIFEDAVQMRASDIHIEPGDKVLRIRQRIDGQLH
FT                   ENILPEASIAAALVLRLKLMAGLDISEKRLPQDGRFHMEIKGHQIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLNETGMPPEILERVRKQIKRPHGMLLVTGPTGSGKTTTLYGVLSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCQ
FT                   NCAREYELTAQDKAWLNSTSQQDFSQAKFRIGSGCQSCNGSGYRGRIGIFEILELDEAM
FT                   IDAMRTGNPQDFARAAYLSPNFIPLAVSAFKYLAEGMTTIEEVAKLVEDVNETESPLSI
FT                   RQQQGTEF"
FT   gene            669099..670319
FT                   /locus_tag="Ssed_0548"
FT   CDS_pept        669099..670319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0548"
FT                   /product="type II secretion system protein"
FT                   /note="KEGG: shn:Shewana3_3659 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35160"
FT                   /db_xref="GOA:A8FQN7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN7"
FT                   /protein_id="ABV35160.1"
FT                   /translation="MATYKYRGRDAQGQQVTGLVDAASESAAADQLMSRAVIPLELDEA
FT                   KEKREFSLASLFKGKVSLDELQIFSRQMYSLTRSGIPILRAIAGLSETTHSQRMRDALN
FT                   DISEQLTSGRPLSSAMNHHPDVFDALFVSMVHVGENTGKLEDAFIQLAGYIEREQETRR
FT                   RIKAAMRYPIFVLIAIALAMVILNIMVIPKFAEMFSRFGADLPWATKVLIGTSNLFVNY
FT                   WPAMLVGLVATFIGIRYWHSTEKGEKQWDSWKLHIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADAVDNAYMHDRIVGMRRGIESGDSMLRVSNQSQLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGFVAGIVLILALGIYLPMWDML
FT                   NVVKGGS"
FT   gene            670354..670875
FT                   /locus_tag="Ssed_0549"
FT   CDS_pept        670354..670875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35161"
FT                   /db_xref="GOA:A8FQN8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN8"
FT                   /protein_id="ABV35161.1"
FT                   /translation="MQSQQQADGELVQMFGKVIAIVLLLTLLSILGFRYFASVDKISAQ
FT                   GLRLDHSKLLNVLAMVKGQWLAKGRPSEMRLEWDTSGFQDSEPFIIEGENSEEHTLVKM
FT                   SHGGWPLLDTADSVGCKQLWRQLLGRELVEQQVVTQLNPEGDVCSYIANNSDRLSYQLS
FT                   TGRVVFLTKE"
FT   gene            670947..671603
FT                   /locus_tag="Ssed_0550"
FT   CDS_pept        670947..671603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0550"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0395 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35162"
FT                   /db_xref="GOA:A8FQN9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQN9"
FT                   /protein_id="ABV35162.1"
FT                   /translation="MRIKNQMLNQVSRKQQGFSLIELVIVIVILGLLAATAIPRFLNVT
FT                   DDAEDASLEGVTGGLATAVGFVRAQWEVDGRSNSSVVLDGTTLSLDTRFGYPTGMVTSG
FT                   SDTGNGNTSATAMTDASCQEVFKYVLQSAPKNVIYTADARKARYTFRVLDGSGGTAIAN
FT                   TGTTVTNLDLCVYHQVASLALNTSSGVPTPTLDLNKGNGIAYNAGTGTVVTFTNN"
FT   gene            671696..672217
FT                   /locus_tag="Ssed_0551"
FT   CDS_pept        671696..672217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0551"
FT                   /product="MSHA pilin protein MshA"
FT                   /note="KEGG: saz:Sama_0461 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35163"
FT                   /db_xref="GOA:A8FQP0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP0"
FT                   /protein_id="ABV35163.1"
FT                   /translation="MKKQNGFTLIELVVVIIILGILAVTAAPKFINLQSDARVSALEGM
FT                   KASLQGANSLVYSKAAIAGDEKKAKGDWTGDNGVDIGTEDKAKTQYGYLQGLQVELENA
FT                   VDVKFNVGTSATDPKIKTDNKADWVIFVKSGVATIWQTDAPAACKFTYTESDGVGKTPS
FT                   FSDMPTASGC"
FT   sig_peptide     671696..671776
FT                   /locus_tag="Ssed_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.867 at
FT                   residue 27"
FT   gene            672263..672742
FT                   /locus_tag="Ssed_0552"
FT   CDS_pept        672263..672742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0552"
FT                   /product="MSHA pilin protein MshA"
FT                   /note="KEGG: saz:Sama_0461 MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35164"
FT                   /db_xref="GOA:A8FQP1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP1"
FT                   /protein_id="ABV35164.1"
FT                   /translation="MNKQSGFTLIELVVVIIILGILAVTAAPKFINLQSDARVSTLQGM
FT                   KAAIQGANSLYYSKAAIGSHEKKDSVTVEGVLVSYGYLQATKANMVLALEIAESDWTID
FT                   DTTDRVAGVPPAKSTPGVITISQTDAPSTCTFTYTEADSASDTPSFSVMPDADKC"
FT   sig_peptide     672263..672343
FT                   /locus_tag="Ssed_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.698 at
FT                   residue 27"
FT   gene            672951..673418
FT                   /locus_tag="Ssed_0553"
FT   CDS_pept        672951..673418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0553"
FT                   /product="MSHA pilin protein MshC"
FT                   /note="KEGG: shw:Sputw3181_3603 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35165"
FT                   /db_xref="GOA:A8FQP2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP2"
FT                   /protein_id="ABV35165.1"
FT                   /translation="MRTVLPQSGFTLVELVTTIILIAILSVVVLPRLMTSSSYSAFTLR
FT                   DEFVSELRKAQLLAMNNGDYCYRIAVDTTGYQLQGFDNTGCTGTAKLTETKQTFEGRAS
FT                   LELDSDSSKSFKVNFDRQGIASLGCSGACIKVIADETLTISIESQGYIHGR"
FT   gene            673408..674004
FT                   /locus_tag="Ssed_0554"
FT   CDS_pept        673408..674004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0554"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0399 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35166"
FT                   /db_xref="GOA:A8FQP3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP3"
FT                   /protein_id="ABV35166.1"
FT                   /translation="MAVNSLSITKRTGALVITKGFTLVELVVGMVVLSIALVMLTSMLF
FT                   PQADRAAETLHRVRSAELAHSVMNEIWGKRYDQNTNPNGGVPACGAAARPDLGLPAGLA
FT                   CTAPGALGPDTGENRNSYNDVDDYHGLNQNSLMLNAAVTTGVNADTYASRYPNYLLAVA
FT                   VTYPDTSDLNRKLITVTVTTPSGEQIVYNAVRSNY"
FT   gene            674004..674813
FT                   /locus_tag="Ssed_0555"
FT   CDS_pept        674004..674813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0555"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0400 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35167"
FT                   /db_xref="GOA:A8FQP4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP4"
FT                   /protein_id="ABV35167.1"
FT                   /translation="MSGLRQLRKSDGFTLVEMVMVIIILGILVLGVSSFVIIGTRIFVE
FT                   STSVDQVLSQSRFAIERMTREIRNAVPNSLRVTNTATYQCMEFMPIQGSASYIDLPIAP
FT                   EAASETGSIITPSQGINNTHRMLVYPLTPAHIYEADPTSSEGRLLDIEKVEGNTVTFDR
FT                   AVRISEASPRNRYFMVNNAVSYCFFTNGDVRRYEGYSMFNTAQPAPADMGDGVLMAEGV
FT                   VTGTGTWPINYTPGSLTNNAVVQLTPTFMVNGQEFQYQHQVQVVNVP"
FT   gene            674803..675288
FT                   /locus_tag="Ssed_0556"
FT   CDS_pept        674803..675288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0556"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: sfr:Sfri_3740 MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35168"
FT                   /db_xref="GOA:A8FQP5"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP5"
FT                   /protein_id="ABV35168.1"
FT                   /translation="MSPNMSHRANRPFRGFSHCRAKQQGSALVIGIFVITVMFLMSAAL
FT                   INVLEDADEQVSLEVWGTRALFAANSGADRALAQLFPLTATDASAASCTNVKEWKNLPS
FT                   VPGFHGCSVVLTCVTNTVDSVNSYRITSTATCETGNCSGNDSSCLRVNRQVEVEARD"
FT   gene            675290..678010
FT                   /locus_tag="Ssed_0557"
FT   CDS_pept        675290..678010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0557"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /note="KEGG: slo:Shew_0402 MSHA biogenesis protein MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35169"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP6"
FT                   /protein_id="ABV35169.1"
FT                   /translation="MFKIVLSLALLFPALAIAVPYCSDIFTDPPTGDHGENGLTPPANI
FT                   GPPLGDLNCTRKRGCDNSTSGYFLPGDYSFSEGNFHGGGPSLVNHITTNGTTARLYFDR
FT                   VSLSGVSLNTYGKAEDLIIYVREDLTIAGHNHINGIIYVVGNVSLTGNGSVTGGLAAGG
FT                   SAGVGGNGDFVFDEEAIDNADFGGMCIPGPKPDLNHYRLEFSSGALSCKAKDILIRACA
FT                   DEYCATETSVLSSVDLTKNGGVYSTVNFAGHTVPAAELWHADGGTVLVGLGATAPSAPY
FT                   RCFIDGLEVANIADCQLTFEDTGFYFDAPDTISYKDSGQFELFAATKDPVTQKCESLFK
FT                   NQTKSVDFSFNYKDPNPVNNPASLMLTAPTQSKVIAGGDTESVSVKFDAEGKALLTVNY
FT                   PEAGEVTLKASHTHTVNTPNGSEELVLEHQDSFVAKPAGFHFFNESANNRCASSDPYDA
FT                   DCKVLAKAGESFDMRLKAAGWTSDEDSDFSDNPVLQNFKHSNIQIQAAVEAPSLADGGT
FT                   NGSFSTSAVDFNLSGSESSQLISQSWTEVGTLTAKLTQDISYLGVTISKDNASSELFGR
FT                   FTPAYLDISGNSPSLTHSCGSFTYIDQPFGFSGGGEPIIQVRGMASDDSEARNYQLGDW
FT                   WRYKHKEEASRNQWLGRGYEDKTGELQVQDSEYPGLSGSVSYANNANTATLTGAKVEYV
FT                   RLPTPMVPFDAKFDLKLAVTDLTDEDGICYQADSSGSCQPFSFEDIADGASFELRYGRL
FT                   QLDNGYSPQSESLRLPLRTEYVSAVDAANVPTWVTNGDDSCSVYNTVTSTDTTEAVTTG
FT                   MNMTLPAGFPAITAHSNDELTSQSGTALQGVNHIYFTAPNTPGEVRLKQHVEPWLKWYW
FT                   NYDGNKPNALYDPRASAFFGTYRGHDKVIYWHEVN"
FT   sig_peptide     675290..675346
FT                   /locus_tag="Ssed_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.593 at
FT                   residue 19"
FT   gene            678219..679268
FT                   /locus_tag="Ssed_0558"
FT   CDS_pept        678219..679268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0558"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: slo:Shew_0403 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35170"
FT                   /db_xref="GOA:A8FQP7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP7"
FT                   /protein_id="ABV35170.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVREEGIVLNEPSVVAIRGER
FT                   GSGGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSV
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALIRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSEES"
FT   gene            679407..680303
FT                   /locus_tag="Ssed_0559"
FT   CDS_pept        679407..680303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0559"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="KEGG: slo:Shew_0404 rod shape-determining protein
FT                   MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35171"
FT                   /db_xref="GOA:A8FQP8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP8"
FT                   /protein_id="ABV35171.1"
FT                   /translation="MKPIFARGISNQFRLTLAIILSVILIVANNRLDPVRKSVSSVLSP
FT                   LQYVANVPGALLDWSAESLATRNMLTKQNKELLRQQLLMSERLQRFEHLRQENDRLRAL
FT                   LGSPVHMDSKKVVAEVMEVASDPYHQYVVLNHGAMSGVFVGQPVVDAQGVVGQVVQVNE
FT                   LTSRVLLISDATHGIPVRVTRNDVRLVVKGTGVLDELELSYVSKSTDIRVGDLLVSSGL
FT                   GNRFPEGYPVARVMSVVKDDGQSYANVIAQPLAALDRIRYLLLIWPDEQDESLSKDELL
FT                   NIENTSESTKQTAEVSQ"
FT   gene            680300..680788
FT                   /locus_tag="Ssed_0560"
FT   CDS_pept        680300..680788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0560"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="KEGG: slo:Shew_0405 rod shape-determining protein
FT                   MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35172"
FT                   /db_xref="GOA:A8FQP9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQP9"
FT                   /protein_id="ABV35172.1"
FT                   /translation="MSMHIANGRWVVWLSFLVAMLFQIMPLPDLVEPWRPDWLLLVIIY
FT                   WAMALPHRYNILSAWVLGVLLDIMLGAHLGIRALSISLVVYVVVLHFQRLRNFPMWQQA
FT                   LMISSLICLYHLVIFWVQFVVDTATFDVRLFLPAISSLIIWPWVFWILRRVRRLYKVR"
FT   gene            680791..681387
FT                   /locus_tag="Ssed_0561"
FT   CDS_pept        680791..681387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0561"
FT                   /product="maf protein"
FT                   /note="KEGG: slo:Shew_0406 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35173"
FT                   /db_xref="GOA:A8FQQ0"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ0"
FT                   /protein_id="ABV35173.1"
FT                   /translation="MNGSARLVLASASPRRKELLTQLGFSKAGFSFDTLSADIDETHQT
FT                   GESPQVFVSRLAVEKAEAGLALCDNLTTPVVLGSDTIVVLGEQILGKPVDEADALKMLT
FT                   DLSGHIHSVMTAVALTDGKKTLTRLVETKVQFCDLNEQDILAYITTGEPMDKAGAYGIQ
FT                   ALGGSFVERIEGSYSAVVGLPLVETRELLKEMKII"
FT   gene            681497..682999
FT                   /locus_tag="Ssed_0562"
FT   CDS_pept        681497..682999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0562"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: slo:Shew_0407 ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35174"
FT                   /db_xref="GOA:A8FQQ1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ1"
FT                   /protein_id="ABV35174.1"
FT                   /translation="MSRIVRNRVQKKIGSELLINVTPTEARVALVEHGVLQEIHIERRM
FT                   KRGLVGNIYKGKVSRVLPGMQAAFVDIGLDKAAFLHASDIVPHTECVADVEKGNFIVRD
FT                   INELVRQGQDIMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGSSHVGVSQRIESEEVR
FT                   SRLKGLTEPFVDEDGGFIIRTAAESAGEQELVQDAAFLRRVWGRVSERRKLKGVSLLYQ
FT                   DLALPVRIVRDFVGTELDQIQVDSSQTFEELQAFSEEFMPEIAEKIEHYNGPVPIFDLY
FT                   DVENEVQRALGRKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNLEATQ
FT                   AIARQLRLRNLGGIIIIDFIDMLRSEHQKRVLASLELALSADRVKTNISGFSGLGLVEM
FT                   TRKRTRESIEHVLCGECPACYGTGSLKTVETVSYEIFREIIRLDRSYDADEFLVYCAPG
FT                   VFNSLTGEEGHLVAELGVYIGKRVRFQNEPMYAQNKFDVVIM"
FT   gene            682999..687258
FT                   /locus_tag="Ssed_0563"
FT   CDS_pept        682999..687258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35175"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ2"
FT                   /protein_id="ABV35175.1"
FT                   /translation="MPRQFCPFKFSRFCWQILAIILVLFALAVSLFRGLLPQLAEVRQE
FT                   LVKYVEEQYQVQVNVGELNAEWQAFGPALTVKNLVLPPQERLPFTLIIRDVHVKLDFWE
FT                   SLMTTSPQIENVIFEGVQVGLDLDKLNQAGPSTVSAETDTDWLYRLLLEQLEHFSITEA
FT                   SLQLLSKSHDFRPIYVKDLRWQNRNNKHQGQGKLYLDEKASEVEQLSLSLEIDGNGFRP
FT                   DTLKGQVYLAASSLDLGEWASRQANPYDEKSKLPLEGVVNLQAWLSLGNRSIESGLIQF
FT                   EPSWLEWQLNEEVQHFEIKGGQFEWLPIDKGWQLSSRSLEFETNDRPWSELNFVAQQRG
FT                   EQLSAYLNRLDTSTLLPLLPLAPKVDLLALKTWQSINPQGYLDNIKFSLNGDLGPQVSL
FT                   DINQLQWRNFESIPGSKALDLQVAWYDDSLYFNAPEQAYTLDFSTAFKAPIVLNGAAFD
FT                   ARFNTQYSELTLPRLQFSNKDIGIDASVKMGFAGDTHLALLADVKINDVVDVGNYFPLH
FT                   GMDAGLVDYLEAGLVAGNTQDARVVWHGPLNQYPYKDHSGIFQAAFTLSDAEFKFQPDW
FT                   PAVTSLELSALFENARMDLTIDSGDLLDVVVDGARISIPELGARSLLEIDAELATQGVA
FT                   ATEVIQASPLAESVGSTLAVVQVQGDVTATLDLSIPLYDGEEEQIRGLVNLDNTPIYIT
FT                   EPGVQLDGVTGQVSFVNEVVKGKDISALLYQQPVSLTFDTEQVRDNYGLNLDLKGVWQL
FT                   DELPAELDNPLMDFYSGEVNWNGAMTLIFDQTGYRIQAQVNSDLLGTELTLPPPFSKAT
FT                   DEKRRLSAELIGDNKQSSLGIKLGNQMEFWGGFDLESGDQLSHFDLLLGRLFKPGDQLK
FT                   RDQGHLQLDIAQTEFSPWLPIITSFTSAATSEINLAPIVPEPQSVPETEAVSAPELNPG
FT                   EKASVQQEQTRGFFPPLISIDADIGDLNLMGQTLSELTMTAAPFEELWRFEAQSKEFDG
FT                   RIDFYPDWSTQGLKMVAKKFHIAPAVKEEAKADFKSGTVLNNLPPLALDVDDFRLYGKP
FT                   LGHLVLQGTPKEGHYQIQTLSLTTPEVKLSGKGAWKNSEGENVTEFDVKLDATKFDALS
FT                   SILDMDPGLKDAPVEIDANISWQGAPYAFSLESLNGKINFELGKGHLSEVSDKGARIFS
FT                   LFSLDSLLRKLSLDFSDVFGKGLYFNSFTGTLEIDNGVIKTRDTEMDAVAGNMKVRGYT
FT                   DLVTESLNYDIRFVPQLASSVPTVVLLTTGGWTLGIGAFALTKVLEPVIEVITELRFRL
FT                   TGTMSEPKLEELERKSKEIEIPESALPRTKEGQPDNKQPAKKGAETQGVEKQEEKSQGA
FT                   DSRESSAPAKINESGVEILAPKVIEMPDFRETNSYPPASNEDKISPPKEAIDADQPVTV
FT                   PKQSRYSPKPAVYRVAA"
FT   sig_peptide     682999..683085
FT                   /locus_tag="Ssed_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.453 at
FT                   residue 29"
FT   gene            687182..688027
FT                   /locus_tag="Ssed_0564"
FT   CDS_pept        687182..688027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0564"
FT                   /product="nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="KEGG: sbl:Sbal_3816 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35176"
FT                   /db_xref="GOA:A8FQQ3"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ3"
FT                   /protein_id="ABV35176.1"
FT                   /translation="MQISLLQCQSSRDIAQNLQFIESQLSLLPRVSGEEQLVVLPECCL
FT                   LFGGHESQQGEYALNSCSEENPLKTAMSDLARKFDVYLVAGTIPVLADDKRVYSRTYLF
FT                   DCAGKVLGEYDKLHLFDVDVSDGTKEYRESDTFCPGEKISVIDTPFGKLGLAICYDLRF
FT                   PDLFRAMRLAGAEIIALPAAFTKVTGAAHWQPLIQARAIETQCFILAAAQWGQHNKGSR
FT                   ETWGQSMIVDPWGRIKAEKMTGCGWVQASLDKSELAQIRQQMPVEQHNRFSPPQLQQIK
FT                   "
FT   gene            688086..689558
FT                   /locus_tag="Ssed_0565"
FT   CDS_pept        688086..689558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0565"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="KEGG: slo:Shew_0410 peptidase U62, modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35177"
FT                   /db_xref="GOA:A8FQQ4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ4"
FT                   /protein_id="ABV35177.1"
FT                   /translation="MSKKRELLMPFLTQVEASLLQDGQSLNDLQGYLNSIHQHNVDFSD
FT                   LYFQGSRHESWVLEDGIVKEGSFHIERGVGVRAITGEKTGFAYADEITPAALKASAEAA
FT                   RSIAVAGKSETVQAWKQQEVKALYQSADPIAAMEEVKKIALLKEADAYIRSLDSRIIQV
FT                   VISLSGVHEEILIAASDGTLAADIRPLVRFNCSVILEENDKRERGASGGGGRHGYEVLM
FT                   DNDDTGLPACFSFAREAVRQASVNLHAIDAPAGQMPVVLGAGWPGVLLHEAVGHGLEAD
FT                   FNRKGSSAFSGLVGQQVASKLVTVVDDGSIPNRRGSLSIDDEGVATQKTVLIEDGILKG
FT                   YMQDKLNARLMGELPTGNGRRESYAHLPMPRMTNTYMEAGESDPQDIIKSVKKGVYAPN
FT                   FGGGQVDITSGKFVFSASEAYLIENGEVTQAIKGATLIGNGPEAMGQISMVGNDLALDQ
FT                   GVGVCGKDGQSVPVGVGQPSLKLDSLTVGGTA"
FT   gene            689688..691109
FT                   /locus_tag="Ssed_0566"
FT   CDS_pept        689688..691109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0566"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: slo:Shew_0411 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35178"
FT                   /db_xref="GOA:A8FQQ5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ5"
FT                   /protein_id="ABV35178.1"
FT                   /translation="MKFSHIALLSLAALGPFTAGAKEMGFSQAWQQLLTVSDKLQAGAQ
FT                   EVNRAEAEHEAGKDLYLPSISLNGSYTRLEKPIELDLNDLNPLASMDPSTLPPSIGGAL
FT                   AGIPSSMFVTQFTEQDIFRSSLQAMWPIYTGGKISAAQGIHAAHVIEKEQQLQLSTRDL
FT                   FIQLVDRYYGVAVTQSLAQTRGELVSSLEEHASHAQKLEEQGQIAKVERLNAQVALENA
FT                   KVNFASAVRQAEMAVIALSRMLHEHEVDTTSALFMLADAPSLPHLSQLTLVQHPALKLL
FT                   EAKEEQANGLIDLEKGKYHPTVFLYGNYTLYEDDSLFSKMEPDWMLGVGVKVPLLSRDG
FT                   RSGKVQAAKSALLQARYTKAQTRQDLSLLLDQSYRQLLQAQEEVLSLETSLSLAQENKR
FT                   LRDLAFRQGLSTSIEKVDAELKLTAVETQQLGAKYRYIQAYARLMAISGQLEEFLGRSV
FT                   SHHTNVAMQESNNAG"
FT   sig_peptide     689688..689753
FT                   /locus_tag="Ssed_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            691099..692070
FT                   /locus_tag="Ssed_0567"
FT   CDS_pept        691099..692070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0567"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="KEGG: slo:Shew_0412 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35179"
FT                   /db_xref="GOA:A8FQQ6"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ6"
FT                   /protein_id="ABV35179.1"
FT                   /translation="MQANRIIGVVAIIGLVGALGYGLKLAYTPQDERIQGQIEAREYNI
FT                   SSKVPGRVEQVLVRRGDKVEAGDLLFAIDSPELSAKLMQAEGGRDAAQAMQLEADTGAR
FT                   KQQVMASKEQWLKAKAAATLAKTTYDRVEVLFVEGVLARQKRDEAFTQWQAAKYTEQAA
FT                   LAMYEMANEGAREETKAAAAGNARMAEGAVNEVSAILADSQMRAPKSGEISEVLLQPGE
FT                   LAPSGFPVVSIIDMDDAWAVFQVREDQLKEFKMGQKHLIFIPALGGEYEFSVTHISVMG
FT                   EFATWRATESGHDFDMRTFEMELRPVKTIPDLRVGMTTLMAQ"
FT   gene            692089..693252
FT                   /locus_tag="Ssed_0568"
FT   CDS_pept        692089..693252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0568"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: slo:Shew_0413 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35180"
FT                   /db_xref="GOA:A8FQQ7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ7"
FT                   /protein_id="ABV35180.1"
FT                   /translation="MTSLIRRELKALWNDPWQFALVTYIPILGIISLWWLFSAGMPRQL
FT                   PVAIVDHDQSQLSRMLARRIQANPAAEPIGYQDIASAKRAMTQGEVYALVVLPYRLKRD
FT                   LLTGHSPTIEIRYNSQFLLVGKLLSSQIQLSLADGLLHVASKKQLALGVPKAQAEINLR
FT                   PVTSQTTALYNSNSNYIGFLVPPVLLALGQLLAMLVFANSLNRELRLNTMSEWFSLGTR
FT                   RVLFAKMLVYTPLILLQGRFILAILYQFLNLPLAGDFGLLLVAQVAMLLAVWLLVLVIF
FT                   FLLQDCARVISFCTALFAPAFPFMGITFPTLDMPVLAQLWRKLMPSSHYIDTHVGVVSY
FT                   GQGWDTLADQLINYWGFLFLIPVIIFLATRVKRAHLADQSLSPEGAK"
FT   gene            693249..694397
FT                   /locus_tag="Ssed_0569"
FT   CDS_pept        693249..694397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0569"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: she:Shewmr4_3461 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35181"
FT                   /db_xref="GOA:A8FQQ8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ8"
FT                   /protein_id="ABV35181.1"
FT                   /translation="MTFWQFLLADLRAIVMDKAIAITLFGGVLFYSVLYPLPYLNQVPT
FT                   EQMLVVIDHDGSSLSRRLIRHADASPKITVTGQVSTIETAQSWIESGRANGLLVIPHGF
FT                   RKDLMLGRGSTLSYGGDANYFLIYSAVVEGLVSVGLDASKYVQLVGLLAHGENAKAAER
FT                   SLNAVKLNSVPAFNPSLGYTPYVVPGVLLLVLHQTLLIGTGILGAGQWRNQGYWRRVSP
FT                   LMLISGRICVFFLIYTLFTSLYVGHCYYWYGVSVQATLGQVALFLLPFLLSTAVTGIAF
FT                   SCLFTRRDLPTQVLLLISMPILFVSGFVWPLELIPEPLIWISTIIPAVPAIIGMLQLNQ
FT                   MGASWVSIMPLWLHLWGLFALFFMLALYGVNWRLKREPNCES"
FT   gene            complement(694715..697270)
FT                   /locus_tag="Ssed_0570"
FT   CDS_pept        complement(694715..697270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0570"
FT                   /product="Ig domain protein, group 1 domain protein"
FT                   /note="KEGG: sbl:Sbal_3807 Ig domain protein, group 1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35182"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQQ9"
FT                   /protein_id="ABV35182.1"
FT                   /translation="MRLIKTAFALPLSFLLLSSLGGCNGASDDSGGENTGEYALSLSYK
FT                   TVVDGKCADATNDLSFANNASICAVAKLTQGGSNSNGGLISFSATLGELSPATKLTDTQ
FT                   GIAEVILGNAQASLGAGTLTAQFDTKAAENNILAVNRNYEFVDDGIPDEDTPKISASII
FT                   NGAATVTQFKVDETVQLQAQFLDSSSQGIAQQIVTFSAGSTTLNPNTALTNEQGIAQVS
FT                   YTPSENELGAASLNVSLSYKDQGYQENSLYEVLPANAIGDDGVLKLGHFDDNNNFIEDE
FT                   LATTLTPVDGKYRISAGGSFGITATLVSVADDGTITRVQTPSSISFGSDCVTSNNASLD
FT                   TPVTTLSGSAGSTFQDTSCSGNSERDDQIVATTQAGNQTLTANLPFTLERQTLASLSFL
FT                   SAEPKNIRIKGAGGTGSTESSLVTFKVTSSNGQPAAQQAVKFTLDTVVGGLSFSNGAAT
FT                   DESLTNSQGIASIRVLAGTMPTPVRVLASATDTDTNETITSQSEQLTVNTGLPQQLGFS
FT                   ISTSMFNPEAGDFNGEKVTLTAYASDTFGNPAPDDTTINFTSEGGQIVPSCLTVNGSCS
FT                   VEWTSANPRVPDHRITVLAYALGHETFFDTNGNNVFDDKDVTVDAEGKPVVDKACLNSD
FT                   GQAIHCSGNGMDIEAYLPSGFSDLGDAFRDDDESFSYTPGEKYFNTTSSGEYQIPDGKF
FT                   NGPQCQSTIVGCEPNTYIRKALVMTMSGSSAGFTIWQGNNLIRDDFGLATGSIVPLTAI
FT                   AAGESSSFTVQFYDSAYQIMPASTQVAVEASAGELIFDAFEVANTTRRGGTTTGFIITN
FT                   DIDPGSTGEPAKLSSVSINLTTPKNFKSGAGLSITLSGT"
FT   sig_peptide     complement(697193..697270)
FT                   /locus_tag="Ssed_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.892 at
FT                   residue 26"
FT   gene            complement(697353..697892)
FT                   /locus_tag="Ssed_0571"
FT   CDS_pept        complement(697353..697892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0571"
FT                   /product="protein of unknown function DUF615"
FT                   /note="KEGG: slo:Shew_0415 protein of unknown function
FT                   DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35183"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR0"
FT                   /protein_id="ABV35183.1"
FT                   /translation="MKIVGDSEHFKQPFDHDEEYVSRAEAKREIAVYQELGIKLVALSK
FT                   SQIKKLNLDELLFDNVMKTKTIKINTEAYRRQLQFIGKIMRNVDIEALQLDIKNVLNQN
FT                   SNESAKQNVAEKLKEQLLSEGDAAVQDLLEKHPQLERQKLRQLIRQSIKELAKKPDEAS
FT                   KSSIELVKYLRNEISE"
FT   gene            698124..699464
FT                   /locus_tag="Ssed_0572"
FT   CDS_pept        698124..699464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0572"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="KEGG: slo:Shew_0416 peptidase U62, modulator of DNA
FT                   gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35184"
FT                   /db_xref="GOA:A8FQR1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR1"
FT                   /protein_id="ABV35184.1"
FT                   /translation="MTTPSTDIELNSLKDAVSMALEYAKELGTTAAEVAISKQQGLSVS
FT                   TRLKEVETVEFNKDGALGITLFRDGCKGSSSTSDLSPDAIRQAVKAADDIAKFTSSDPY
FT                   NGLADADLMATEFPDLDLFHPQEISADELTDLAARSEEAALSVDSRITNSDGASANAHT
FT                   GLKVYGNSHGFLHGYSSSRYSLSCVVIGETDGNMQRDYDYTISRKFGDLLSPEEVGRKA
FT                   SEKTLSRLGSRKIATTELPVLLSPEIATGLISHLVGAISGSSLYRKSSFLLDSIDTQLF
FT                   PDWFSIEEQPHLKGALASANYDSEGVATQERHIIESGILSTYLLTSYSARKLGLKNTGH
FT                   AGGIYNWTLSHTGQTFDELVKEMGTGLIVTEVMGQGVNAVTGDYSRGAAGFYVENGVIL
FT                   YPVEEITIAGNLKDMYQNIVAVSKDRDLRSSIRTGGILLSDMKIAGN"
FT   gene            699606..700106
FT                   /locus_tag="Ssed_0573"
FT   CDS_pept        699606..700106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0573"
FT                   /product="MshA, mannose-sensitive haemaglutinin"
FT                   /note="KEGG: slo:Shew_0364 MshA, mannose-sensitive
FT                   haemaglutinin"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35185"
FT                   /db_xref="GOA:A8FQR2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR2"
FT                   /protein_id="ABV35185.1"
FT                   /translation="MNRHSGFTLIELVVVIIILGILAVTAAPKFINLQNDARISTVQGM
FT                   KAAVASEVLLVHSKALIQGLEKDSEVDVDLGSVTVKSVYGYPKAEFSSTWSKLLGGEFG
FT                   EAGYVDPAEYDWIWRNRTGGSNIGLYFMPRGYSDDNQNCWVRYQQPTEAGGEYQLTIET
FT                   SGC"
FT   sig_peptide     699606..699686
FT                   /locus_tag="Ssed_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.684 at
FT                   residue 27"
FT   gene            700340..700684
FT                   /locus_tag="Ssed_0574"
FT   CDS_pept        700340..700684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0574"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: slo:Shew_0417 transcriptional regulator, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35186"
FT                   /db_xref="GOA:A8FQR3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR3"
FT                   /protein_id="ABV35186.1"
FT                   /translation="MTALDLFKALSDETRLRSLLLIQAEQELCVCELMQALEESQPKVS
FT                   RHLAQLRKFGLLTDRRQGQWVFYRLNPSLPKWANAVIDETCSANRALIQDELTRLNKMG
FT                   DRPDRVKSCC"
FT   gene            700791..701840
FT                   /locus_tag="Ssed_0575"
FT   CDS_pept        700791..701840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0575"
FT                   /product="arsenical-resistance protein"
FT                   /note="KEGG: slo:Shew_0418 arsenical-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35187"
FT                   /db_xref="GOA:A8FQR4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR4"
FT                   /protein_id="ABV35187.1"
FT                   /translation="MGLFERYLSVWVGLAIVLGVILGNLMPDVFALVAAVEYAHVNLVI
FT                   AVLIWVMIYPMMVQIDFAAVKDVRKSPKGLVLTLVVNWLIKPFTMALLGWLFFKVLFVE
FT                   WVDPQTATEYIAGMILLGVAPCTAMVFVWSQLTKGDPNYTLVQVSVNDLIMVVAFAPIC
FT                   AFLLGVSDIQVPWETLLSSVFLYVVLPLVAGVLTRKKLESDGDPASLARFVSNLKPWSI
FT                   VGLLATVVLLFGFQAETILNEPQNILLIAIPLLIQTYGIFFIAYYAAKKLKLSHKVAAP
FT                   ACMIATSNFFELAVAVAISLFGLHSGAALATVVGVLVEVPVMLSLVAFVNRNRKQFEDD
FT                   RDEHQAASE"
FT   gene            701844..702905
FT                   /locus_tag="Ssed_0576"
FT   CDS_pept        701844..702905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0576"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: slo:Shew_0419 glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35188"
FT                   /db_xref="GOA:A8FQR5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR5"
FT                   /protein_id="ABV35188.1"
FT                   /translation="MGLEDHITREDRIKGFNMSIKIGINGFGRMGRLALRAAWDWDDVE
FT                   FVQINDPAGDAATLAHLLTFDSIHGRWHHEATGEGSEIRIGDTRIATTQDSNIGDTDWS
FT                   GCDLVIEASGVMKTKALLQAYIDQGVKRVVVTAPVKEEGVLNVVMGVNHHLYDKSLHPI
FT                   VTAASCTTNCLAPVVKVIHETIGIKHGSMTTIHDITNTQTILDAPHKDLRRARACGLSL
FT                   IPTTTGSATAITHIFPELKGKLNGHAVRVPLANASITDCVFELEHATTEDEINALLKKA
FT                   AEGELKDIMGYEERPLVSVDYKTDPRSCIIDAPSTMVVNGTQVKLYVWYDNEWGYANRT
FT                   AELARMVGLSDKG"
FT   gene            703016..704257
FT                   /locus_tag="Ssed_0577"
FT   CDS_pept        703016..704257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0577"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="KEGG: slo:Shew_0420 major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35189"
FT                   /db_xref="GOA:A8FQR6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR6"
FT                   /protein_id="ABV35189.1"
FT                   /translation="MLASIKALPEQVRQYLIVTGNYWVFTLTDGALRMLVVLHFHQLGY
FT                   TPLAIAMLFIFYEIFGVVTNLVGGYLGARLGLNRTMNLGLGLQVLALGMLLLPTSMLTI
FT                   AWVMAAQGLSGIAKDLNKMSAKSSIKLLVTSEQYGKGEQEKLYKWVALLTGSKNALKGA
FT                   GFFLGGALLSLFGFTAAIGVLAGMLVMVWLFSMVKLKKDLGKAKRKPKFSEIFSKSRSI
FT                   NILSAARLFLFAARDVWFVVALPVYLASQFGWDHYYVGGFLALWVIGYGCVQSIAPSLT
FT                   GKRRGKIPDGCSALVWVMLLTFIPGLIALALSHDIAPQISLLLGLILFGGVFAINSSLH
FT                   SYLIVSYASDDGVSLDVGFYYMANAMGRLIGTILSGWVYQVAGLEACLWISSAFLVMTV
FT                   VISVYLPQRVAALE"
FT   gene            705085..705303
FT                   /locus_tag="Ssed_0578"
FT   CDS_pept        705085..705303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0578"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: sdn:Sden_1874 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35190"
FT                   /db_xref="GOA:A8FQR7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR7"
FT                   /protein_id="ABV35190.1"
FT                   /translation="MMILIRKAIEGDAQAVYDLRSRAILEECSGFYSAEPLSLWTKGGV
FT                   SESLISDIVNSFYVSESDAQVTGNSSR"
FT   gene            complement(705321..706250)
FT                   /locus_tag="Ssed_0579"
FT   CDS_pept        complement(705321..706250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0579"
FT                   /product="putative LysR-like regular protein"
FT                   /note="KEGG: vpa:VP2406 putative LysR-like regular protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35191"
FT                   /db_xref="GOA:A8FQR8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR8"
FT                   /protein_id="ABV35191.1"
FT                   /translation="MTNEINWKSTDLNLLVTFSYLYRYRSVSIAADKSHVSQSAMSHSL
FT                   ARLRILFDDQLFERKGHHMEPSEYAHHIAPIVGQLLDDISHRLLAKEQFTPLSYSGECR
FT                   IGLTDYAEFIFAPSLYDAIQASAPKSQVSFINVNRHNYVNIADQDKLDVVIGSMPQPHS
FT                   DFDSKFLYTEKHVCLCDSQLFSNNQTLTVAEFAAVEQALVSPDGTLVTQVDKRLADLGL
FT                   TRKVSVASRNFLTIRSLLKKRKLIAIVPELMAKAQGFDDQLTALTPPVDIADFEISLLW
FT                   KSKLTNNDKNSWLRSVVQNVLSNAKSQS"
FT   gene            706356..707492
FT                   /locus_tag="Ssed_0580"
FT   CDS_pept        706356..707492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0580"
FT                   /product="chromate resistance protein-related protein"
FT                   /note="KEGG: vpa:VP2407 chromate resistance protein-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35192"
FT                   /db_xref="GOA:A8FQR9"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQR9"
FT                   /protein_id="ABV35192.1"
FT                   /translation="MLSIFKAFFALGWISFGGPAAHIGYFRITFVEKLKWLDDKEYGQI
FT                   VALSQFLPGPGSSQVGFALGYKRGGLGGACLAFIGFTLPSVLIMLVLAVLSSQLTTTPM
FT                   FQSIVHGLKLLAVIVVADATIGMYKNFCRQKLTIGLCIATAVSLLVFPGIATQMLVLAI
FT                   AAIIGAKMLANQQANIDQSFRPSVAPLVLFVLLLIGLPFVAQQLPMLALFSDFYQAGSL
FT                   VFGGGHVVLPLLQNIVGDQISQDTFLTGYAVAQAVPGPMFTFATFIGYELLPDAPLFGS
FT                   LIATLGVFLPGFLLLLGVLRNWQQLASNKLVSGAINGVNAAVVGLLVAALYQPVFSSAV
FT                   VDGLDFALILVGFFLLKQLKLPIVAMVVFYIITGVILL"
FT   sig_peptide     706356..706421
FT                   /locus_tag="Ssed_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.650 at
FT                   residue 22"
FT   gene            complement(707643..709520)
FT                   /locus_tag="Ssed_0581"
FT   CDS_pept        complement(707643..709520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0581"
FT                   /product="GGDEF domain"
FT                   /note="KEGG: sdn:Sden_2587 GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35193"
FT                   /db_xref="GOA:A8FQS0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS0"
FT                   /protein_id="ABV35193.1"
FT                   /translation="MFFLLMKKWLTWLGCVLFVFSTNGFASDALTELERAAKAVSPADG
FT                   IELLNKFDLKNSKLEAEQQAKVYYLYGQLYEKTRQLDQSIASYDKGIELVKYLPITDVL
FT                   IDSHLERSFALYLQSNDPAAYCVDRKQALVYARLHHNSELLAKTLTQNAFCFNEPKSIH
FT                   KGIALLDEAMAIVDKNNLNVNRKALIYNATGSLYRQVGLHRRGYDSFEKAYQTWQSIND
FT                   IEDMFNMQYNMLSEAISLGHWDKASQSVEAQFSLAAMSTGDNDMLFFSHLNAGRVALRT
FT                   YDYDKAVLHLEKAVSLNHTTQEKYFISSNYLYLGLAYMRSGEAEKAADMARTFKQDDSF
FT                   AANQKAMLLQADAIIALDEHDPVNALNKLFQVIDIEREINQSVIDNEVISLSLDHNSAL
FT                   AEFENELLGNRLAINELSLASVKDKERINELKLSLFFIIVTVLFCIVLFLLISRRTLKV
FT                   RAQTDFLTGLANRGHTFKKGQKIIEKTIKKQQPASVIMFDIDDFKSINDRYGHHIGDLA
FT                   IKSVSKRTRRWLKKHDLVGRIGGEEFLIVLENTSQTEAYDIADRLRHNIEEQFFQFDDV
FT                   TVELTISLGVAALNEHTTTLIGLMKQADDALYRAKFSGKNKVYLAAECA"
FT   sig_peptide     complement(709440..709520)
FT                   /locus_tag="Ssed_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            709771..710268
FT                   /locus_tag="Ssed_0582"
FT   CDS_pept        709771..710268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0582"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="KEGG: sdn:Sden_1874 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35194"
FT                   /db_xref="GOA:A8FQS1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS1"
FT                   /protein_id="ABV35194.1"
FT                   /translation="MILIRKAVEGDAQAIYDLRSRAILEECAGFYSAEQLSLWTKGGVS
FT                   ESLMTDIVNSFYVSEIDGQVIGSGKLTIETGMLDAIFVEPEFFGRGAARLMVSFLENLA
FT                   LESGLSSIKLESTLNAAPFYRRCGFVGDEISTYHSPRGISLDCVPMLKSLEKREQGDAS
FT                   QQ"
FT   gene            711267..711389
FT                   /locus_tag="Ssed_0583"
FT   CDS_pept        711267..711389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35195"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS2"
FT                   /protein_id="ABV35195.1"
FT                   /translation="MSKGKSIRKEGKKQPQKTAKEKRMAKHAKKESRGLLDNVK"
FT   gene            712221..713600
FT                   /locus_tag="Ssed_0584"
FT   CDS_pept        712221..713600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0584"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: slo:Shew_0424 amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35196"
FT                   /db_xref="GOA:A8FQS3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS3"
FT                   /protein_id="ABV35196.1"
FT                   /translation="MEGITEFVSMINGFVWGTPMLVMILGVGLFLSVGLKLMPILKLGT
FT                   GFKLLWSGRIPDKDKTMEGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMW
FT                   CTALVGMATKFAEAVLAVKYREVDDNGDHIGGPMYYIKNGLGSKWAWLGTAFALFGSFA
FT                   GFGIGNTVQSNSVADALSSNFGVPTWATGVVLMMLVGAVLMGGIKRIADVAGKLVPLMT
FT                   LFYIAAGLAVLAVNAAAIPDAIVMIVHSAFNPVAAQGGFAGAAVWAAIRFGVARGVFSN
FT                   EAGLGSAPIAHASAQTNNPVAQGLVAMLGTFIDTLIVCSITGLAIIVSGAWTSGENGAA
FT                   LTSLAFSTAIPMGNYIVAVALSVFAFTTILGWSVYSEKCVQYLFGVKAVKPFRVLWILV
FT                   VPLGAVSSLDFIWLLADTLNAMMAIPNLIALALLSPVVFSLTREYFIKKREDEAQAKIA
FT                   S"
FT   gene            complement(713851..714966)
FT                   /locus_tag="Ssed_0585"
FT   CDS_pept        complement(713851..714966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0585"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: slo:Shew_0425 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35197"
FT                   /db_xref="GOA:A8FQS4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS4"
FT                   /protein_id="ABV35197.1"
FT                   /translation="MFLANSLLNSLRRIKAITTKEIRQLMRDRITFGMVVMIPLIQLLL
FT                   FGYAINTDVRNVPVAIVDQSNSALGRWIVEAIKVTQVVSIESHYTTAREAEDAITRGEI
FT                   RAALILPPNLTEKLANKETLGQWLVDGSDTMIAGAIKQLRHMPLDQITGIKTEVPPTFE
FT                   VALFYNPEQRSAVNIVPGLIAVILTMTMILFTSAAIVRERERGNLELLITTPIKPLELM
FT                   LGKIFPYIIVGLIQMTIILGLGNIIFDVPLNGDIAQLLMGTLLFIAASLTLGLIISTIA
FT                   KSQLQAMQMTIFIILPTILLSGFMFPFEAMPKPAQWIAEILPATHFMRIIRAVVLRGGE
FT                   ISDMRFDALWLVGFTVIGIIIASMRFNKRLD"
FT   gene            complement(714968..715951)
FT                   /locus_tag="Ssed_0586"
FT   CDS_pept        complement(714968..715951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0586"
FT                   /product="ABC transporter-related protein"
FT                   /note="KEGG: slo:Shew_0426 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35198"
FT                   /db_xref="GOA:A8FQS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS5"
FT                   /protein_id="ABV35198.1"
FT                   /translation="MNNKGSSNELAIDARGLTKHFGSLAAVSDMNLSVEKGHIYGFLGP
FT                   NGCGKSTSIRMLTGLLTPTAGSIEVLGMSIPKQAEALRLRIGYMTQKFSLYDDLTVKEN
FT                   LEFIAQIYCLTPNESKRKIGELLSTYKLIKQAKQYAGTLSGGQKQRLSLACSCLNDPEL
FT                   LFLDEPTSAVDPQNRRDFWEQLFDLSESGTSILVTTHYMDEAERCHGLAIMEQGYIRAD
FT                   GSPNELMRQMGAHVIEVSHPNLRQLKSELMLNREIKSAAQLGARLRVLVDNKISDPLGW
FT                   LRQIRPELALNEIREVPPNLEDVFVTVTGQDRDRDSTREPQTSEAN"
FT   gene            complement(715948..716892)
FT                   /locus_tag="Ssed_0587"
FT   CDS_pept        complement(715948..716892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_0427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35199"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS6"
FT                   /protein_id="ABV35199.1"
FT                   /translation="MRPFLSIIFILSLAACQGDVTNQALGTLERDRVLLRATASEIITD
FT                   LPIAEGSMVKKGELLLQFDNNKQLATVAMANAEVQKSQAYLLRLTNGERPEDIASAQAN
FT                   VARTQAALIEAKQSYKRTSSLLKQNLASQAAQDRARANRDQSQAEFNAANENLSKLIAG
FT                   VREEDINQAKAALDAAKAYLSLEKKTLDDLSVIATRDGNLDSLPFNLGERVPPNAVIVA
FT                   IQADNAPYARVYIPETHVAKLTIGQTLTVHVDGVEQVFQGKLRWLSTQPAFTPYYALNQ
FT                   EDRARLVFLAEIDLGSDADRLPTGIPSQVDLPL"
FT   sig_peptide     complement(716836..716892)
FT                   /locus_tag="Ssed_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.454 at
FT                   residue 19"
FT   gene            717378..718286
FT                   /locus_tag="Ssed_0588"
FT   CDS_pept        717378..718286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35200"
FT                   /db_xref="GOA:A8FQS7"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS7"
FT                   /protein_id="ABV35200.1"
FT                   /translation="MDIPVWQYVVSMTGYIVFLLVLVEGMRRAPRMTAAFWLLSLLTAP
FT                   LWADNLDGWFRWVKTVSVLIPTAIVVGGARIAWLYHDNPNKFLAFFRGDWVLKVLYMVL
FT                   FLNIAEATAKDFATANYFNAICGVILCITIPFPRYKNGKRLYWVIGRDKPNDLLFYSTA
FT                   AWNFLYTTWNLAFVFGENPGFFASSFCILMAAELYPIIKGRPELYIIARVYTLAFHILV
FT                   RANGDIFTPVMDSSSWASDSVVYYWGAINLAMHIPFVIWYFKTKNKSETNEPPFGEKSP
FT                   PPLISDYSDTKVNDESKLTTA"
FT   gene            718427..719533
FT                   /locus_tag="Ssed_0589"
FT   CDS_pept        718427..719533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbo:CBO0434 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35201"
FT                   /db_xref="GOA:A8FQS8"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS8"
FT                   /protein_id="ABV35201.1"
FT                   /translation="MAEPAQSQDGGVEKLQGEVWQGTRDGKPGEGSLFYRLEFNADNNV
FT                   EVTKQSGGFNKTETQKWSLNGDSVLIESLNGDEITDFDGASLAFVDSEEIRFSLDGDGF
FT                   NIHKWYKYRAFAHVLFVLIGLMALNELCRRLKWSNYVLWFALPIVLIPLWSSYEITYWF
FT                   KWVKLYSVVGAAALFTLIRFTKVGDMKWAKFGAGAFLAINISEAVMQDFSMGNLANVLN
FT                   AIGGVLSIITLAGWAMIHADKSKQQDMIWPAMTTFWIIAYDVWNIVFVYLNFPGSATAQ
FT                   MMVLIAATLPSLFIKKGTWLQARAFTLAGSFMYYFSCPFMYESNVVPMPRNDELMLAAG
FT                   AASFIINGIYAYVFFSKKFRQRQAVASA"
FT   gene            719671..720528
FT                   /locus_tag="Ssed_0590"
FT   CDS_pept        719671..720528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VFA0898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35202"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQS9"
FT                   /protein_id="ABV35202.1"
FT                   /translation="MKKRILSIAILASMTSGLTYAADDADIDMSNPTDVYTSIGASYGS
FT                   EGANLKGQLMLSEKTGDTGQKTGIIFEAKNILNEGDKSPQFTGMVQHPDYGMVPTFNDE
FT                   TSKRSYRLRYGTINTTNGTGWSIDAILADHPFYGSMAVVQAGPVMTIPVTDNFYIWPIL
FT                   YAGGVVIEDNMSQILPPDMAGSTVVSSSGIDVPSLILTGMVYARYAFNDNFWALLSTSY
FT                   TEEIQGKSWSDDIMDGGLQMASFSAEISVAYQMNKRQNVRVNYKTDNSDSTDDSYWIEY
FT                   NHAF"
FT   sig_peptide     719671..719736
FT                   /locus_tag="Ssed_0590"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            720630..721193
FT                   /locus_tag="Ssed_0591"
FT   CDS_pept        720630..721193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35203"
FT                   /db_xref="GOA:A8FQT0"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT0"
FT                   /protein_id="ABV35203.1"
FT                   /translation="MIKRALVLGTMLFACGNAVAGSEISGVNLPDSITLQDKVLSFNGA
FT                   GVRSKFFIDLYVGSLFTVGQVDQASKVIDSDQPAAIRLNITSGMITSEKMTDAMNEGFD
FT                   RATDGDSASIADSIKEFIATFEEPIQEGDQFTLLSVPGEGVISYKNGKQLSVTRGETFR
FT                   KAVMAIWLGKNPTDKGLKEDMLEG"
FT   sig_peptide     720630..720692
FT                   /locus_tag="Ssed_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            721346..722806
FT                   /locus_tag="Ssed_0592"
FT   CDS_pept        721346..722806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0592"
FT                   /product="conserved hypothetical methyl-accepting
FT                   chemotaxis protein"
FT                   /note="KEGG: ppr:PBPRA1115 hypothetical methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35204"
FT                   /db_xref="GOA:A8FQT1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT1"
FT                   /protein_id="ABV35204.1"
FT                   /translation="MTPLAIWRAMFMPESHQWRPEQLRFVDTLMFFTLLSLFTGLYSLF
FT                   KWLQHDHTLLIYTSFLLIGAELLAGAIVRFGRMPVLALNVGFFGMVVHALNMIYQGGGV
FT                   LSSTQTLWIPVLIISFFLTANLLMATLWSLGVILFSSRMVANALNGVAMPQMELSPSAL
FT                   ATETWSGLIMPLLVIVVAQGFTAKQRNKAMNAAERAQFDTLATAEKAQQGELQLSEVLD
FT                   KAGDNAGQLSLVANELESQSLDLHQQVNNLNQNCESQASAAEQMSQQLLRMTSDMEQSE
FT                   RFVTEMRERSEVINRQAQSSAESLAASTDAIDKILISNEKIMSVAGLITSVADQTNLLA
FT                   LNAAIEAARAGEHGRGFAVVAEQVRELSAKSNASAVEIRALLDLSKQEVNHGQVVIQAT
FT                   ANELSGIIEQVSETVTDVNQLADTMVHQVQAVQELNSASAEVANSVVQTNQVSESVATQ
FT                   GKQLTQQVDTLKALAEDLRLAMLSKSAA"
FT   gene            complement(723065..724111)
FT                   /locus_tag="Ssed_0593"
FT   CDS_pept        complement(723065..724111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0593"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: pau:PA14_24920 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35205"
FT                   /db_xref="GOA:A8FQT2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT2"
FT                   /protein_id="ABV35205.1"
FT                   /translation="MKRQANRSLGTTSIPPVQQFLQAGRHCKIDVSSALEHADIALSEL
FT                   YKIDGRLSGEQFQRLLHYLIDQSKHPLFGLYSARFIQPDRFYILGQIGLNSTDLSQALK
FT                   EAMPLEKLVGDMGVTEIREHSEGIRMIWHCQYSHPLVISHLIDNVLASWVNFARFLLED
FT                   NQATPRAIQLQRDKPSQAEVKQYEQLFGCPVHFAQSDNAIVIDKTLLGRRLPGGNLKRL
FT                   SQLTISANLRLNNIGDADDLELKTARVIRQLLPQGKIQREQVSGHLHMAGRSLQRHLIK
FT                   QGSSYQALLDQIRHEMADYWLTCSELSMDEIALQLGFSDARVFFRAYKTWTGHTPGVTR
FT                   TNASDAAS"
FT   gene            724186..725883
FT                   /locus_tag="Ssed_0594"
FT   CDS_pept        724186..725883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0594"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="KEGG: maq:Maqu_1346 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35206"
FT                   /db_xref="GOA:A8FQT3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT3"
FT                   /protein_id="ABV35206.1"
FT                   /translation="MQPERRNMNRSQQDNRNWNGWGAREKRMELSQDGAAFICEKLGQA
FT                   KPLGVSTLARVIAKVPDSRLADSELYSTDAEIRLRHARGQSLPDWLAMKSGEFGVFPDA
FT                   VAFPVSGEDIRILMAEAKANGWQLIPYGGGTSVVGHITPCPSDKPVITVSLTKMNRLLE
FT                   LDRVDQIATFGAGVKGPFLEAQLQAHGYTLGHFPQSFELSTLGGWVVTRSSGQQSLGYG
FT                   RIENLFAGGEIETFNGTVDIPTLPASSAGPDWRQLVLGSEGHLGILTQAKVRVTRVAEE
FT                   EFFGVAFMPDWQSGIDCAREIIQQKLPLSMLRVSNSEETHTQLFLSATETQRSWLNRLL
FT                   SLKGVGEGKCMLVYGVTGDLDANRQSYKRLKQVLRRFKGVNTGQRLGKKWAHKRFTFPY
FT                   LRETLWQMGYAIDTLETATNWSNIESMTQKIEHSLRDGLTEFDSKVHVFSHLSHLYGDG
FT                   ASIYTTYLFPVADSYDETYRRWQKLKSTTSTLIVENNGTISHQHGVGSDHAPYLAREKG
FT                   EHVMASLQTCFDYFDPDKQLNPGKLFKAGQTEPVETVHTEKSHTEKEQ"
FT   gene            725880..727535
FT                   /locus_tag="Ssed_0595"
FT   CDS_pept        725880..727535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0595"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="KEGG: maq:Maqu_1345 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35207"
FT                   /db_xref="GOA:A8FQT4"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT4"
FT                   /protein_id="ABV35207.1"
FT                   /translation="MKTLTQASIQAREAIVVVKAGELASEYDLVVIGGGITGAGIFHLA
FT                   ASQGLKVLLVEQQDFAWGTSSRSSKMVHGGLRYLAAGQWRMTRDTARQREALLAELPGL
FT                   VELMPYMMLHRQGDFPSAALFKRVLSIYDKLAGCDYHKPLTLEKAQTWLTELSFDGVTG
FT                   VSLFADGVTDDARLVLRLLQDGVLAGGQALNYAKVTGLIESENGISGIELELDEGKHKI
FT                   GAKCVINATGSWASQLHPLEKGLLRPLRGSHLVLPFERLPVSACITFFHPIDKRPVYIY
FT                   PWQGCTVIGTTDLDHDQGIESEPGITRTEVDYLLQLTRNYFPDKEIGEEDVISCWSGIR
FT                   PILSSSTDTAPSKESREHVIWSKPGLISVTGGKLTGFHLMAEEVLESIKTQFPAMMKDI
FT                   KQAKFSQPVMGYADKRLIGYFGHFATSISEMKNNQQIGISRCQWRELEWSLLNESVVHL
FT                   DDLLLRRTRLGLLLGGGIIKYREQILALCCQSLNWSESMAEQEWQRFELIFSTYYSLPN
FT                   KDKPASAYSQLSAGSQSSTANSPDTDNLLSTETL"
FT   gene            727532..729097
FT                   /locus_tag="Ssed_0596"
FT   CDS_pept        727532..729097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ssed_0596"
FT                   /product="sugar (pentulose and hexulose) kinase"
FT                   /note="KEGG: hch:HCH_04623 sugar (pentulose and hexulose)
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ssed_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABV35208"
FT                   /db_xref="GOA:A8FQT5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8FQT5"
FT                   /protein_id="ABV35208.1"
FT                   /translation="MMNEKDNGYLLAIDNGTQSVRALIFDLQGQLVAKSQVKLIPYVSP
FT                   QSGWCEQSGEYYWDKLCQACQSLWAQGIDKTRIKGMSVTTQRGTMLPLDCEGNPLHDAI
FT                   LWLDQRKAEPEKNLGGIWDPLFKVMGLSETINTFRSRAQPNWLYQARRDLWDKTYKFTF
FT                   LSGFFHHRLTGEWVDSSGSQVGYLPFDYRKHRWAKKWDWKWRALNVREDQLLPLVDPGD
FT                   RIGEITAQASALTGIPEGLPVIAAAADKACEVLGSGGQHSDVGCLSFGTTATINVTMKR
FT                   YVEAVRFLPPYPSAIAGSYCSEVMLYRGFWMVSWFKEQFAHIEKAKADEAGIEAEALFD
FT                   ELVNTVPPGSMGLMLQPYWGPGVKQPGPEAKGAVIGFGDIHTRAHLYRAILEGLAFGLK
FT                   EGLEAIEKRSGCKIKELRVSGGGAQSDAAMQIAADVFGLTTVRAHTVETSGLGAAIDAA
FT                   VGLGLHPDFDSAIKAMVHQGKRFEPDAEHYKMYQRLYGEVYLNIYKKLQPLYSKIRDIT
FT                   GYPE"
FT   gene            729208..729483
FT                   /locus_tag="Ssed_0597"
FT   CDS_pept        729208..729483
FT