(data stored in ACNUC7421 zone)

EMBL: CP000822

ID   CP000822; SV 1; circular; genomic DNA; STD; PRO; 4720462 BP.
XX
AC   CP000822;
XX
PR   Project:PRJNA12716;
XX
DT   12-SEP-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Citrobacter koseri ATCC BAA-895, complete genome.
XX
KW   .
XX
OS   Citrobacter koseri ATCC BAA-895
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Citrobacter.
XX
RN   [1]
RP   1-4720462
RG   The Citrobacter koseri Genome Sequencing Project
RA   McClelland M., Sanderson E.K., Porwollik S., Spieth J., Clifton W.S.,
RA   Latreille P., Courtney L., Wang C., Pepin K., Bhonagiri V., Nash W.,
RA   Johnson M., Thiruvilangam P., Wilson R.;
RT   ;
RL   Submitted (29-AUG-2007) to the INSDC.
RL   Genetics, Genome Sequencing Center, 4444 Forest Park Parkway, St. Louis, MO
RL   63108, USA
XX
DR   MD5; 8a41c7def8c93441e831ff903e897efa.
DR   BioSample; SAMN02603912.
DR   EnsemblGenomes-Gn; CKO_00097.
DR   EnsemblGenomes-Gn; CKO_00098.
DR   EnsemblGenomes-Gn; CKO_00100.
DR   EnsemblGenomes-Gn; CKO_00101.
DR   EnsemblGenomes-Gn; CKO_00102.
DR   EnsemblGenomes-Gn; CKO_00138.
DR   EnsemblGenomes-Gn; CKO_00139.
DR   EnsemblGenomes-Gn; CKO_00140.
DR   EnsemblGenomes-Gn; CKO_00141.
DR   EnsemblGenomes-Gn; CKO_00194.
DR   EnsemblGenomes-Gn; CKO_00195.
DR   EnsemblGenomes-Gn; CKO_00196.
DR   EnsemblGenomes-Gn; CKO_00392.
DR   EnsemblGenomes-Gn; CKO_00393.
DR   EnsemblGenomes-Gn; CKO_00394.
DR   EnsemblGenomes-Gn; CKO_00395.
DR   EnsemblGenomes-Gn; CKO_00399.
DR   EnsemblGenomes-Gn; CKO_00400.
DR   EnsemblGenomes-Gn; CKO_00442.
DR   EnsemblGenomes-Gn; CKO_00585.
DR   EnsemblGenomes-Gn; CKO_00836.
DR   EnsemblGenomes-Gn; CKO_00838.
DR   EnsemblGenomes-Gn; CKO_00954.
DR   EnsemblGenomes-Gn; CKO_00957.
DR   EnsemblGenomes-Gn; CKO_00959.
DR   EnsemblGenomes-Gn; CKO_01035.
DR   EnsemblGenomes-Gn; CKO_01036.
DR   EnsemblGenomes-Gn; CKO_01037.
DR   EnsemblGenomes-Gn; CKO_01308.
DR   EnsemblGenomes-Gn; CKO_01309.
DR   EnsemblGenomes-Gn; CKO_01376.
DR   EnsemblGenomes-Gn; CKO_01680.
DR   EnsemblGenomes-Gn; CKO_01681.
DR   EnsemblGenomes-Gn; CKO_02038.
DR   EnsemblGenomes-Gn; CKO_02094.
DR   EnsemblGenomes-Gn; CKO_02195.
DR   EnsemblGenomes-Gn; CKO_02392.
DR   EnsemblGenomes-Gn; CKO_02393.
DR   EnsemblGenomes-Gn; CKO_02394.
DR   EnsemblGenomes-Gn; CKO_02395.
DR   EnsemblGenomes-Gn; CKO_02396.
DR   EnsemblGenomes-Gn; CKO_02492.
DR   EnsemblGenomes-Gn; CKO_02493.
DR   EnsemblGenomes-Gn; CKO_02494.
DR   EnsemblGenomes-Gn; CKO_02495.
DR   EnsemblGenomes-Gn; CKO_02497.
DR   EnsemblGenomes-Gn; CKO_02498.
DR   EnsemblGenomes-Gn; CKO_02499.
DR   EnsemblGenomes-Gn; CKO_02617.
DR   EnsemblGenomes-Gn; CKO_02951.
DR   EnsemblGenomes-Gn; CKO_02967.
DR   EnsemblGenomes-Gn; CKO_02977.
DR   EnsemblGenomes-Gn; CKO_02978.
DR   EnsemblGenomes-Gn; CKO_02980.
DR   EnsemblGenomes-Gn; CKO_02981.
DR   EnsemblGenomes-Gn; CKO_03012.
DR   EnsemblGenomes-Gn; CKO_03013.
DR   EnsemblGenomes-Gn; CKO_03014.
DR   EnsemblGenomes-Gn; CKO_03015.
DR   EnsemblGenomes-Gn; CKO_03020.
DR   EnsemblGenomes-Gn; CKO_03021.
DR   EnsemblGenomes-Gn; CKO_03022.
DR   EnsemblGenomes-Gn; CKO_03023.
DR   EnsemblGenomes-Gn; CKO_03160.
DR   EnsemblGenomes-Gn; CKO_03162.
DR   EnsemblGenomes-Gn; CKO_03163.
DR   EnsemblGenomes-Gn; CKO_03164.
DR   EnsemblGenomes-Gn; CKO_03424.
DR   EnsemblGenomes-Gn; CKO_03425.
DR   EnsemblGenomes-Gn; CKO_03426.
DR   EnsemblGenomes-Gn; CKO_03533.
DR   EnsemblGenomes-Gn; CKO_03670.
DR   EnsemblGenomes-Gn; CKO_03671.
DR   EnsemblGenomes-Gn; CKO_03702.
DR   EnsemblGenomes-Gn; CKO_03910.
DR   EnsemblGenomes-Gn; CKO_03912.
DR   EnsemblGenomes-Gn; CKO_03913.
DR   EnsemblGenomes-Gn; CKO_03943.
DR   EnsemblGenomes-Gn; CKO_04042.
DR   EnsemblGenomes-Gn; CKO_04043.
DR   EnsemblGenomes-Gn; CKO_04044.
DR   EnsemblGenomes-Gn; CKO_04045.
DR   EnsemblGenomes-Gn; CKO_04046.
DR   EnsemblGenomes-Gn; CKO_04179.
DR   EnsemblGenomes-Gn; CKO_04180.
DR   EnsemblGenomes-Gn; CKO_04181.
DR   EnsemblGenomes-Gn; CKO_04248.
DR   EnsemblGenomes-Gn; CKO_04343.
DR   EnsemblGenomes-Gn; CKO_04468.
DR   EnsemblGenomes-Gn; CKO_04572.
DR   EnsemblGenomes-Gn; CKO_04575.
DR   EnsemblGenomes-Gn; CKO_04685.
DR   EnsemblGenomes-Gn; CKO_04686.
DR   EnsemblGenomes-Gn; CKO_04687.
DR   EnsemblGenomes-Gn; CKO_04689.
DR   EnsemblGenomes-Gn; CKO_04690.
DR   EnsemblGenomes-Gn; CKO_04995.
DR   EnsemblGenomes-Gn; CKO_05140.
DR   EnsemblGenomes-Gn; EBG00001464435.
DR   EnsemblGenomes-Gn; EBG00001464436.
DR   EnsemblGenomes-Gn; EBG00001464437.
DR   EnsemblGenomes-Gn; EBG00001464438.
DR   EnsemblGenomes-Gn; EBG00001464439.
DR   EnsemblGenomes-Gn; EBG00001464440.
DR   EnsemblGenomes-Gn; EBG00001464441.
DR   EnsemblGenomes-Gn; EBG00001464442.
DR   EnsemblGenomes-Gn; EBG00001464443.
DR   EnsemblGenomes-Gn; EBG00001464444.
DR   EnsemblGenomes-Gn; EBG00001464445.
DR   EnsemblGenomes-Gn; EBG00001464446.
DR   EnsemblGenomes-Gn; EBG00001464447.
DR   EnsemblGenomes-Gn; EBG00001464448.
DR   EnsemblGenomes-Gn; EBG00001464449.
DR   EnsemblGenomes-Gn; EBG00001464450.
DR   EnsemblGenomes-Gn; EBG00001464451.
DR   EnsemblGenomes-Gn; EBG00001464452.
DR   EnsemblGenomes-Gn; EBG00001464453.
DR   EnsemblGenomes-Gn; EBG00001464454.
DR   EnsemblGenomes-Gn; EBG00001464455.
DR   EnsemblGenomes-Gn; EBG00001464456.
DR   EnsemblGenomes-Gn; EBG00001464457.
DR   EnsemblGenomes-Gn; EBG00001464458.
DR   EnsemblGenomes-Gn; EBG00001464459.
DR   EnsemblGenomes-Gn; EBG00001464460.
DR   EnsemblGenomes-Gn; EBG00001464461.
DR   EnsemblGenomes-Gn; EBG00001464462.
DR   EnsemblGenomes-Gn; EBG00001464463.
DR   EnsemblGenomes-Gn; EBG00001464464.
DR   EnsemblGenomes-Gn; EBG00001464465.
DR   EnsemblGenomes-Gn; EBG00001464466.
DR   EnsemblGenomes-Gn; EBG00001464467.
DR   EnsemblGenomes-Gn; EBG00001464468.
DR   EnsemblGenomes-Gn; EBG00001464469.
DR   EnsemblGenomes-Gn; EBG00001464470.
DR   EnsemblGenomes-Gn; EBG00001464471.
DR   EnsemblGenomes-Gn; EBG00001464472.
DR   EnsemblGenomes-Gn; EBG00001464473.
DR   EnsemblGenomes-Gn; EBG00001464474.
DR   EnsemblGenomes-Gn; EBG00001464475.
DR   EnsemblGenomes-Gn; EBG00001464476.
DR   EnsemblGenomes-Gn; EBG00001464477.
DR   EnsemblGenomes-Gn; EBG00001464478.
DR   EnsemblGenomes-Gn; EBG00001464479.
DR   EnsemblGenomes-Gn; EBG00001464480.
DR   EnsemblGenomes-Gn; EBG00001464481.
DR   EnsemblGenomes-Gn; EBG00001464482.
DR   EnsemblGenomes-Gn; EBG00001464483.
DR   EnsemblGenomes-Gn; EBG00001464484.
DR   EnsemblGenomes-Gn; EBG00001464485.
DR   EnsemblGenomes-Gn; EBG00001464486.
DR   EnsemblGenomes-Gn; EBG00001464487.
DR   EnsemblGenomes-Gn; EBG00001464488.
DR   EnsemblGenomes-Gn; EBG00001464489.
DR   EnsemblGenomes-Gn; EBG00001464490.
DR   EnsemblGenomes-Gn; EBG00001464491.
DR   EnsemblGenomes-Gn; EBG00001464492.
DR   EnsemblGenomes-Gn; EBG00001464493.
DR   EnsemblGenomes-Gn; EBG00001464494.
DR   EnsemblGenomes-Gn; EBG00001464495.
DR   EnsemblGenomes-Gn; EBG00001464496.
DR   EnsemblGenomes-Gn; EBG00001464497.
DR   EnsemblGenomes-Gn; EBG00001464498.
DR   EnsemblGenomes-Gn; EBG00001464499.
DR   EnsemblGenomes-Gn; EBG00001464500.
DR   EnsemblGenomes-Gn; EBG00001464501.
DR   EnsemblGenomes-Gn; EBG00001464502.
DR   EnsemblGenomes-Gn; EBG00001464503.
DR   EnsemblGenomes-Gn; EBG00001464504.
DR   EnsemblGenomes-Gn; EBG00001464505.
DR   EnsemblGenomes-Gn; EBG00001464506.
DR   EnsemblGenomes-Gn; EBG00001464507.
DR   EnsemblGenomes-Gn; EBG00001464508.
DR   EnsemblGenomes-Gn; EBG00001464509.
DR   EnsemblGenomes-Gn; EBG00001464510.
DR   EnsemblGenomes-Gn; EBG00001464511.
DR   EnsemblGenomes-Gn; EBG00001464512.
DR   EnsemblGenomes-Gn; EBG00001464513.
DR   EnsemblGenomes-Gn; EBG00001464514.
DR   EnsemblGenomes-Gn; EBG00001464515.
DR   EnsemblGenomes-Gn; EBG00001464516.
DR   EnsemblGenomes-Gn; EBG00001464517.
DR   EnsemblGenomes-Gn; EBG00001464518.
DR   EnsemblGenomes-Gn; EBG00001464519.
DR   EnsemblGenomes-Gn; EBG00001464520.
DR   EnsemblGenomes-Gn; EBG00001464521.
DR   EnsemblGenomes-Gn; EBG00001464522.
DR   EnsemblGenomes-Gn; EBG00001464523.
DR   EnsemblGenomes-Gn; EBG00001464524.
DR   EnsemblGenomes-Gn; EBG00001464525.
DR   EnsemblGenomes-Gn; EBG00001464526.
DR   EnsemblGenomes-Gn; EBG00001464527.
DR   EnsemblGenomes-Gn; EBG00001464528.
DR   EnsemblGenomes-Gn; EBG00001464529.
DR   EnsemblGenomes-Gn; EBG00001464530.
DR   EnsemblGenomes-Gn; EBG00001464531.
DR   EnsemblGenomes-Gn; EBG00001464532.
DR   EnsemblGenomes-Gn; EBG00001464533.
DR   EnsemblGenomes-Gn; EBG00001464534.
DR   EnsemblGenomes-Gn; EBG00001464535.
DR   EnsemblGenomes-Gn; EBG00001464536.
DR   EnsemblGenomes-Gn; EBG00001464537.
DR   EnsemblGenomes-Gn; EBG00001464538.
DR   EnsemblGenomes-Gn; EBG00001464539.
DR   EnsemblGenomes-Gn; EBG00001464540.
DR   EnsemblGenomes-Gn; EBG00001464541.
DR   EnsemblGenomes-Gn; EBG00001464542.
DR   EnsemblGenomes-Gn; EBG00001464543.
DR   EnsemblGenomes-Gn; EBG00001464544.
DR   EnsemblGenomes-Gn; EBG00001464545.
DR   EnsemblGenomes-Gn; EBG00001464546.
DR   EnsemblGenomes-Gn; EBG00001464547.
DR   EnsemblGenomes-Gn; EBG00001464548.
DR   EnsemblGenomes-Gn; EBG00001464549.
DR   EnsemblGenomes-Gn; EBG00001464550.
DR   EnsemblGenomes-Gn; EBG00001464551.
DR   EnsemblGenomes-Gn; EBG00001464552.
DR   EnsemblGenomes-Gn; EBG00001464553.
DR   EnsemblGenomes-Gn; EBG00001464554.
DR   EnsemblGenomes-Gn; EBG00001464555.
DR   EnsemblGenomes-Gn; EBG00001464556.
DR   EnsemblGenomes-Gn; EBG00001464557.
DR   EnsemblGenomes-Gn; EBG00001464558.
DR   EnsemblGenomes-Gn; EBG00001464559.
DR   EnsemblGenomes-Gn; EBG00001464560.
DR   EnsemblGenomes-Gn; EBG00001464561.
DR   EnsemblGenomes-Gn; EBG00001464562.
DR   EnsemblGenomes-Gn; EBG00001464563.
DR   EnsemblGenomes-Gn; EBG00001464564.
DR   EnsemblGenomes-Gn; EBG00001464565.
DR   EnsemblGenomes-Gn; EBG00001464566.
DR   EnsemblGenomes-Gn; EBG00001464567.
DR   EnsemblGenomes-Gn; EBG00001464568.
DR   EnsemblGenomes-Gn; EBG00001464569.
DR   EnsemblGenomes-Gn; EBG00001464570.
DR   EnsemblGenomes-Gn; EBG00001464571.
DR   EnsemblGenomes-Gn; EBG00001464572.
DR   EnsemblGenomes-Gn; EBG00001464573.
DR   EnsemblGenomes-Gn; EBG00001464574.
DR   EnsemblGenomes-Gn; EBG00001464575.
DR   EnsemblGenomes-Gn; EBG00001464576.
DR   EnsemblGenomes-Gn; EBG00001464577.
DR   EnsemblGenomes-Gn; EBG00001464578.
DR   EnsemblGenomes-Gn; EBG00001464579.
DR   EnsemblGenomes-Gn; EBG00001464580.
DR   EnsemblGenomes-Gn; EBG00001464581.
DR   EnsemblGenomes-Gn; EBG00001464582.
DR   EnsemblGenomes-Gn; EBG00001464583.
DR   EnsemblGenomes-Gn; EBG00001464584.
DR   EnsemblGenomes-Gn; EBG00001464585.
DR   EnsemblGenomes-Gn; EBG00001464586.
DR   EnsemblGenomes-Gn; EBG00001464587.
DR   EnsemblGenomes-Gn; EBG00001464588.
DR   EnsemblGenomes-Gn; EBG00001464589.
DR   EnsemblGenomes-Gn; EBG00001464590.
DR   EnsemblGenomes-Gn; EBG00001464591.
DR   EnsemblGenomes-Gn; EBG00001464592.
DR   EnsemblGenomes-Gn; EBG00001464593.
DR   EnsemblGenomes-Gn; EBG00001464594.
DR   EnsemblGenomes-Gn; EBG00001464595.
DR   EnsemblGenomes-Gn; EBG00001464596.
DR   EnsemblGenomes-Gn; EBG00001464597.
DR   EnsemblGenomes-Gn; EBG00001464598.
DR   EnsemblGenomes-Gn; EBG00001464599.
DR   EnsemblGenomes-Gn; EBG00001464600.
DR   EnsemblGenomes-Gn; EBG00001464601.
DR   EnsemblGenomes-Gn; EBG00001464602.
DR   EnsemblGenomes-Gn; EBG00001464603.
DR   EnsemblGenomes-Gn; EBG00001464604.
DR   EnsemblGenomes-Gn; EBG00001464605.
DR   EnsemblGenomes-Gn; EBG00001464606.
DR   EnsemblGenomes-Gn; EBG00001464607.
DR   EnsemblGenomes-Gn; EBG00001464608.
DR   EnsemblGenomes-Gn; EBG00001464609.
DR   EnsemblGenomes-Gn; EBG00001464610.
DR   EnsemblGenomes-Gn; EBG00001464611.
DR   EnsemblGenomes-Gn; EBG00001464612.
DR   EnsemblGenomes-Gn; EBG00001464613.
DR   EnsemblGenomes-Gn; EBG00001464614.
DR   EnsemblGenomes-Gn; EBG00001464615.
DR   EnsemblGenomes-Gn; EBG00001464616.
DR   EnsemblGenomes-Gn; EBG00001464617.
DR   EnsemblGenomes-Gn; EBG00001464618.
DR   EnsemblGenomes-Gn; EBG00001464619.
DR   EnsemblGenomes-Gn; EBG00001464620.
DR   EnsemblGenomes-Gn; EBG00001464621.
DR   EnsemblGenomes-Gn; EBG00001464622.
DR   EnsemblGenomes-Gn; EBG00001464623.
DR   EnsemblGenomes-Gn; EBG00001464624.
DR   EnsemblGenomes-Gn; EBG00001464625.
DR   EnsemblGenomes-Gn; EBG00001464626.
DR   EnsemblGenomes-Tr; CKO_00097-1.
DR   EnsemblGenomes-Tr; CKO_00098-1.
DR   EnsemblGenomes-Tr; CKO_00100-1.
DR   EnsemblGenomes-Tr; CKO_00101-1.
DR   EnsemblGenomes-Tr; CKO_00102-1.
DR   EnsemblGenomes-Tr; CKO_00138-1.
DR   EnsemblGenomes-Tr; CKO_00139-1.
DR   EnsemblGenomes-Tr; CKO_00140-1.
DR   EnsemblGenomes-Tr; CKO_00141-1.
DR   EnsemblGenomes-Tr; CKO_00194-1.
DR   EnsemblGenomes-Tr; CKO_00195-1.
DR   EnsemblGenomes-Tr; CKO_00196-1.
DR   EnsemblGenomes-Tr; CKO_00392-1.
DR   EnsemblGenomes-Tr; CKO_00393-1.
DR   EnsemblGenomes-Tr; CKO_00394-1.
DR   EnsemblGenomes-Tr; CKO_00395-1.
DR   EnsemblGenomes-Tr; CKO_00399-1.
DR   EnsemblGenomes-Tr; CKO_00400-1.
DR   EnsemblGenomes-Tr; CKO_00442-1.
DR   EnsemblGenomes-Tr; CKO_00585-1.
DR   EnsemblGenomes-Tr; CKO_00836-1.
DR   EnsemblGenomes-Tr; CKO_00838-1.
DR   EnsemblGenomes-Tr; CKO_00954-1.
DR   EnsemblGenomes-Tr; CKO_00957-1.
DR   EnsemblGenomes-Tr; CKO_00959-1.
DR   EnsemblGenomes-Tr; CKO_01035-1.
DR   EnsemblGenomes-Tr; CKO_01036-1.
DR   EnsemblGenomes-Tr; CKO_01037-1.
DR   EnsemblGenomes-Tr; CKO_01308-1.
DR   EnsemblGenomes-Tr; CKO_01309-1.
DR   EnsemblGenomes-Tr; CKO_01376-1.
DR   EnsemblGenomes-Tr; CKO_01680-1.
DR   EnsemblGenomes-Tr; CKO_01681-1.
DR   EnsemblGenomes-Tr; CKO_02038-1.
DR   EnsemblGenomes-Tr; CKO_02094-1.
DR   EnsemblGenomes-Tr; CKO_02195-1.
DR   EnsemblGenomes-Tr; CKO_02392-1.
DR   EnsemblGenomes-Tr; CKO_02393-1.
DR   EnsemblGenomes-Tr; CKO_02394-1.
DR   EnsemblGenomes-Tr; CKO_02395-1.
DR   EnsemblGenomes-Tr; CKO_02396-1.
DR   EnsemblGenomes-Tr; CKO_02492-1.
DR   EnsemblGenomes-Tr; CKO_02493-1.
DR   EnsemblGenomes-Tr; CKO_02494-1.
DR   EnsemblGenomes-Tr; CKO_02495-1.
DR   EnsemblGenomes-Tr; CKO_02497-1.
DR   EnsemblGenomes-Tr; CKO_02498-1.
DR   EnsemblGenomes-Tr; CKO_02499-1.
DR   EnsemblGenomes-Tr; CKO_02617-1.
DR   EnsemblGenomes-Tr; CKO_02951-1.
DR   EnsemblGenomes-Tr; CKO_02967-1.
DR   EnsemblGenomes-Tr; CKO_02977-1.
DR   EnsemblGenomes-Tr; CKO_02978-1.
DR   EnsemblGenomes-Tr; CKO_02980-1.
DR   EnsemblGenomes-Tr; CKO_02981-1.
DR   EnsemblGenomes-Tr; CKO_03012-1.
DR   EnsemblGenomes-Tr; CKO_03013-1.
DR   EnsemblGenomes-Tr; CKO_03014-1.
DR   EnsemblGenomes-Tr; CKO_03015-1.
DR   EnsemblGenomes-Tr; CKO_03020-1.
DR   EnsemblGenomes-Tr; CKO_03021-1.
DR   EnsemblGenomes-Tr; CKO_03022-1.
DR   EnsemblGenomes-Tr; CKO_03023-1.
DR   EnsemblGenomes-Tr; CKO_03160-1.
DR   EnsemblGenomes-Tr; CKO_03162-1.
DR   EnsemblGenomes-Tr; CKO_03163-1.
DR   EnsemblGenomes-Tr; CKO_03164-1.
DR   EnsemblGenomes-Tr; CKO_03424-1.
DR   EnsemblGenomes-Tr; CKO_03425-1.
DR   EnsemblGenomes-Tr; CKO_03426-1.
DR   EnsemblGenomes-Tr; CKO_03533-1.
DR   EnsemblGenomes-Tr; CKO_03670-1.
DR   EnsemblGenomes-Tr; CKO_03671-1.
DR   EnsemblGenomes-Tr; CKO_03702-1.
DR   EnsemblGenomes-Tr; CKO_03910-1.
DR   EnsemblGenomes-Tr; CKO_03912-1.
DR   EnsemblGenomes-Tr; CKO_03913-1.
DR   EnsemblGenomes-Tr; CKO_03943-1.
DR   EnsemblGenomes-Tr; CKO_04042-1.
DR   EnsemblGenomes-Tr; CKO_04043-1.
DR   EnsemblGenomes-Tr; CKO_04044-1.
DR   EnsemblGenomes-Tr; CKO_04045-1.
DR   EnsemblGenomes-Tr; CKO_04046-1.
DR   EnsemblGenomes-Tr; CKO_04179-1.
DR   EnsemblGenomes-Tr; CKO_04180-1.
DR   EnsemblGenomes-Tr; CKO_04181-1.
DR   EnsemblGenomes-Tr; CKO_04248-1.
DR   EnsemblGenomes-Tr; CKO_04343-1.
DR   EnsemblGenomes-Tr; CKO_04468-1.
DR   EnsemblGenomes-Tr; CKO_04572-1.
DR   EnsemblGenomes-Tr; CKO_04575-1.
DR   EnsemblGenomes-Tr; CKO_04685-1.
DR   EnsemblGenomes-Tr; CKO_04686-1.
DR   EnsemblGenomes-Tr; CKO_04687-1.
DR   EnsemblGenomes-Tr; CKO_04689-1.
DR   EnsemblGenomes-Tr; CKO_04690-1.
DR   EnsemblGenomes-Tr; CKO_04995-1.
DR   EnsemblGenomes-Tr; CKO_05140-1.
DR   EnsemblGenomes-Tr; EBT00001618091.
DR   EnsemblGenomes-Tr; EBT00001618094.
DR   EnsemblGenomes-Tr; EBT00001618095.
DR   EnsemblGenomes-Tr; EBT00001618099.
DR   EnsemblGenomes-Tr; EBT00001618100.
DR   EnsemblGenomes-Tr; EBT00001618101.
DR   EnsemblGenomes-Tr; EBT00001618103.
DR   EnsemblGenomes-Tr; EBT00001618105.
DR   EnsemblGenomes-Tr; EBT00001618107.
DR   EnsemblGenomes-Tr; EBT00001618109.
DR   EnsemblGenomes-Tr; EBT00001618110.
DR   EnsemblGenomes-Tr; EBT00001618112.
DR   EnsemblGenomes-Tr; EBT00001618114.
DR   EnsemblGenomes-Tr; EBT00001618116.
DR   EnsemblGenomes-Tr; EBT00001618118.
DR   EnsemblGenomes-Tr; EBT00001618119.
DR   EnsemblGenomes-Tr; EBT00001618121.
DR   EnsemblGenomes-Tr; EBT00001618122.
DR   EnsemblGenomes-Tr; EBT00001618124.
DR   EnsemblGenomes-Tr; EBT00001618126.
DR   EnsemblGenomes-Tr; EBT00001618128.
DR   EnsemblGenomes-Tr; EBT00001618130.
DR   EnsemblGenomes-Tr; EBT00001618131.
DR   EnsemblGenomes-Tr; EBT00001618133.
DR   EnsemblGenomes-Tr; EBT00001618134.
DR   EnsemblGenomes-Tr; EBT00001618136.
DR   EnsemblGenomes-Tr; EBT00001618138.
DR   EnsemblGenomes-Tr; EBT00001618139.
DR   EnsemblGenomes-Tr; EBT00001618141.
DR   EnsemblGenomes-Tr; EBT00001618143.
DR   EnsemblGenomes-Tr; EBT00001618145.
DR   EnsemblGenomes-Tr; EBT00001618146.
DR   EnsemblGenomes-Tr; EBT00001618148.
DR   EnsemblGenomes-Tr; EBT00001618150.
DR   EnsemblGenomes-Tr; EBT00001618152.
DR   EnsemblGenomes-Tr; EBT00001618154.
DR   EnsemblGenomes-Tr; EBT00001618155.
DR   EnsemblGenomes-Tr; EBT00001618158.
DR   EnsemblGenomes-Tr; EBT00001618160.
DR   EnsemblGenomes-Tr; EBT00001618162.
DR   EnsemblGenomes-Tr; EBT00001618164.
DR   EnsemblGenomes-Tr; EBT00001618165.
DR   EnsemblGenomes-Tr; EBT00001618167.
DR   EnsemblGenomes-Tr; EBT00001618169.
DR   EnsemblGenomes-Tr; EBT00001618172.
DR   EnsemblGenomes-Tr; EBT00001618174.
DR   EnsemblGenomes-Tr; EBT00001618175.
DR   EnsemblGenomes-Tr; EBT00001618177.
DR   EnsemblGenomes-Tr; EBT00001618179.
DR   EnsemblGenomes-Tr; EBT00001618181.
DR   EnsemblGenomes-Tr; EBT00001618183.
DR   EnsemblGenomes-Tr; EBT00001618185.
DR   EnsemblGenomes-Tr; EBT00001618187.
DR   EnsemblGenomes-Tr; EBT00001618189.
DR   EnsemblGenomes-Tr; EBT00001618191.
DR   EnsemblGenomes-Tr; EBT00001618192.
DR   EnsemblGenomes-Tr; EBT00001618194.
DR   EnsemblGenomes-Tr; EBT00001618196.
DR   EnsemblGenomes-Tr; EBT00001618198.
DR   EnsemblGenomes-Tr; EBT00001618200.
DR   EnsemblGenomes-Tr; EBT00001618201.
DR   EnsemblGenomes-Tr; EBT00001618202.
DR   EnsemblGenomes-Tr; EBT00001618204.
DR   EnsemblGenomes-Tr; EBT00001618206.
DR   EnsemblGenomes-Tr; EBT00001618207.
DR   EnsemblGenomes-Tr; EBT00001618209.
DR   EnsemblGenomes-Tr; EBT00001618210.
DR   EnsemblGenomes-Tr; EBT00001618211.
DR   EnsemblGenomes-Tr; EBT00001618213.
DR   EnsemblGenomes-Tr; EBT00001618214.
DR   EnsemblGenomes-Tr; EBT00001618215.
DR   EnsemblGenomes-Tr; EBT00001618216.
DR   EnsemblGenomes-Tr; EBT00001618217.
DR   EnsemblGenomes-Tr; EBT00001618219.
DR   EnsemblGenomes-Tr; EBT00001618220.
DR   EnsemblGenomes-Tr; EBT00001618222.
DR   EnsemblGenomes-Tr; EBT00001618224.
DR   EnsemblGenomes-Tr; EBT00001618226.
DR   EnsemblGenomes-Tr; EBT00001618229.
DR   EnsemblGenomes-Tr; EBT00001618231.
DR   EnsemblGenomes-Tr; EBT00001618233.
DR   EnsemblGenomes-Tr; EBT00001618236.
DR   EnsemblGenomes-Tr; EBT00001618237.
DR   EnsemblGenomes-Tr; EBT00001618240.
DR   EnsemblGenomes-Tr; EBT00001618241.
DR   EnsemblGenomes-Tr; EBT00001618243.
DR   EnsemblGenomes-Tr; EBT00001618244.
DR   EnsemblGenomes-Tr; EBT00001618246.
DR   EnsemblGenomes-Tr; EBT00001618248.
DR   EnsemblGenomes-Tr; EBT00001618249.
DR   EnsemblGenomes-Tr; EBT00001618250.
DR   EnsemblGenomes-Tr; EBT00001618253.
DR   EnsemblGenomes-Tr; EBT00001618255.
DR   EnsemblGenomes-Tr; EBT00001618257.
DR   EnsemblGenomes-Tr; EBT00001618258.
DR   EnsemblGenomes-Tr; EBT00001618260.
DR   EnsemblGenomes-Tr; EBT00001618262.
DR   EnsemblGenomes-Tr; EBT00001618264.
DR   EnsemblGenomes-Tr; EBT00001618266.
DR   EnsemblGenomes-Tr; EBT00001618267.
DR   EnsemblGenomes-Tr; EBT00001618268.
DR   EnsemblGenomes-Tr; EBT00001618269.
DR   EnsemblGenomes-Tr; EBT00001618270.
DR   EnsemblGenomes-Tr; EBT00001618271.
DR   EnsemblGenomes-Tr; EBT00001618272.
DR   EnsemblGenomes-Tr; EBT00001618273.
DR   EnsemblGenomes-Tr; EBT00001618274.
DR   EnsemblGenomes-Tr; EBT00001618275.
DR   EnsemblGenomes-Tr; EBT00001618276.
DR   EnsemblGenomes-Tr; EBT00001618277.
DR   EnsemblGenomes-Tr; EBT00001618278.
DR   EnsemblGenomes-Tr; EBT00001618279.
DR   EnsemblGenomes-Tr; EBT00001618280.
DR   EnsemblGenomes-Tr; EBT00001618281.
DR   EnsemblGenomes-Tr; EBT00001618282.
DR   EnsemblGenomes-Tr; EBT00001618283.
DR   EnsemblGenomes-Tr; EBT00001618284.
DR   EnsemblGenomes-Tr; EBT00001618285.
DR   EnsemblGenomes-Tr; EBT00001618286.
DR   EnsemblGenomes-Tr; EBT00001618287.
DR   EnsemblGenomes-Tr; EBT00001618288.
DR   EnsemblGenomes-Tr; EBT00001618289.
DR   EnsemblGenomes-Tr; EBT00001618290.
DR   EnsemblGenomes-Tr; EBT00001618291.
DR   EnsemblGenomes-Tr; EBT00001618292.
DR   EnsemblGenomes-Tr; EBT00001618293.
DR   EnsemblGenomes-Tr; EBT00001618294.
DR   EnsemblGenomes-Tr; EBT00001618295.
DR   EnsemblGenomes-Tr; EBT00001618296.
DR   EnsemblGenomes-Tr; EBT00001618297.
DR   EnsemblGenomes-Tr; EBT00001618298.
DR   EnsemblGenomes-Tr; EBT00001618299.
DR   EnsemblGenomes-Tr; EBT00001618300.
DR   EnsemblGenomes-Tr; EBT00001618301.
DR   EnsemblGenomes-Tr; EBT00001618302.
DR   EnsemblGenomes-Tr; EBT00001618303.
DR   EnsemblGenomes-Tr; EBT00001618304.
DR   EnsemblGenomes-Tr; EBT00001618305.
DR   EnsemblGenomes-Tr; EBT00001618306.
DR   EnsemblGenomes-Tr; EBT00001618307.
DR   EnsemblGenomes-Tr; EBT00001618308.
DR   EnsemblGenomes-Tr; EBT00001618309.
DR   EnsemblGenomes-Tr; EBT00001618310.
DR   EnsemblGenomes-Tr; EBT00001618311.
DR   EnsemblGenomes-Tr; EBT00001618312.
DR   EnsemblGenomes-Tr; EBT00001618313.
DR   EnsemblGenomes-Tr; EBT00001618314.
DR   EnsemblGenomes-Tr; EBT00001618315.
DR   EnsemblGenomes-Tr; EBT00001618316.
DR   EnsemblGenomes-Tr; EBT00001618317.
DR   EnsemblGenomes-Tr; EBT00001618318.
DR   EnsemblGenomes-Tr; EBT00001618319.
DR   EnsemblGenomes-Tr; EBT00001618320.
DR   EnsemblGenomes-Tr; EBT00001618321.
DR   EnsemblGenomes-Tr; EBT00001618322.
DR   EnsemblGenomes-Tr; EBT00001618323.
DR   EnsemblGenomes-Tr; EBT00001618324.
DR   EnsemblGenomes-Tr; EBT00001618325.
DR   EnsemblGenomes-Tr; EBT00001618326.
DR   EnsemblGenomes-Tr; EBT00001618327.
DR   EnsemblGenomes-Tr; EBT00001618328.
DR   EnsemblGenomes-Tr; EBT00001618329.
DR   EnsemblGenomes-Tr; EBT00001618330.
DR   EnsemblGenomes-Tr; EBT00001618331.
DR   EnsemblGenomes-Tr; EBT00001618332.
DR   EnsemblGenomes-Tr; EBT00001618333.
DR   EnsemblGenomes-Tr; EBT00001618334.
DR   EnsemblGenomes-Tr; EBT00001618335.
DR   EnsemblGenomes-Tr; EBT00001618336.
DR   EnsemblGenomes-Tr; EBT00001618337.
DR   EnsemblGenomes-Tr; EBT00001618338.
DR   EnsemblGenomes-Tr; EBT00001618339.
DR   EnsemblGenomes-Tr; EBT00001618340.
DR   EnsemblGenomes-Tr; EBT00001618341.
DR   EnsemblGenomes-Tr; EBT00001618342.
DR   EnsemblGenomes-Tr; EBT00001618343.
DR   EnsemblGenomes-Tr; EBT00001618344.
DR   EnsemblGenomes-Tr; EBT00001618345.
DR   EnsemblGenomes-Tr; EBT00001618346.
DR   EnsemblGenomes-Tr; EBT00001618347.
DR   EnsemblGenomes-Tr; EBT00001618348.
DR   EnsemblGenomes-Tr; EBT00001618349.
DR   EnsemblGenomes-Tr; EBT00001618350.
DR   EnsemblGenomes-Tr; EBT00001618351.
DR   EnsemblGenomes-Tr; EBT00001618352.
DR   EnsemblGenomes-Tr; EBT00001618353.
DR   EnsemblGenomes-Tr; EBT00001618354.
DR   EnsemblGenomes-Tr; EBT00001618355.
DR   EnsemblGenomes-Tr; EBT00001618356.
DR   EnsemblGenomes-Tr; EBT00001618357.
DR   EnsemblGenomes-Tr; EBT00001618358.
DR   EnsemblGenomes-Tr; EBT00001618359.
DR   EuropePMC; PMC2592850; 18852276.
DR   EuropePMC; PMC2770063; 19852808.
DR   EuropePMC; PMC2772509; 19720753.
DR   EuropePMC; PMC2786675; 19812281.
DR   EuropePMC; PMC2805327; 19897651.
DR   EuropePMC; PMC2900259; 20576143.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3195058; 21859935.
DR   EuropePMC; PMC3421776; 22785185.
DR   EuropePMC; PMC3504363; 23189075.
DR   EuropePMC; PMC3732745; 22983040.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01386; isrB.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01409; STnc250.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02065; STnc340.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02075; STnc230.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02084; STnc130.
DR   SILVA-LSU; CP000822.
DR   SILVA-SSU; CP000822.
DR   StrainInfo; 692373; 0.
XX
CC   Citrobacter (diversus) koseri--Citrobacter cells are isolated from
CC   water, sewage, soils, and food, as well as from the feces of man
CC   and other animals, where they may be normal inhabitants. They can
CC   be found in urine, sputum, and other clinical specimens. They can
CC   sometimes be opportunistic pathogens particularly in
CC   immunocompromised patients in hospitals or in infants (Pepperell et
CC   al., Antimicrob Agents Chemother. 2002 Nov;46(11):3555-60. and
CC   references therein).
CC   The strain of Citrobacter koseri being sequenced, strain CDC
CC   4225-83, was isolated in 1983 in Maryland, where it caused neonatal
CC   meningitis. It was provided by Caroline Mohr and Melissa Campbell
CC   of CDC. The strain is available from the American Type Culture
CC   Collection as ATCC BAA-895 or from the Salmonella Genetic Stock
CC   Centre as SGSC4696. The genome was sequenced to 8X coverage, using
CC   plasmid and fosmid libraries and was finished to an error rate of
CC   less than 1 per 10,000 bases. Automated annotation was performed
CC   and manual annotation will continue in the labs of Michael
CC   McClelland and Kenneth Sanderson. The National Institute of Allergy
CC   and Infectious Diseases (NIAID), National Institutes of Health
CC   (NIH) has funded this project.
CC   Coding sequences below are predicted using GeneMark v3.3 and
CC   Glimmer2 v2.13.Intergenic regions not spanned by GeneMark and
CC   Glimmer2 were blasted against NCBI's non-redundant (NR) database
CC   and predictions generated based on protein alignments. RNA genes
CC   were determined usingtRNAscan-SE 1.23 or Rfam v8.0. This sequence
CC   was finished as follows unless otherwise noted: all regions were
CC   double stranded, sequenced with an alternate chemistries or covered
CC   by high quality data (i.e., phred quality >=30); an attempt was
CC   made to resolve all sequencing problems, such as compressions and
CC   repeats; all regions were covered by sequence from more than one
CC   m13 subclone.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4720462
FT                   /organism="Citrobacter koseri ATCC BAA-895"
FT                   /strain="ATCC BAA-895"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:290338"
FT   unsure          3
FT                   /note="Unresolved duplication"
FT   gene            833..2143
FT                   /locus_tag="CKO_00001"
FT   CDS_pept        833..2143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00001"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11180"
FT                   /db_xref="GOA:A8ACG7"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACG7"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01500235.1"
FT                   /protein_id="ABV11180.1"
FT                   /translation="MSIVNVNTEEEKLKATTVRWRIFIIMLLLGAINYIDRTSLSIAMP
FT                   YITDEFGITDTRVVGVIHSAFFWAYALMQIPSGVIADKFKARNIIALATILWGAFQAVA
FT                   ALCHSIFTLSLSRLGLGVTESPIMPAGAKLMGTWLTPTERGRGSMLLDGGAPLGTALGA
FT                   VIIAGLIAFFDSWRMAFVVAGVGTMLVGLLAWWYIRTYPSEHPRINQAELDHITAANGP
FT                   ATNSKKYRLADIKPYLKQRNVLALIGGWVCYSFVFYGLMTWLPLYFQATYGFDIKSMGG
FT                   AMALIFLLCFIGQLTGGYIMDKWRSKGAKTSRVMHTMLAISATTAGVGIFLCAQSSTPA
FT                   IAITLLTIALFPLRWASVYWSIPGLLGAQSVAGTICGTMNFTSNLFAAILPIFIGFLVQ
FT                   STGNYYAAMMFFALAAVGYLICSLLINFDKKMDIAEK"
FT   gene            2064..2309
FT                   /locus_tag="CKO_00002"
FT   CDS_pept        2064..2309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACG8"
FT                   /protein_id="ABV11181.1"
FT                   /translation="MRWPQWVTSSARCSLTSIKKWILLKSNYPSPARSRAIFYGIRNEV
FT                   CSIQITLLPSTGAPATYACGFTRRGAVSGVTPVMMG"
FT   gene            2198..3100
FT                   /locus_tag="CKO_00003"
FT   CDS_pept        2198..3100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00003"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4418 4.8e-61 dgoK;
FT                   2-dehydro-3-deoxygalactonokinase K00883; COG: COG3734
FT                   2-keto-3-deoxy-galactonokinase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11182"
FT                   /db_xref="GOA:A8ACG9"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACG9"
FT                   /inference="protein motif:HMMPfam:IPR007729"
FT                   /inference="similar to AA sequence:REFSEQ:YP_052503.1"
FT                   /protein_id="ABV11182.1"
FT                   /translation="MFNSDNFIAVDWGSSNLRLWVYQKGSCVWRHASHDGVINHHAGQF
FT                   KDIWLTLLEQCPHTLADNTTVIMSGMIGSNIGWVDSHYLLCPVSLQTLSQHLTQVHDAG
FT                   HLPVFIIPGLQLAGSETCNVMRGEETQLLGALSENSWYAFPGTHSKWVRMENDTVRDFQ
FT                   TIMTGEFFHLLTRHSIVGKHATVQQHNVDAFLAGAKRGQHENCLSRGVFDLRARTLSHI
FT                   LPQDALFDALSGLLIGHEIAQMLQHYAIPAHEEIVLVGSDELLVRYQTVFQLFGQRCRL
FT                   LNGETAFINGIRSVLHEHP"
FT   gene            3087..3701
FT                   /locus_tag="CKO_00004"
FT   CDS_pept        3087..3701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2752 1.9e-57 dgoAa, RS00102;
FT                   keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase K01631; COG: COG0800
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11183"
FT                   /db_xref="GOA:A8ACH0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH0"
FT                   /inference="protein motif:HMMPfam:IPR000887"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01660510.1"
FT                   /protein_id="ABV11183.1"
FT                   /translation="MNIRNPLVAILRGITPDEVLAHIDVLATAGFTTVEIPLNSPDWQT
FT                   SIAIAVAHYGQTIHIGAGTVTAVSEVNLLSAFKCSFILTPNTDPSVIDAARDAGMTTCI
FT                   GCHTASEAFVAIHHGASALKIFPAGELGPGYIRALKAVLPTHIPLYAVGGIRPDNLADY
FT                   LNAGCIGAGLGSDLYRAGQTVNQTAKNAQAFIEAWNACKQQ"
FT   gene            complement(3745..5136)
FT                   /locus_tag="CKO_00005"
FT   CDS_pept        complement(3745..5136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00005"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2271 Sugar phosphate permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11184"
FT                   /db_xref="GOA:A8ACH1"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH1"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR000849"
FT                   /inference="protein motif:ScanRegExp:IPR000849"
FT                   /inference="similar to AA sequence:REFSEQ:NP_462686.1"
FT                   /protein_id="ABV11184.1"
FT                   /translation="MLNFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYLI
FT                   RKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVGKTLVSYYADGKNTKQFLPFMLIL
FT                   SAICMLGFSASMGSGSVSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGTFLGF
FT                   WNISHNLGGAGAAGVALFGANYLFDGHVIGMFIFPSIIALIVGFIGLRFGSDSPESYGL
FT                   GKAEELFGEEISEEDKETEENEMTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRIGIDQW
FT                   STVYAFQELKLSKEVAIQGFTLFEVGALVGTLLWGWLSDLANGRRALVACVALALIIAT
FT                   LGVYQHASNQYVYLASLFALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIG
FT                   DSFAKLGLGMIADGTPVFGLTGWAGTFAALDAAAISCICLMAMVAVLEERKIRREKKIQ
FT                   QLKVA"
FT   gene            complement(5281..6609)
FT                   /locus_tag="CKO_00006"
FT   CDS_pept        complement(5281..6609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00006"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2271 Sugar phosphate permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11185"
FT                   /db_xref="GOA:A8ACH2"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH2"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR000849"
FT                   /inference="protein motif:ScanRegExp:IPR000849"
FT                   /inference="similar to AA sequence:REFSEQ:NP_312631.1"
FT                   /protein_id="ABV11185.1"
FT                   /translation="MLTFLKAPANAPLITDKHEVDARYRYWRRQILLTIWLGYALFYFT
FT                   RKSFNAAVPEILVSGVLTRSDIGLLATLFYITYGLSKFVSGIVSDRSNARYFMGIGLIA
FT                   TGVVNILFGFSTSLWAFALLWALNAFFQGWGAPVCARLLTSWYSRNERGGWWAIWNTAH
FT                   NVGGALIPIVMAAAALHYGWRAGMMIAGTLAIIVGIFLCWRLRDRPQAIGLPAVGDWRH
FT                   DELEIAQQQEGAGLTRKEILTKYVLLNPYIWLLSLCYVLVYVVRAAINDWGNLYMSETL
FT                   GVDLVTANTAVTMFELGGFIGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMP
FT                   FASYVMQAACFFTTGFFVFGPQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLSGWP
FT                   LAQVMETWHWTGFFVVIAIAAGISALLLLPFLNAQAPREASIT"
FT   gene            complement(6619..8121)
FT                   /locus_tag="CKO_00007"
FT   CDS_pept        complement(6619..8121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3789 1.8e-253 uhpB; sensory histidine
FT                   kinase in two-component regulatory sytem with UhpA K07675;
FT                   COG: COG3851 Signal transduction histidine kinase,
FT                   glucose-6-phosphate specific; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11186"
FT                   /db_xref="GOA:A8ACH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH3"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMPfam:IPR011712"
FT                   /inference="protein motif:HMMPIR:IPR012053"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:SwissProt:P27668"
FT                   /protein_id="ABV11186.1"
FT                   /translation="MKTILSRLITVIACFFIFSAAWFCLWSISLHLVERPELAVLLFPF
FT                   GLRLGLMLQCPRSYWPVLLGAEWLLVWWLAQEVALAHLPLLMIGGLLTLLPVALISRYR
FT                   HQRDWRTLLLQGAALTAAALLQSLPWLGQGEETLNALLLTLTGGLTLAPICLVFWHYLT
FT                   STTWLPLGPALVSQPVNWRGRHLVWYLLLFTVSLWLQLGLPAELSRFTPFCLALPIIAL
FT                   AWHYGWQGALIATLMNAIALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLRELNQ
FT                   SLQNELARNHRLAERLLETEESVRRDVARELHDDIGQTITAIRTQAGIVQRLAADNGGV
FT                   KQSGAHIEQLSLGVYDAVRRLLGRLRPRQLDDLTLEQAIRSLMREMELESRGIISHLDW
FT                   RIDESALSESQRVTLFRVCQEGLNNIVKHANASAVTLQGWQQDERLMLVIEDDGSGLPP
FT                   DSGQQGFGLTGMRERVTALGGVLAISCTHGTRVSVSLPLRYV"
FT   gene            complement(8121..8792)
FT                   /locus_tag="CKO_00008"
FT   CDS_pept        complement(8121..8792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_C0116 2.7e-28 two component
FT                   transcriptional regulator, LuxR family; COG: COG2197
FT                   Response regulator containing a CheY-like receiver domain
FT                   and an HTH DNA-binding domain; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11187"
FT                   /db_xref="GOA:A8ACH4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH4"
FT                   /inference="protein motif:BlastProDom:IPR000792"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000792"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR000792"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:ScanRegExp:IPR000792"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00720490.1"
FT                   /protein_id="ABV11187.1"
FT                   /translation="MAGLQRLPPVGLISAAPSGTFKYQDRTMITIALIDDHLIVRSGFA
FT                   QLLGLEPDLQVVAEFGSGQEALAGLPGRGVQVCICDISMPDISGLELLSQLPKGMATIM
FT                   LSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVATGGCYLTPDIAVKLAAGRQD
FT                   PLTRRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLLEKLGVSNDVELARRMFDG
FT                   W"
FT   gene            complement(8879..9880)
FT                   /locus_tag="CKO_00009"
FT   CDS_pept        complement(8879..9880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmu:PM0508 9.9e-22
FT                   CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,
FT                   3-sialyltransferase K00785; COG: NOG15044 non supervised
FT                   orthologous group; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11188"
FT                   /db_xref="InterPro:IPR012477"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH5"
FT                   /inference="protein motif:HMMPfam:IPR012477"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00348216.1"
FT                   /protein_id="ABV11188.1"
FT                   /translation="MEIVEHLFIVCSPLQLRIVSKIKARYKHARFHIIYLKTKVELKSY
FT                   IYETVNNEFSSGLVASMDYGFINMLKINRFLSHKTIHYVYMANISHLSVQYILKMLSDD
FT                   VKIRTFDDGILSINSAGYLDKQIKLRKGPGRKLTRMWLGQHYNIRDIAKRSELHFSIVK
FT                   HKSKSRNVDCDIVYIDVLSEEKQRLHTERSAPVYAGEINVFVGSKFKDILDVKNDSNLI
FT                   ALIHKIETLAAHYPSLQYLRHPREYSQQVFGMTEITLNAISEDYICQLSSAYQRVNVFG
FT                   FASTCQLNVMKLENVYITLLKTTLIRPDIRDSFALFSDSDKVRICDLDSMEP"
FT   gene            complement(9884..10048)
FT                   /locus_tag="CKO_00010"
FT   CDS_pept        complement(9884..10048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11189"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH6"
FT                   /protein_id="ABV11189.1"
FT                   /translation="MTCLYYPVYELSYLQYRKYLFGQSDQYSPERLGRFFTMSYCNDIM
FT                   RRVAVIQSE"
FT   gene            complement(10132..10422)
FT                   /locus_tag="CKO_00011"
FT   CDS_pept        complement(10132..10422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3987 7.8e-45 ilvN; acetolactate
FT                   synthase small subunit K01653; COG: COG0440 Acetolactate
FT                   synthase, small (regulatory) subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11190"
FT                   /db_xref="GOA:A8ACH7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH7"
FT                   /inference="protein motif:BlastProDom:IPR004789"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="similar to AA sequence:INSD:AAV79439.1"
FT                   /protein_id="ABV11190.1"
FT                   /translation="MQKQSHENVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQ
FT                   SSDQSRIWLLVNDDQRLEQMISQIDKLEDVVKVARNQSDPSMFNKISVFFE"
FT   gene            complement(10426..12120)
FT                   /locus_tag="CKO_00013"
FT   CDS_pept        complement(10426..12120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c4596 1.6e-284 ilvB; acetolactate synthase
FT                   isozyme I large subunit K01652; COG: COG0028 Thiamine
FT                   pyrophosphate-requiring enzymes [acetolactate synthase,
FT                   pyruvate dehydrogenase (cytochrome), glyoxylate
FT                   carboligase, phosphonopyruvate decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11192"
FT                   /db_xref="GOA:A8ACH8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH8"
FT                   /inference="protein motif:HMMPfam:IPR011766"
FT                   /inference="protein motif:HMMPfam:IPR012000"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR000399"
FT                   /inference="protein motif:HMMPIR:IPR004407"
FT                   /inference="protein motif:HMMTigr:IPR012846"
FT                   /inference="protein motif:ScanRegExp:IPR000399"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00701697.1"
FT                   /protein_id="ABV11192.1"
FT                   /translation="MASSGTTSTSPRTRFTGAEFIVHFLERQGIKIVTGIPGGSILPVY
FT                   DALSQSTQIRHILARHEQGAGFIAQGMARTDGKPAVCMACSGPGATNLVTAIADARLDS
FT                   IPLVCITGQVPASMIGTDAFQEVDTYGISIPITKHNYLVRDINELPQVMCDAFRLAQSG
FT                   RPGPVWIDIPKDIQTAVFDIEALPAPAEKMAAPEFSAESIRDAAAMINAAKRPVLYLGG
FT                   GVINAPARVRELAEKARLPTTMTLMALGILPKAHPLSLGMLGMHGARSTNYILQEADLL
FT                   VVLGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPHI
FT                   EAQPREEWHQLVADLQREFPCAIPEASDPLSHYGLINAVAACVDDSAIITTDVGQHQMW
FT                   AAQAYPLNRPRQWLTSGGLGTMGFGLPAAIGAALANPDKKVLCFSGDGSLMMNIQEMAT
FT                   ASENQLDVKIILMNNEALGLVHQQQSLFYKQGVFAATYPGMINFMQIAAGFGLETCDLN
FT                   NEADPQAALREIISRPGPALIHVRIDADEKVYPMVPPGAANTEMVGE"
FT   gene            12104..12691
FT                   /locus_tag="CKO_00012"
FT   CDS_pept        12104..12691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11191"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACH9"
FT                   /protein_id="ABV11191.1"
FT                   /translation="MPELAMLQSFYSGPTCREGVLNEKPRPVCAGGVLESCVVPVPTAH
FT                   CRRPPPHARRPLRQVAQFLVGSQSAWKGSLGTLSVYGLTGFIQAQLFRHDNGKFFICTK
FT                   MRRRSRFARCRRWPAKQKTPPERGFYQRYAVGCRKAHCVISTSEVYAFREEHAISARIL
FT                   THLSMDQKSRSVHKILFIHTVFIYNITVRNVL"
FT   gene            complement(12839..13018)
FT                   /locus_tag="CKO_00014"
FT   CDS_pept        complement(12839..13018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00014"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11193"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI0"
FT                   /protein_id="ABV11193.1"
FT                   /translation="MDKHQADDERGAVARSPSVRLESELPEVFQNGIKQLQCSNNEFQD
FT                   KNSDIHEAHTLSFW"
FT   gene            13066..13899
FT                   /locus_tag="CKO_00015"
FT   CDS_pept        13066..13899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00015"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0697 Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11194"
FT                   /db_xref="GOA:A8ACI1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI1"
FT                   /inference="protein motif:HMMPfam:IPR000620"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218706.1"
FT                   /protein_id="ABV11194.1"
FT                   /translation="MTLSIFCILLFAALLHASWNAIVKAGNDKLYSAISVSGSAALMAL
FT                   ACLPFAPPLPAASIPFLAASTALQVVYTVLVAKTYQVSDMSQTYPLMRGTAPLLVAIIS
FT                   VLFLGDSLSTMAWLGIAVICLAILGMACNGRARSRRGITLALINACFIAGYTLVDGTGV
FT                   RVSETALGYTLWTFLLNGTCLLGWAMIARRREASRYLAQHWKKGIFGGIGTMGSYGLAL
FT                   WAMTQAPLAVVAALRETSILFGALIAWLLLNEKVAGLRLVAAGGIAAGAILLRLS"
FT   gene            13907..14044
FT                   /locus_tag="CKO_00016"
FT   CDS_pept        13907..14044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI2"
FT                   /protein_id="ABV11195.1"
FT                   /translation="MAATPYPAYGSRRAPSNCGKIISRQQLLPLFVYISCRSAPALFPP
FT                   "
FT   gene            14146..15330
FT                   /locus_tag="CKO_00017"
FT   CDS_pept        14146..15330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A1315 3.2e-05 putative acyltransferase
FT                   K00680; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11196"
FT                   /db_xref="GOA:A8ACI3"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI3"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR004734"
FT                   /inference="similar to AA sequence:INSD:CAD03195.1"
FT                   /protein_id="ABV11196.1"
FT                   /translation="MKRQRSVNLLLMLVLLVAVGQMAQTIYIPAIADMARELNVREGAV
FT                   QSVMAAYLLTYGVSQLFYGPLSDRVGRRPVILVGMSIFMLATLVAITTHSLTVLIAASA
FT                   LQGMGTGVGGVMARTLPRDLYEGTQLRHANSLLNMGILVSPLLAPLIGGLLDTVWNWRA
FT                   CYVFLLVLCAGVTFSMARWMPETRPAGAPRTRLIASYKTLFGNGAFTCYLLMLIGGLAG
FT                   IAVFEACSGVLMGAVLGLSSMVVSILFILPIPAAFFGAWFAGRPNKRFATLMWQSVFSC
FT                   LLAGVMMWVPGLFGVMNVWTLLIPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVG
FT                   GLQNIGSGVLAWLSAMLPQTGQGSLGFLMTLMGLLILLCWLPLASRVPHQGQTI"
FT   gene            complement(15257..16339)
FT                   /locus_tag="CKO_00018"
FT   CDS_pept        complement(15257..16339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr3367 3.7e-07 probable cellulase K01179;
FT                   COG: NOG14136 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11197"
FT                   /db_xref="GOA:A8ACI4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI4"
FT                   /inference="protein motif:Gene3D:IPR013781"
FT                   /inference="similar to AA sequence:INSD:ABP58712.1"
FT                   /protein_id="ABV11197.1"
FT                   /translation="MICLRTIVLKPLASLFLLVSATVCAAQPPLTASRYAQQLGVGMDV
FT                   DWARTERGIREFDPLVVRDFQAKGFKHVRIRVAGEPTEARLIHLRKLVEACEQYGVIPI
FT                   IAYQADEYKNDPSPGNEQEVINWWVAVAHYFAQRSPLLGFDLIYEPAEKLNHSQSSLNR
FT                   VYDKTIRTLHAIDPQRMIFVAPRLRAAPEALSALKLPPQSQNYVLAEWHIFPWGPLKNN
FT                   GKYPWTSGTAAEKAAIRARINAAARWQQKTGHASWVGGWAPGESIKNSPSASQLAFARF
FT                   MACELQRVNIPYAINADTQFYDGEEGAWRPALEPLLTTMISPVCEKPGGKPGHHSIKSS
FT                   APDAAHATPAAASTVKSAAP"
FT   gene            complement(16408..17427)
FT                   /locus_tag="CKO_00019"
FT   CDS_pept        complement(16408..17427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 0.00070 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11198"
FT                   /db_xref="GOA:A8ACI5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011781"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI5"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="protein motif:HMMTigr:IPR011781"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218709.1"
FT                   /protein_id="ABV11198.1"
FT                   /translation="MRYGSLRFIFTLIFQAHFFTLQSQKEVTEAAMEPLRDGRNRLLNG
FT                   WQLSKLYTFEVAARHQSFALAADELSLSPSAVSHRINQLEEELGIQLFVRSHRKVELTH
FT                   EGKRVFWALKSSLDTLNQEILDIKNQELSGTLTVYSRPSIAQCWLVPALGDFTRRYPSI
FT                   SLTMLTGNDNVNLQRAGIDLAIYFDDAPSAQLTHHFLMDEAILPVCSPEYARHHDLTNA
FT                   RVNLRHCTLLHDRQAWSNDSGTDEWHSWAQHFGVNLPTSSGIGFDRSDLAVIAAMNHIG
FT                   VAMGRKRLVQKRLDSGELIAPFGEMTLKCHQHYYVTTLPGRQWPKIEAFIGWLQEQAT"
FT   gene            17562..18899
FT                   /locus_tag="CKO_00020"
FT   CDS_pept        17562..18899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3106 3.8e-52 ygbN; hypothetical
FT                   permease YgbN K03299; COG: COG2610 H+/gluconate symporter
FT                   and related permeases; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11199"
FT                   /db_xref="GOA:A8ACI6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI6"
FT                   /inference="protein motif:HMMPfam:IPR003474"
FT                   /inference="protein motif:HMMTigr:IPR003474"
FT                   /inference="similar to AA sequence:INSD:AAL22661.1"
FT                   /protein_id="ABV11199.1"
FT                   /translation="MHSQIWVVSTLLVSIVLIVLTIVKFRFHPFLALLLASFFVGAMMG
FT                   MGPLEMVNAIESGIGGTLGFLAAVIGLGTILGKMMEVSGAAERIGLTLQRCRWLSADVI
FT                   MVLVGLICGITLFVEVGVVLLIPLAFSIAKKTNTSLLKLAIPLCTALMAVHCVVPPHPA
FT                   ALFVANKLGADIGSVIVYGLLVGLVASLVGGPLFLKFLGNRLPFKPVPAEFADLEVRDE
FT                   NTLPSLRATLFTVLLPIGLMLVKTVAELNMTQGGTLYTLLEFIGNPITAMFIAVFVAYY
FT                   ILGLRQHIGMGTLLTHTENGFGSIANILLIIGAGGAFNAILKSSGLADTLAVILSNMHM
FT                   HPILLAWLVALILHAAVGSATVAMMGATAIVAPMLPLYPNVSPEIIAIAIGSGAIGCTI
FT                   VTDSLFWLVKQYCGATLNETFKYYTTATFIASVVALAGTFLLSFII"
FT   gene            18917..20245
FT                   /locus_tag="CKO_00021"
FT   CDS_pept        18917..20245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z3628 6.2e-219 dsdA; D-serine dehydratase
FT                   (deaminase) K01753; COG: COG3048 D-serine dehydratase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11200"
FT                   /db_xref="GOA:A8ACI7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011780"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACI7"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR011780"
FT                   /inference="protein motif:ScanRegExp:IPR000634"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311272.1"
FT                   /protein_id="ABV11200.1"
FT                   /translation="MENAKMTSLIAQYPLVEDLIALKETTWFNPGTTSLAEGLPYVGLT
FT                   AQDVQDAHARLARFAPYLAKAFPETAATGGIIESELAIIPAMQQRLEKEYGQKISGELL
FT                   LKKDSHLPISGSIKARGGIYEVLAHAEKLALEAGLLTTEDDYSVMLSPEFRQFFSQYSI
FT                   AVGSTGNLGLSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEEDYGVAVEQ
FT                   GRKAAQSDPNCFFIDDENSRTLFLGYAVAGQRLKAQFAQQGRVVDADHPLFVYLPCGVG
FT                   GGPGGVAFGLKLAFGDNVHCFFAEPTHSPCMLLGVYTGLHDAISVQEIGVDNLTAADGL
FT                   AVGRASGFVGRAMERLLDGLYTLDDRTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVCR
FT                   STDYQQMHAFSAEQLNHATHLVWATGGGMVPEEEMAQYLAKGR"
FT   gene            complement(20258..21274)
FT                   /locus_tag="CKO_00022"
FT   CDS_pept        complement(20258..21274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syg:sync_2368 3.1e-16 arylsulfatase regulator;
FT                   COG: COG0641 Arylsulfatase regulator (Fe-S oxidoreductase);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11201"
FT                   /db_xref="GOA:A8ACI8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI8"
FT                   /inference="protein motif:HMMPfam:IPR007197"
FT                   /inference="similar to AA sequence:INSD:AAL19000.1"
FT                   /protein_id="ABV11201.1"
FT                   /translation="MDNATLEAFICQHIAAQPVDDVLFAWQGGEPTLCGLDFFHRVVAL
FT                   QKRYGEGKRIQNTFQTNGILLSDEWCRFLRDNGWLVGISLDGPADLHDAYRVSRSGKPT
FT                   HHKVVEAIARLVAHRVDFNLLVVVNRLNSQQPARMYRYLRQLGTPFLQFIPLVEHDDSD
FT                   KLTADSVTSEDWGHFLNDVFDLWVREDIGRVFVQLFDSMLGVWSGHPAQMCALSETCGH
FT                   AFALEANGDLYQCDHYVYPAFRLGNIHQTPLHMLNASPQASEFGQQKKSTLGADCLDCA
FT                   LLRFCNGDCPKHRDLSGKSVLCGGYKAFINHTSPHMRVMRDLIKQHRSPMELMAMLR"
FT   gene            complement(21367..21729)
FT                   /locus_tag="CKO_00023"
FT   CDS_pept        complement(21367..21729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00023"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09782 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11202"
FT                   /db_xref="GOA:A8ACI9"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACI9"
FT                   /inference="similar to AA sequence:INSD:AAL22664.1"
FT                   /protein_id="ABV11202.1"
FT                   /translation="MPDSRKARRQVDPGLQPERTSLAWFRTLLGYGALMALALKHNWHQ
FT                   AGFLFWVSIGVLAIVALILWRYTRSRNLMDVAHSDFSESRAVRDKFLISLAVLSLAILF
FT                   AVTHIRQLIVFIRDVA"
FT   gene            complement(21719..22066)
FT                   /locus_tag="CKO_00024"
FT   CDS_pept        complement(21719..22066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:orf19.201 5.6e-06 CDC47; DNA helicase and
FT                   DNA replication licensing factor K02210; COG: COG2149
FT                   Predicted membrane protein; Psort location:
FT                   CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11203"
FT                   /db_xref="GOA:A8ACJ0"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ0"
FT                   /inference="protein motif:HMMPfam:IPR003807"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152762.1"
FT                   /protein_id="ABV11203.1"
FT                   /translation="MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPD
FT                   FATPVIRELLALLLCLFAGGLAIYGYLRWLRNEKAMRLKEDLPYTHSLMIISLMLMIVA
FT                   VIVMALVLYAG"
FT   gene            complement(22175..23668)
FT                   /locus_tag="CKO_00025"
FT   CDS_pept        complement(22175..23668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW3654 1.3e-264 yidJ; predicted
FT                   sulfatase/phosphatase; COG: COG3119 Arylsulfatase A and
FT                   related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11204"
FT                   /db_xref="GOA:A8ACJ1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ1"
FT                   /inference="protein motif:HMMPfam:IPR000917"
FT                   /inference="protein motif:ScanRegExp:IPR000917"
FT                   /inference="similar to AA sequence:SwissProt:P31447"
FT                   /protein_id="ABV11204.1"
FT                   /translation="MTRPNFLFIMTDTQATNMVGCYSGKPLNTQHIDSLAAEGIRFNSA
FT                   YTCSPVCTPARAGLFTGIYANQSGPWTNNVAPGKNISTMGRYFKDAGYHTCYIGKWHLD
FT                   GHDYFGTGECPPEWDADYWYDGANYLSELTENEISLWRNGLNSIEDLQTNNIDETFTWA
FT                   YRISNRAVDFLHQPARDDEPFLMVVSYDEPHHPFTCPVEYLEKYQDFYYDLGAKAQDSL
FT                   SNKPEHHRLWAQAMPSPVGDDGCYHHPLYFACNDFVDDQIGRVINALTPEQRENTWVIY
FT                   TSDHGEMMGAHKLISKGAAMYDDITRIPLIMRPPQGAPQQIDTPVSHIDLLPTMMALAG
FT                   IDKPDILPGENILAVEAPRGVMVEFNRYEIEHDSFGGFIPVRCWVTDNWKLVLNLFTSD
FT                   ELYDRRNDPDELHNLIAAPEFAGVRSQMHDALLDYMDKIRDPFRTYQWILRPWRKDARP
FT                   RWMGAFRPRPQDGYSPVVRDYDTGLPTQGVKVEEKKQKF"
FT   gene            complement(23665..25401)
FT                   /locus_tag="CKO_00026"
FT   CDS_pept        complement(23665..25401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00026"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4146 Predicted symporter; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11205"
FT                   /db_xref="GOA:A8ACJ2"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ2"
FT                   /inference="protein motif:HMMPanther:IPR001734"
FT                   /inference="protein motif:HMMPfam:IPR001734"
FT                   /inference="protein motif:HMMTigr:IPR001734"
FT                   /inference="similar to AA sequence:INSD:AAN83037.1"
FT                   /protein_id="ABV11205.1"
FT                   /translation="MKNKGYEMNTLQILSFVGFTLLVAVITWWKLRKADTGSQQGYFLA
FT                   GRSLKAPVIAASLMLTNLSTEQLVGLTGQAYRSGMSVMAWEVISAIPLIFLALIFLPRY
FT                   LQRGIATIPDFIEERYDKTTRIIIDCCFLIATGICFLPIILYSGALAFNSMFHVTETFG
FT                   ISQHTAIWLMAVVLGISGILYAVVGGMRAIAIADVINGIGLVIGGLMVPLFGLMAMGKG
FT                   SLSEGITRLTQDHSQMLNSIGGSNDPVPIGAALTGLILVNTFYWCTNQGIVQRTLASKS
FT                   LSEGQKGALLTAVLKMLDPLILVLPGVIAFHLFQDLPKADMAYPALVNKVMPLPLIGFF
FT                   SAVLFGAIISAFCGFLNSASTLFSLGIYRRLINEQASPDKLVTVGRRFGFIVAVISVLV
FT                   APWIAYAPQGLYSWMKQLNGIYNVPLVTIVIMGFFFPRIPALAAKVAMGLGIVSYITIN
FT                   YLVKFDFHFLYVLACTFCINVVVMLLIGVIKPRATPFKFHDAFAVDMKPWKNVKIAAVG
FT                   VLFAMIGVYSGLAQFGGYQTRWLTILSYAITAAVVVYLIYSSWQTRHSAPVVYVSDAKD
FT                   KA"
FT   gene            25440..26441
FT                   /locus_tag="CKO_00027"
FT   CDS_pept        25440..26441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0394 1.2e-07 adaA;
FT                   methylphosphotriester-DNA alkyltransferase (AraC/XylS
FT                   family) K00567; COG: COG2207 AraC-type DNA-binding
FT                   domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11206"
FT                   /db_xref="GOA:A8ACJ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ3"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR003313"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:BAE77613.1"
FT                   /protein_id="ABV11206.1"
FT                   /translation="MPGQAVRFLNYKHRLPEAFTFCYVQVVGIILRRENKMNGNLLSSH
FT                   VKNETTYNIPLLINENVISSGISLISLWHTYADENYRVIWPRDKKKPLIANSWVAVYTV
FT                   QGCGKILLKAGEQITLNGNCIIFLKPTDIQSYHCEGLLWEQYWMEFTPTSIMDIPIRQQ
FT                   SIIYNGDVYNQELAEVSQLITRPEPIKNNLAVAFLTKIIYQWICLIDSNGKKDPQRIQV
FT                   EKLIAALHASLQRRWSVADMAATIPCSEAWLRRLFLRYTGKTPKEYYLDARLELALSLL
FT                   KQEGNTVGQVADMLNFFDSFHFSKAFKHKFGYAPSAVLKHPDRHPLDAGQQD"
FT   gene            complement(26438..27760)
FT                   /locus_tag="CKO_00028"
FT   CDS_pept        complement(26438..27760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_4168 2.9e-221 putative
FT                   6-phospho-beta-glucosidase K01222; COG: COG1486
FT                   Alpha-galactosidases/6-phospho-beta-glucosidases, family 4
FT                   of glycosyl hydrolases; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11207"
FT                   /db_xref="GOA:A8ACJ4"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ4"
FT                   /inference="protein motif:BlastProDom:IPR001088"
FT                   /inference="protein motif:FPrintScan:IPR001088"
FT                   /inference="protein motif:HMMPfam:IPR001088"
FT                   /inference="protein motif:ScanRegExp:IPR001088"
FT                   /inference="similar to AA sequence:SwissProt:Q9AGA6"
FT                   /protein_id="ABV11207.1"
FT                   /translation="MKKFSVVIAGGGSTFTPGIVLMLLANQDRFPLRALKFYDNDGARQ
FT                   EVIAEACKIILKEQAPEIEFSYTTDPEAAFTDVDFVMAHIRVGKYPMREKDEKIPLRHG
FT                   VLGQETCGPGGIAYGMRSIGGVLELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNA
FT                   KILNICDMPIGIEGRMAQIVGLQDRKQMRVRYYGLNHFGWWTSIEDLQGNDLMPKLREY
FT                   VAKHGYVPPSNDPHTEASWNDTFAKAKDVQALDPDTMPNTYLKYYLFPDYVVQHSNPAR
FT                   TRANEVMDHREKQVFGSCRAIIEAGHSSAGELEIDEHASYIVDLATAIAFNTQERMLLI
FT                   VPNNGAIHNFDDEAMVEIPCLVGHNGPESLTVGDIPQFQKGLMSQQVAVEKLVVDAWEH
FT                   RSYQRLWQAITLSKTVPSASVAKAILDDLIEANKEYWPELH"
FT   gene            complement(27757..29499)
FT                   /locus_tag="CKO_00029"
FT   CDS_pept        complement(27757..29499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_3634 3.5e-248 glvC; phosphotransferase
FT                   system enzyme IIBC component K02749:K02750; COG: COG1263
FT                   Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11208"
FT                   /db_xref="GOA:A8ACJ5"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010975"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ5"
FT                   /inference="protein motif:HMMPfam:IPR001996"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:HMMTigr:IPR004719"
FT                   /inference="protein motif:HMMTigr:IPR010975"
FT                   /inference="protein motif:HMMTigr:IPR011535"
FT                   /inference="protein motif:ScanRegExp:IPR001996"
FT                   /inference="similar to AA sequence:INSD:ABR79469.1"
FT                   /protein_id="ABV11208.1"
FT                   /translation="MRSRIEAALHVLRIATTYSRIRPAITTKKASPYWLLYEDVKMLSQ
FT                   IQRFGGAMFTPVLLFPFAGIVVGIAIMLRNPLFVGEALTDPNSLFAQIVHIIEEGGWTV
FT                   FRNMPLIFAVGLPIGLAKQAQGRACLAVLVSFLTWNYFINAMGMTWGHFFGVDFSVDPT
FT                   AGSGLTMMAGIKTLDTSIIGAIMISGIVTALHNRYFDKPLPVFLGIFQGTSFVVIIAFL
FT                   VMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYTFLERILIPTGLHHFVYGPFI
FT                   FGPAAVEGGIQVYWAQHMQAFSQSTESLKTLFPEGGFALHGNSKIFGSVGIALALYYTA
FT                   SPENRVKVAGLLIPATLTAVLVGITEPLEFTFLFISPLLFAVHAVLAASMATVMYICGV
FT                   VGNMGGGLLDQFLPQNWIPMFHNHAGMMFTQIGIGLAFTALYFVVFRTLILRFNLKTPG
FT                   REESEIRLYSKADYKAARGQTTAPAPDAKLGQAAGFLQALGGAGNIESINNCATRLRIA
FT                   LHDMAQTQSDDVFKALGAHGVVRRGNGIQVIVGLHVPQVRDQLETLMKSPLSTEQIPMT
FT                   EAVS"
FT   gene            29599..30321
FT                   /locus_tag="CKO_00030"
FT   CDS_pept        29599..30321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_3183 7.5e-24 transcriptional
FT                   regulator, GntR family; COG: COG2188 Transcriptional
FT                   regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11209"
FT                   /db_xref="GOA:A8ACJ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ6"
FT                   /inference="protein motif:FPrintScan:IPR000524"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR011663"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:INSD:ABR79470.1"
FT                   /protein_id="ABV11209.1"
FT                   /translation="MIYKSIAERLRIRLNSSDYNIGSPLPGEKKLAEEFAVSRMTIRKA
FT                   VDMLVGWGLVVRRHGSGTYVARKDVHHETTNLTGLAEVLRRQGKEVTSQVLVFEVMPAP
FT                   PAIASQLRIQINERIYFSRRVRYVDGKPLMLEDSYMPVRLFRNLSLIHLEGSKFDYIEK
FT                   ECGITISGNYESLTPVLADKQLSAQMNVPEQTPLLRITSLSYSDSGEFLNYSVMFRNAS
FT                   EYQVDYHLRRVHPDANLT"
FT   gene            complement(30318..31979)
FT                   /locus_tag="CKO_00031"
FT   CDS_pept        complement(30318..31979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00031"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2985 Predicted permease; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11210"
FT                   /db_xref="GOA:A8ACJ7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACJ7"
FT                   /inference="protein motif:HMMPfam:IPR006037"
FT                   /inference="protein motif:HMMPfam:IPR006512"
FT                   /inference="protein motif:HMMTigr:IPR006512"
FT                   /inference="similar to AA sequence:REFSEQ:NP_807346.1"
FT                   /protein_id="ABV11210.1"
FT                   /translation="MSDIALTVSVLALVAVVGLWIGNIKVRGVGFGIGGVLFGGIIVGH
FT                   FVDQAGMTLSSDMLHFIQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFAILIVIIG
FT                   GLVTAILHKIFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGTPMEAVDQMGMSYAMA
FT                   YPFGICGILLTMWLMRMIFRVNVEAEAKQHEDTLSNGHSLIQTMNIRVENPNLNNMAIQ
FT                   DVPILNSDKIICSRLKRDETLMVPSPGTIIQSGDLLHLVGQPVDLHNAQLVIGQEVDTS
FT                   LSTRGTDLRVERVVVTNEKVLGKRIRDLHFKERYDVVISRLNRAGVELVASSDASLQFG
FT                   DILNLVGRPSSIDAVANVVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFVPGFPVALK
FT                   LGLAGGPLIMALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFIDTL
FT                   TQGDGLSWIGYGIFITAIPLITVGLLARIFAKMNYLTLCGMLAGSMTDPPALAFANNLH
FT                   ATSGAAALSYATVYPLVMFLRIITPQLLAVLFWGLG"
FT   gene            32047..32217
FT                   /locus_tag="CKO_00032"
FT   CDS_pept        32047..32217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11211"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACJ8"
FT                   /protein_id="ABV11211.1"
FT                   /translation="MVKHKNAPSLLAGRFVEKHDAGPTGSASLCRPGKHSAPGDLPDGG
FT                   YALSGLQVVLD"
FT   gene            complement(32214..32642)
FT                   /locus_tag="CKO_00033"
FT   CDS_pept        complement(32214..32642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00033"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0071 Molecular chaperone (small heat shock
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11212"
FT                   /db_xref="GOA:A8ACJ9"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACJ9"
FT                   /inference="protein motif:HMMPfam:IPR002068"
FT                   /inference="protein motif:superfamily:IPR008978"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZL03"
FT                   /protein_id="ABV11212.1"
FT                   /translation="MRNYDLSPLLRQWIGFDKLANALQNTGESQSFPPYNIEKSDDNHY
FT                   RITLALAGFRQEDLDIQLEGTRLTVKGTPAQPEKEIKWLHQGLVTQPFSLSFTLAENME
FT                   VSGATFTNGLLHIDLTRNEPETIAPQRIAISERPALNS"
FT   gene            complement(32755..33168)
FT                   /locus_tag="CKO_00034"
FT   CDS_pept        complement(32755..33168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00034"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0071 Molecular chaperone (small heat shock
FT                   protein); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11213"
FT                   /db_xref="GOA:A8ACK0"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACK0"
FT                   /inference="protein motif:HMMPfam:IPR002068"
FT                   /inference="protein motif:superfamily:IPR008978"
FT                   /inference="similar to AA sequence:INSD:AAO71204.1"
FT                   /protein_id="ABV11213.1"
FT                   /translation="MRNFDLSPLYRSAIGFDRLFNLLENNQSQSNGGYPPYNVELVDEN
FT                   HYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAEN
FT                   IHVRGANLVNGLLYIDLERVIPEANKPRRIEIN"
FT   gene            33213..33371
FT                   /locus_tag="CKO_00035"
FT   CDS_pept        33213..33371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11214"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK1"
FT                   /protein_id="ABV11214.1"
FT                   /translation="MDRSGSQNTHQACSLFAYTLKMGLEMNFSSACRGLFLQFVVYRID
FT                   WVNSTHC"
FT   gene            complement(33429..33566)
FT                   /locus_tag="CKO_00037"
FT   CDS_pept        complement(33429..33566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11216"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK2"
FT                   /protein_id="ABV11216.1"
FT                   /translation="MPPVCDITLEQPPSKTNPLHIISVNNTFFIMIYSSVDYRCLHDEL
FT                   "
FT   gene            33475..33807
FT                   /locus_tag="CKO_00036"
FT   CDS_pept        33475..33807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aci:ACIAD3598 0.0040 putative glucose
FT                   dehydrogenase precursor K00120; COG: COG5645 Predicted
FT                   periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11215"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK3"
FT                   /inference="protein motif:HMMPfam:IPR010780"
FT                   /inference="similar to AA sequence:INSD:CAD03184.1"
FT                   /protein_id="ABV11215.1"
FT                   /translation="MIKNVLLTLMMCSGLVLLGGCSSVMSHTGGKEGTYPGTRASAEMI
FT                   GSSDTNWGTKSLAILDMPFTAVMDTILLPWDFFRTDSSVKSRVEKSEEKTKMTNAVIPP
FT                   ARMPAH"
FT   gene            complement(33809..35077)
FT                   /locus_tag="CKO_00038"
FT   CDS_pept        complement(33809..35077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4240 9.5e-191 yidR; hypothetical
FT                   protein YidR; COG: NOG06296 non supervised orthologous
FT                   group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11217"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK4"
FT                   /inference="protein motif:superfamily:IPR011042"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152767.1"
FT                   /protein_id="ABV11217.1"
FT                   /translation="MLYPDAKTAHQGISMKQITFASRHHQLTNTNTWTADSQWLVFDVR
FT                   PSGASFTGETIERVNVRTGEIEVIYRATQGAHVGVVTVHPQDDRYVFIHGPENPDETWH
FT                   YDFHHRRGVIAAQNRVTNLDAMDITVPYTPGALRGGSHVHVFSPNGERVSFTYNDHVLR
FT                   ERDPALDLRNVGVAVPYGPVTVAVQHPREYSGSHWCVLVSQTTPAPRPGSDDINRAYEE
FT                   GWVGDHALAFIGDTLSAKGEKVPELFLVALPQDEKGWKQAGDMPLTGTESTLPAPPAGV
FT                   VQRRLTFTHDRVFPGLVNVPRHWVRSNPQATDIAFLMRDDRGIVQLWLIPAQGGEPRQL
FT                   THNATDIQSAFNWHPSGRWLGFVLENRIACCDAQSGAIAFLTASHDSPPSADAVVFSPD
FT                   GALIAWMEEVDGFRQLWVTETER"
FT   gene            35371..36249
FT                   /locus_tag="CKO_00039"
FT   CDS_pept        35371..36249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00039"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3016 Uncharacterized iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11218"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="InterPro:IPR016773"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK5"
FT                   /inference="protein motif:HMMPfam:IPR007314"
FT                   /inference="similar to AA sequence:INSD:AAK67301.1"
FT                   /protein_id="ABV11218.1"
FT                   /translation="MRKKIILTSLIALASLSLSSCSQPASINQNKPLQTACVSDGQIVD
FT                   LKSNKTITKQELLAELAVARQLIIGEKHDNAGHHQIELWLIQNLPTRRPQGSVLLEMLT
FT                   ADQQPRVNQVKRWLKDDPVVRDGRIQELLNWQKGWPWEMYGDIVMQALRAPYPLLNANI
FT                   DRDRVMALYKKNEFPEGKKSTAPAVQEALRETIIAMHEGNIEGQQLASMLSVQQQRDRY
FT                   MARQLLDAPAPSLLIAGGYHASKSIGVPLHIEDLAPGTQPVVLMLAEKGMNITVDHADY
FT                   VWFVTPDTAKR"
FT   gene            36257..37045
FT                   /locus_tag="CKO_00040"
FT   CDS_pept        36257..37045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00040"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0810 Periplasmic protein TonB, links inner
FT                   and outer membranes; Psort location: CytoplasmicMembrane,
FT                   score:8.02"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11219"
FT                   /db_xref="GOA:A8ACK6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK6"
FT                   /inference="protein motif:HMMTigr:IPR006260"
FT                   /inference="similar to AA sequence:REFSEQ:YP_406307.1"
FT                   /protein_id="ABV11219.1"
FT                   /translation="MMNILYLPRPAKWSGWFICSLLLHGLLFLAFVWRFSDVQPATPPA
FT                   PAIMLQWADNIEAPSSPLPLPVGIAQQESAAAEEKQQAEDRQQRPVTEDRDATIEITRK
FT                   KKASDGEKKKPRPPRKIKDQTSDSSHAAVSSNAAPQAPVESSRIAAPFNSDSAKRDNSG
FT                   ASWESRVKGHLNRYKRYPGDARKRARTGTAIVTFTVNAQGTVVSNSLATSSGTLSLDRE
FT                   AVAVLERAQPLPRPPAEILEGGFFKVKMPITFDLTELREN"
FT   gene            37210..39471
FT                   /locus_tag="CKO_00041"
FT   CDS_pept        37210..39471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00041"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1629 Outer membrane receptor proteins,
FT                   mostly Fe transport; Psort location: OuterMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11220"
FT                   /db_xref="GOA:A8ACK7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK7"
FT                   /inference="protein motif:HMMPfam:IPR000531"
FT                   /inference="protein motif:HMMPfam:IPR012910"
FT                   /protein_id="ABV11220.1"
FT                   /translation="MNIIKLAIGSGILLLNCGAYAQSISEKTGTDKKGAAEFSPLNVSI
FT                   GKTTSEQEALEKTGATSSRTTDKNLQSLDATLRSMPGTYTQIDLGQGAVSVNIRGMSGF
FT                   GRVNTMVDGITQSFYGSSTSGTTAHGSTNNMAGVLIDPNFLVAVDVTRGDSSGPAGVNA
FT                   LAGSANMRTIGVDDVIFNGNTYGLRSRFSVGSNGLGRSGMIAVGGKTDAFTDTGSVGVM
FT                   AAVSGSSVYSNFSNGSGINSKEFGYDKYMKQNPKSQLYKMDIRPDEFNSFELSARTYEN
FT                   KFTRRDITSDDYYIKYHYTPFSELIDFNVTASTSRGNQKYRDGSLYTFYKTSAQNRSDA
FT                   LDINNTSRFTIADNDLEFMLGSKLMRTRYDRTIHSAAGDPKANQEAIENNPFAPSGQQD
FT                   ISALYTGLKVTRGIWEADFNLNYTRNRITGYKPACDSRVICVPQGSYDIDDKEDGFNPS
FT                   VQLSAQVTPWLQPFIGYSKSMRAPNIQEMFFSNSGGASMNPFLKPERAETWQAGFNIDT
FT                   RDLLVEQDALRFKALAYRSRIQNYIYSESYLVCSGGRKCSMAEVIGNDWEGMSDEYSDN
FT                   MYIYVNSASDVIAKGFELEMDYDAGFAFGRLSFSQQQTDQPTSIASTYFGAGDMTELPR
FT                   KYMTLDTGVRFFDNALTLGTIIKYTGKARRLSPDFEQDEHTGAIIKQDLPQIPTIIDLY
FT                   GTYEYNRNLTLKLSVQNLMNRDYSEALNKLNMMPGLGDETHPANSARGRTWIFGGDIRF
FT                   "
FT   gene            complement(39380..39610)
FT                   /locus_tag="CKO_00043"
FT   CDS_pept        complement(39380..39610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11222"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK8"
FT                   /inference="similar to AA sequence:INSD:ABB68952.1"
FT                   /protein_id="ABV11222.1"
FT                   /translation="MAIVGKNSEINRYSGALDKVKIFIFRSCNKIDIREKTYCLNLAEI
FT                   VIRNECPRQISMFCHARNWLGGSRHQDLASC"
FT   gene            39471..40715
FT                   /locus_tag="CKO_00042"
FT   CDS_pept        39471..40715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00042"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3391 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11221"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACK9"
FT                   /inference="protein motif:superfamily:IPR011044"
FT                   /inference="similar to AA sequence:INSD:ABE10606.1"
FT                   /protein_id="ABV11221.1"
FT                   /translation="MTISARFRQYVFSLMSILLQERKMNIFTLSKAPLYLLISLFLPTM
FT                   AMAIDPPERELSRFALKTNYLQSPDEGVYELAFDNASKKVFAAVTDRVNREANKGYLYS
FT                   FNSDSLKVENKYTMPYRAFSLAINQDKHQLYIGHTQSASLRISMFDTSTGKLVRTSDRL
FT                   SFKAANAADSRFEHLRHMVYSQDSDTLFVSYSNMLKTAEGMKPLHKLLMLDGTTLALKG
FT                   EVKDAYKGTAYGLTMDEKTQKIYVGGRDYINEIDAKNQTLLRTIPLKDPRPQITSVQNL
FT                   AVDSASDRAFVVVFDHDDRSGTKDGLYIFDLRDGKQLGYVHTGAGANAVKYNPKYNELY
FT                   VTNFTSGTISVVDATKYSITREFNMPVYPNQMVLSDDMDTLYIGIKEGFNRDWDPDVFV
FT                   EGAKERILSIDLNKS"
FT   gene            complement(40829..41641)
FT                   /locus_tag="CKO_00044"
FT   CDS_pept        complement(40829..41641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4247 4.7e-134 yidA; hypothetical
FT                   protein; COG: COG0561 Predicted hydrolases of the HAD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11223"
FT                   /db_xref="GOA:A8ACL0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACL0"
FT                   /inference="protein motif:HMMPfam:IPR013200"
FT                   /inference="protein motif:HMMTigr:IPR000150"
FT                   /inference="protein motif:HMMTigr:IPR006379"
FT                   /inference="protein motif:ScanRegExp:IPR000150"
FT                   /inference="similar to AA sequence:INSD:AAX67655.1"
FT                   /protein_id="ABV11223.1"
FT                   /translation="MAIKLIAIDMDGTLLLPDHTISPAVKTAIAAARARGVNVVLTTGR
FT                   PYAGVHSYLKELHMEQPGDYCITYNGALVQKAGDGSTVAQTALSYDDYRFLEKLSREVG
FT                   SHFHALDRNTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPATQFLKVMMIDEPVIL
FT                   DQAIARIPAEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADALGIKPEEIMAIGDQE
FT                   NDIAMIEYAGMGVAMDNAIPSVKEVANFVTKSNLEDGVAYAIEKFVLN"
FT   gene            complement(41853..44267)
FT                   /locus_tag="CKO_00045"
FT   CDS_pept        complement(41853..44267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3753 0. gyrB; DNA gyrase, subunit B
FT                   (type II topoisomerase) K02470; COG: COG0187 Type IIA
FT                   topoisomerase (DNA gyrase/topo II, topoisomerase IV), B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11224"
FT                   /db_xref="GOA:A8ACL1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACL1"
FT                   /inference="protein motif:BlastProDom:IPR011558"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:Gene3D:IPR013506"
FT                   /inference="protein motif:Gene3D:IPR013759"
FT                   /inference="protein motif:HMMPfam:IPR002288"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR006171"
FT                   /inference="protein motif:HMMPfam:IPR013506"
FT                   /inference="protein motif:HMMSmart:IPR001241"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMTigr:IPR011557"
FT                   /inference="protein motif:ScanRegExp:IPR001241"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR013760"
FT                   /protein_id="ABV11224.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCKDIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSQKLELVIQRDNKIHRQIYEHGVPQAPLAVTGETDKT
FT                   GTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLKDKRDGKEDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVEQQMNELLSEYLLENPSDAKIVVGKIIDAARAREAARRAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIALDGATLHTNASAPALA
FT                   GEALEKLVSDYNATQKMIGRMERRFPKALLKELVYQPTLTEADLSNEQAVTRWVNALIT
FT                   ELNEKEQHGSQWKFDVRENAEQQQFEPIVRVRTHGVDTDYPLDHEFVTGGEYRRICTLG
FT                   EKLRGLIEDDAFIERGERRQPVASFEQALEWLVKESRRGLAIQRYKGLGEMNPDQLWET
FT                   TMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   gene            complement(44296..45369)
FT                   /locus_tag="CKO_00046"
FT   CDS_pept        complement(44296..45369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00046"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0003 4.9e-68 recF; DNA replication,
FT                   recombinaison and repair protein; COG: COG1195
FT                   Recombinational DNA repair ATPase (RecF pathway); Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11225"
FT                   /db_xref="GOA:A8ACL2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACL2"
FT                   /inference="protein motif:HMMPfam:IPR003395"
FT                   /inference="protein motif:HMMTigr:IPR001238"
FT                   /inference="protein motif:ScanRegExp:IPR001238"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218741.1"
FT                   /protein_id="ABV11225.1"
FT                   /translation="MSLTRLLIRDFRNIENADLALSPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQIGRVIRHEQESFVLHGRLQGEERETAIGLTKDKLGDSKVRIDGTDGHK
FT                   VAELAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEVGFFTAWSNLKRLLKQRNA
FT                   ALRQVSRYEQLRPWDKELIPLAEQISTWRAEYSAGIAQDMADTCQQFLPEFSLTFSFQR
FT                   GWEKETDYAEVLERSFERDRMLTYTAHGPHKADFRIRADGAPVEDTLSRGQLKLLMCAL
FT                   RLAQGEFLTRESGRRCLYLIDDFASELDDARRGLLASRLKATQSQVFVSAISAEHVLDM
FT                   SDKNSKMFTVEKGKITD"
FT   gene            complement(45369..46469)
FT                   /locus_tag="CKO_00047"
FT   CDS_pept        complement(45369..46469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_3902 1.6e-186 DNA polymerase III, beta
FT                   chain K02338; COG: COG0592 DNA polymerase sliding clamp
FT                   subunit (PCNA homolog); Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11226"
FT                   /db_xref="GOA:A8ACL3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACL3"
FT                   /inference="protein motif:Gene3D:IPR001001"
FT                   /inference="protein motif:HMMPfam:IPR001001"
FT                   /inference="protein motif:HMMSmart:IPR001001"
FT                   /inference="protein motif:HMMTigr:IPR001001"
FT                   /inference="similar to AA sequence:INSD:EAY47664.1"
FT                   /protein_id="ABV11226.1"
FT                   /translation="MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT
FT                   GTDLEMEMVARVALIQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPVGQSLPNHSVIVPRKGVIELMRMLDGGETPLRVQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDILKQAFARAAILSNEKFRGV
FT                   RLYVSENQLKITANNPEQEEAEEILDVTYGGTEMEIGFNVSYVLDVLNALKCETVRILL
FT                   TDSVSSVQIEDAASQSAAYVVMPMRL"
FT   gene            complement(46474..47808)
FT                   /locus_tag="CKO_00048"
FT   CDS_pept        complement(46474..47808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0009 2.5e-183 chromosomal
FT                   replication initiator protein DnaA K00972; COG: COG0593
FT                   ATPase involved in DNA replication initiation; Psort
FT                   location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11227"
FT                   /db_xref="GOA:A8ACL4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACL4"
FT                   /inference="protein motif:FPrintScan:IPR001957"
FT                   /inference="protein motif:HMMPfam:IPR013159"
FT                   /inference="protein motif:HMMPfam:IPR013317"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMSmart:IPR013159"
FT                   /inference="protein motif:HMMTigr:IPR001957"
FT                   /inference="protein motif:ScanRegExp:IPR001957"
FT                   /inference="protein motif:superfamily:IPR010921"
FT                   /inference="similar to AA sequence:INSD:AAV79474.1"
FT                   /protein_id="ABV11227.1"
FT                   /translation="MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNNFCG
FT                   ADAPQLRFEVGTKPVTQTLKTPVNNVVAPAQVAQAQPQRAVPAAARPGWDNVPAPAEPT
FT                   YRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVG
FT                   NGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKER
FT                   SQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVA
FT                   ILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREAL
FT                   RDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSVARPRQMAMALAKELTNHSL
FT                   PEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   gene            complement(48137..48283)
FT                   /locus_tag="CKO_00049"
FT   CDS_pept        complement(48137..48283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11228"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACL5"
FT                   /protein_id="ABV11228.1"
FT                   /translation="MGIVQRVEDYTDCRAKRKDRTGSLLDRLCSIASLLINFFNMRAKS
FT                   CST"
FT   gene            48644..49003
FT                   /locus_tag="CKO_00050"
FT   CDS_pept        48644..49003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00050"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3939 1.3e-58 rnpA; RNase P, protein
FT                   component K03536; COG: COG0594 RNase P protein component;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11229"
FT                   /db_xref="GOA:A8ACL6"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACL6"
FT                   /inference="protein motif:BlastProDom:IPR000100"
FT                   /inference="protein motif:HMMPfam:IPR000100"
FT                   /inference="protein motif:HMMTigr:IPR000100"
FT                   /inference="protein motif:ScanRegExp:IPR000100"
FT                   /inference="similar to AA sequence:INSD:AAV79476.1"
FT                   /protein_id="ABV11229.1"
FT                   /translation="MVKLAFPRELRLLTPSHFTFVFQQPQRAGTPQITILGRLNSLGHP
FT                   RIGLTVAKKNVRRAHERNRIKRLTRESFRLRQHELPAMDFVVVAKKGVADLDNRALSEA
FT                   LEKLWRRHCRLARGS"
FT   gene            49227..50873
FT                   /locus_tag="CKO_00051"
FT   CDS_pept        49227..50873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00051"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0706 Preprotein translocase subunit YidC;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11230"
FT                   /db_xref="GOA:A8ACL7"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACL7"
FT                   /inference="protein motif:HMMPfam:IPR001708"
FT                   /inference="similar to AA sequence:INSD:AAL22701.1"
FT                   /protein_id="ABV11230.1"
FT                   /translation="MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQTQQTTQTTTTAAG
FT                   SAADQGVPASGQGKLITVKTDVLDLTINTRGGDVEQALLPTYPKELGSKEPFQLLETTP
FT                   QFIYQAQSGLTGRDGPDNPANGPRPLYSVDNDTFVLADGQNELHVPMTWTDAAGNTFTK
FT                   TFVLKRGEYAVNVNYSVQNAGEKPLEISTFGQLKQSINLPSHRDTGSSNFALHTFRGAA
FT                   YSTPDEKYEKYKFDTIADNENLNVSSNGGWVAMLQQYFATAWIPRNDGTNNFYTANLGN
FT                   GIAAIGYKSQPVLVQPGQTGAMTSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPL
FT                   FKLLKWIHSFLGNWGFSIIVITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGD
FT                   DKQRQSQEMMALYKAEKVNPLGGCFPLIIQMPIFLALYYMLMGSIELRHAPFALWIHDL
FT                   SAQDPYYILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYY
FT                   IVSNLVTIIQQQLIYRGLEKRGLHSREKKSS"
FT   gene            50939..52339
FT                   /locus_tag="CKO_00052"
FT   CDS_pept        50939..52339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0103 7.4e-120 predicted GTPase
FT                   K01529; COG: COG0486 Predicted GTPase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11231"
FT                   /db_xref="GOA:A8ACL8"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACL8"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMTigr:IPR004520"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218747.1"
FT                   /protein_id="ABV11231.1"
FT                   /translation="MTAFFISKKEKIMSHNDTIVAQATPPGRGGVGILRISGLKAREVA
FT                   EAVLGKLPKPRYADYLPFKDADGTALDQGIALWFPGPNSFTGEDVLELQGHGGPVILDL
FT                   LLKRILTLPGLRIARPGEFSERAFLNDKLDLAQAEAIADLIDASSEQAARSALNSLQGA
FT                   FSARVNHLVEALTHLRIYVEAAIDFPDEEIDFLSDGKIEAQLNGVIADLDAVRAEARQG
FT                   SLLREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHII
FT                   DTAGLRDASDEVERIGIERAWQEIEQADRVLFMVDGTTTDAVDPAEIWPDFIARLPAKL
FT                   PITVVRNKADITGETLGISEVNGHSLVRLSARTGEGVDVLRNHLKQSMGFDTNMEGGFL
FT                   ARRRHLQALAEAAEHLQQGKSQLLGAWAGELLAEELRLAQQALSEITGEFTSDDLLGRI
FT                   FSSFCIGK"
FT   gene            52329..52523
FT                   /locus_tag="CKO_00053"
FT   CDS_pept        52329..52523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11232"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACL9"
FT                   /protein_id="ABV11232.1"
FT                   /translation="MASDVVLPGGATFTGPTKSVGRIRQSRHPAIINFLTGNHRCPNGN
FT                   SRHRKAPRILSATLIVRTL"
FT   gene            52520..53692
FT                   /locus_tag="CKO_00054"
FT   CDS_pept        52520..53692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_1692 3.0e-05 Xaa-His dipeptidase
FT                   K01270; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11233"
FT                   /db_xref="GOA:A8ACM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023697"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACM0"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:INSD:ABG71881.1"
FT                   /protein_id="ABV11233.1"
FT                   /translation="MTRFLICSFALVLLYPAGIDMYLVGLPRIAADLNASEAQLHIAFS
FT                   VYLAGMATAMLFAGKVADQSGRKPVAIAGAVIFIIASMLCSRATDGSLFLTGRFIQGIG
FT                   AGCCYVVAFAILRDTLDDRRRAKVLSLLNGITCIVPVLAPVLGHLIMLKFPWQSLFYTM
FT                   IAMGIAVCLLSVFILKETRPATCSSTSRPQQNAESLLNRFFLSRLAITTLSVSVILTFV
FT                   NTSPVLLMEMMGFDRGEYATTMALTAGISMAVSFSTPFALSVFKPRTLMLTSQGLFLAA
FT                   GIVLSLSSSHAVTLFGLTLICAGFSVGFGVAMSQALGPFSLRAGVASSVLGIAQVCGSS
FT                   LWIWLAAVIGFNALNMLIGILIGCSMVCILLLMTIQPAAHYEKIHHQSRS"
FT   gene            53661..54620
FT                   /locus_tag="CKO_00055"
FT   CDS_pept        53661..54620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00055"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0583 Transcriptional regulator; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11234"
FT                   /db_xref="GOA:A8ACM1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR023746"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACM1"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:SwissProt:Q5PKV5"
FT                   /protein_id="ABV11234.1"
FT                   /translation="MKKSITSLDLNLLLCLQLLMQERSVTKAAKRMNVTPSAVSKSLSK
FT                   LRTWFDDPLFVNTPLGLTPTPLMVNMEQSLADWMQMSNQLLDKPHHESPRGLKFELAAE
FT                   SPLVMIMFNSLSQQIYQRYPQATIKVRNWDYDSLDAITRGEVDLGFTGRESHPRSRELL
FT                   SLLPLSIDFEVLFSDLPWVWLREDHPALQEEWNLETFLRYPHISICWEQSDTWALDDVL
FT                   QEMGRKRNIALSLPGFEQSLFMAAQPNHSLLATAPLYCQRYNQLHQLPLVARPLPFDAA
FT                   QREKLMVPFTLLWHKRNSHNPKIIWLKETIKTLYSHLS"
FT   gene            54915..55520
FT                   /locus_tag="CKO_00056"
FT   CDS_pept        54915..55520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY4228 0.00075 4'-phosphopantetheinyl
FT                   transferase K06133; COG: COG2091 Phosphopantetheinyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11235"
FT                   /db_xref="GOA:A8ACM2"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM2"
FT                   /inference="protein motif:superfamily:IPR008278"
FT                   /inference="similar to AA sequence:REFSEQ:NP_458097.1"
FT                   /protein_id="ABV11235.1"
FT                   /translation="MFMLYGTSELPEIAIQAKGKPVFRDKNLPAFSISYAGNMVGVALT
FT                   TEGECGLDMELQRAMRGFHSPLSAESPAFSSNENLWINNQSDPNEARAQLITLRQSVLK
FT                   LTGDVLNDDPRELQLLPGAGRLKCAHVTQVEAICDAEDILVWSVAVTPAIEKLNVWEFD
FT                   SKQGWKSLADIQTRANEPTGRLMRFAQLSTAKSSYTLS"
FT   gene            55561..56127
FT                   /locus_tag="CKO_00057"
FT   CDS_pept        55561..56127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4266 8.3e-89 yieF; hypothetical
FT                   protein; COG: COG0431 Predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11236"
FT                   /db_xref="GOA:A8ACM3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM3"
FT                   /inference="protein motif:HMMPfam:IPR005025"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152795.1"
FT                   /protein_id="ABV11236.1"
FT                   /translation="MSETLNVVTLLGSLRKGSFNGMVARTLPKIAPAGMEVSALPSIGD
FT                   IPLYDADVQQEEGFPASVEALAEQIRKADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQ
FT                   PLAGKPVLIQTSSMGAIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEV
FT                   VDQSTIDHLTGQLTAFGDYIQRVKA"
FT   gene            complement(56109..56252)
FT                   /locus_tag="CKO_00058"
FT   CDS_pept        complement(56109..56252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11237"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM4"
FT                   /protein_id="ABV11237.1"
FT                   /translation="MPLIRRCARCPGLISVAPSGKFDSRMAAKRLIRPAALRARCYHAL
FT                   TR"
FT   gene            complement(56253..57590)
FT                   /locus_tag="CKO_00059"
FT   CDS_pept        complement(56253..57590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0244 2.4e-89 guanine-hypoxanthine
FT                   permease; xanthine/uracil permease family protein K06901;
FT                   COG: COG2252 Permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11238"
FT                   /db_xref="GOA:A8ACM5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM5"
FT                   /inference="protein motif:HMMPfam:IPR006043"
FT                   /inference="protein motif:ScanRegExp:IPR013055"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152796.1"
FT                   /protein_id="ABV11238.1"
FT                   /translation="MSQQHTTQTSGQGMLERVFKLREHGTTARTEVIAGFTTFLTMVYI
FT                   VFVNPQILGVAGMDTSAVFVTTCLIAAFGSILMGLFANLPVALAPAMGLNAFFAFVVVG
FT                   AMGLSWQVGMGAIFWGAIGLLLLTIFRVRYWMIANIPVSLRVGITSGIGLFIGMMGLKN
FT                   AGVIVANPETLVSIGNLTSHSVLLGVLGFFIIAILASRNIHAAVLVSIIVTTLLGWMMG
FT                   DVHYNGIVSAPPSVSSVIGHVDLAGSFNIGLAGVIFSFMLVNLFDSSGTLIGVTDKAGL
FT                   ADEKGKFPRMKQALFVDSVSSVTGAFIGTSSVTAYIESSSGVSVGGRTGLTAVVVGLLF
FT                   LLVIFLSPLAGMVPGYAAAGALIYVGVLMTSSLARVKWQDLTESVPAFITAVMMPFSFS
FT                   ITEGIALGFISYCVMKIGTGRLRELSPCVVVVALLFVLKIVFIDAH"
FT   gene            57755..58420
FT                   /locus_tag="CKO_00060"
FT   CDS_pept        57755..58420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b3715 2.7e-99 yieH; predicted hydrolase
FT                   K01112; COG: COG0637 Predicted
FT                   phosphatase/phosphohexomutase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11239"
FT                   /db_xref="GOA:A8ACM6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM6"
FT                   /inference="protein motif:FPrintScan:IPR005833"
FT                   /inference="protein motif:HMMPfam:IPR005834"
FT                   /inference="protein motif:HMMTigr:IPR006402"
FT                   /inference="protein motif:HMMTigr:IPR006439"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001178846.1"
FT                   /protein_id="ABV11239.1"
FT                   /translation="MSQIQAVFFDCDGTLVDSEVICSRAYVAMFQEFGITLDLEEVFKR
FT                   FKGVKLYEIIDIINEEQGVSLAKADLEPVYRAEVARLFDSELEVIAGANALLDSMTVPM
FT                   CVVSNGPVSKMQHSLGKLGMLHHFPEKLFSGYDIQRWKPDPALMFHAAKAMNVNVENCI
FT                   LVDDSSAGARSGIDAGMEVFYFCADPHNKPIDHPKVTTFTDLAQLPGLWKARGWNIVD"
FT   gene            complement(58542..59267)
FT                   /locus_tag="CKO_00061"
FT   CDS_pept        complement(58542..59267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00061"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0704 Phosphate uptake regulator; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11240"
FT                   /db_xref="GOA:A8ACM7"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM7"
FT                   /inference="protein motif:HMMPfam:IPR008170"
FT                   /inference="protein motif:HMMTigr:IPR008170"
FT                   /inference="similar to AA sequence:SwissProt:O32488"
FT                   /protein_id="ABV11240.1"
FT                   /translation="MDNLNLNKHISGQFNAELESIRTQVMTMGGMVEQQLSDAITAMHN
FT                   QDSELAKRVIDGDKHVNMMEVAIDEACVRIIAKRQPTASDLRLVMAIIKTIAELERIGD
FT                   VADKICRTALEKFSHQHQPLLVSLESLGRHTVQMLHDVLDAFARMDIDEAVRIYREDKK
FT                   VDQEYEGIVRQLMTYMMEDSRTIPSVLTALFCARSIERIGDRCQNICEYIFYFVKGQDF
FT                   RHVGGDELDKLLAGKDPKE"
FT   gene            complement(59281..60054)
FT                   /locus_tag="CKO_00062"
FT   CDS_pept        complement(59281..60054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t3669 1.4e-134 pstB; phosphate transport
FT                   ATP-binding protein K02036; COG: COG1117 ABC-type phosphate
FT                   transport system, ATPase component; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11241"
FT                   /db_xref="GOA:A8ACM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM8"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPanther:IPR005670"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005670"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001178844.1"
FT                   /protein_id="ABV11241.1"
FT                   /translation="MSMVDTAPGKIQVRDLNFYYGKFHALKDINLDIAKNQVTAFIGPS
FT                   GCGKSTLLRTFNKMYSLYPEQRAEGEILLDGDNILTNTQDIALLRAKVGMVFQKPTPFP
FT                   MSIYDNIAFGVRLFEKLSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLC
FT                   IARGIAIRPEVLLLDEPCSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHT
FT                   AFMYLGELIEFSNTDDLFTKPAKKQTEDYITGRYG"
FT   gene            complement(60165..61055)
FT                   /locus_tag="CKO_00063"
FT   CDS_pept        complement(60165..61055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll0739 7.8e-06 modBC; ABC-type molybdate
FT                   transport system permease/ATP-binding protein K02018; COG:
FT                   COG0581 ABC-type phosphate transport system, permease
FT                   component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11242"
FT                   /db_xref="GOA:A8ACM9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACM9"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005672"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01700843.1"
FT                   /protein_id="ABV11242.1"
FT                   /translation="MATLEMQTTAELAESRRKMQAKRRTRNRIALTLSMATMAFGLFWL
FT                   IWILMSTITRGFDGMSLALFTEMTPPPNTAGGGLANALAGSGLLILWATVFGTPLGIMA
FT                   GIYLAEYGRKSWLAEVIRFINDILLSAPSIVVGLFVYTIVVAQMEHFSGWAGVIALALL
FT                   QVPIVIRTTENMLKLVPDSLREAAYALGTPKWKMISAITLKASISGIITGVLLAVARIA
FT                   GETAPLLFTALSNQFWSTDMMQPIANLPVTIFKFAMSPFAEWQQLAWAGVLIITLCVLL
FT                   LNILARIIFAKSKHG"
FT   gene            complement(61055..62014)
FT                   /locus_tag="CKO_00064"
FT   CDS_pept        complement(61055..62014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyb:CYB_0398 1.9e-05 modB; molybdate ABC
FT                   transporter, permease protein K02018; COG: COG0573 ABC-type
FT                   phosphate transport system, permease component; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11243"
FT                   /db_xref="GOA:A8ACN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACN0"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR011864"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152801.1"
FT                   /protein_id="ABV11243.1"
FT                   /translation="MAATKPAFNPPGKKGDMIFSALVKLAALIVLLMLGGIIVSLIISS
FT                   WPSIEKFGFSFLWTKEWDAPNDIYGALVPIYGTLVTSFIALLIAVPVSFGIALFLTELA
FT                   PGWLRRPLGIAIELLAAIPSIVYGMWGLFIFAPLFATWFQEPVGNILSNIPFVGALFSG
FT                   PAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPF
FT                   TKNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSVSLYMPGNSITSALANEFAEAESG
FT                   LHVAALMELGLILFVITFIVLAISKLMIMRLAKNEGAR"
FT   gene            complement(62159..63229)
FT                   /locus_tag="CKO_00065"
FT   CDS_pept        complement(62159..63229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mst:Msp_0343 3.4e-08 pstS; PstS K02040; COG:
FT                   COG0226 ABC-type phosphate transport system, periplasmic
FT                   component; Psort location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11244"
FT                   /db_xref="GOA:A8ACN1"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACN1"
FT                   /inference="protein motif:HMMPfam:IPR006059"
FT                   /inference="protein motif:HMMTigr:IPR005673"
FT                   /inference="similar to AA sequence:REFSEQ:NP_462756.1"
FT                   /protein_id="ABV11244.1"
FT                   /translation="MIYENLAGDIMKVMRTTVATVVAATLSMSAFSAFAAASLTGAGAT
FT                   FPAPVYAKWADTYQKETGSKVNYQGIGSSGGVKQITANTVDFGASDAPLSDEKLEQEGL
FT                   FQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAITKLNPGLKLPSQ
FT                   NIAVVRRADGSGTSFVFTSYLAKVNEEWKSKVGAGSTVNWPTGLGGKGNDGIAAFVQRL
FT                   PGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEESFANAAKGADWSTSFAQDLTNQQG
FT                   DDAWPITSTTFILVHKEQKKPEQGAEVLKFFDWAYKNGGKQANDLDYASLPDSVVEQVR
FT                   AAWKTNVKDSSGKALY"
FT   gene            complement(63519..65348)
FT                   /locus_tag="CKO_00066"
FT   CDS_pept        complement(63519..65348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_3890 0. glmS;
FT                   L-glutamine:D-fructose-6-phosphate aminotransferase K00820;
FT                   COG: COG0449 Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11245"
FT                   /db_xref="GOA:A8ACN2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACN2"
FT                   /inference="protein motif:HMMPfam:IPR000583"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005855"
FT                   /inference="protein motif:ScanRegExp:IPR000583"
FT                   /protein_id="ABV11245.1"
FT                   /translation="MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTR
FT                   LRRLGKVQMLAQAAEDHPLSGGTGIAHTRWATHGEPSEANAHPHVSDHIVVVHNGIIEN
FT                   HEPLREELKARGYTFVSETDTEVIAHLVHWELEQGGTLREAVMRAIPQLRGAYGTVIMD
FT                   TRHPDTLLAARSGSPLVIGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEVTRRSVSI
FT                   FDKSGAEVKRQDIESSLQYDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGEVDLSE
FT                   LGPKANELLSQVEHIQIIACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRR
FT                   NSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLAMMTNAGTEIG
FT                   VASTKAFTTQLTVLLMLVAKLARLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEAL
FT                   AEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPV
FT                   IVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIF
FT                   YTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE"
FT   gene            complement(65713..67083)
FT                   /locus_tag="CKO_00067"
FT   CDS_pept        complement(65713..67083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c4655 8.6e-229 glmU;
FT                   glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase K04042:K00972;
FT                   COG: COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains); Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11246"
FT                   /db_xref="GOA:A8ACN3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACN3"
FT                   /inference="protein motif:HMMPfam:IPR001228"
FT                   /inference="protein motif:HMMTigr:IPR005882"
FT                   /inference="protein motif:ScanRegExp:IPR001451"
FT                   /inference="protein motif:superfamily:IPR011004"
FT                   /inference="similar to AA sequence:INSD:AAN83087.1"
FT                   /protein_id="ABV11246.1"
FT                   /translation="MLNSAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANE
FT                   LGASQVHLVYGHGGDLLKNTLKNDNLNWVLQAEQLGTGHAMQQAAPFFSDDEDILMLYG
FT                   DVPLISVETLQRLRDAKPQGGIGLLTVKLDDPSGYGRITRENGKVTGIVEHKDATDEQR
FT                   QIQEINTGILIANGADMKRWLAKLTNNNAQGEYYITDIIALAYQEGREIAAVHPDRLSE
FT                   VEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPARFDLRGALTHGRDVEIDTNVIIK
FT                   GNVTLGHRVKIGAGCVIKNSVIGDDCDISPYSVVEDAHLEAACTIGPFARLRPGAELRE
FT                   GAHVGNFVEMKKARLGKGSKAGHLSYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGD
FT                   DVFVGSDTQLVAPVTVGKGATIAAGTTVTRDVADNELVLSRVPQVHKQGWQRPAKKK"
FT   gene            67307..67468
FT                   /locus_tag="CKO_00068"
FT   CDS_pept        67307..67468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11247"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACN4"
FT                   /protein_id="ABV11247.1"
FT                   /translation="MNKDETARNNIQAKKNQPDFRLVLMLSSRCYIAFLVNSITRSLAI
FT                   ALASSADA"
FT   gene            complement(67396..67815)
FT                   /locus_tag="CKO_00069"
FT   CDS_pept        complement(67396..67815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA3703 3.1e-66 atpC; ATP synthase epsilon
FT                   subunit K02114; COG: COG0355 F0F1-type ATP synthase,
FT                   epsilon subunit (mitochondrial delta subunit); Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11248"
FT                   /db_xref="GOA:A8ACN5"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACN5"
FT                   /inference="protein motif:BlastProDom:IPR001469"
FT                   /inference="protein motif:Gene3D:IPR001469"
FT                   /inference="protein motif:HMMPanther:IPR001469"
FT                   /inference="protein motif:HMMPfam:IPR001469"
FT                   /inference="protein motif:HMMTigr:IPR001469"
FT                   /inference="protein motif:superfamily:IPR001469"
FT                   /inference="similar to AA sequence:INSD:ABP62786.1"
FT                   /protein_id="ABV11248.1"
FT                   /translation="MAMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTA
FT                   IKPGMIRIVKQFGHEEFIYLSGGILEVQPGSVTVLADTAIRGQDLDEARALEAKRKAEE
FT                   RIKSSHGDVDYAQASAELAKAIAKLRVIELTKKAM"
FT   gene            complement(67836..69218)
FT                   /locus_tag="CKO_00070"
FT   CDS_pept        complement(67836..69218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3777 1.5e-240 atpD; membrane-bound ATP
FT                   synthase, F1 sector, beta-subunit K02112; COG: COG0055
FT                   F0F1-type ATP synthase, beta subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11249"
FT                   /db_xref="GOA:A8ACN6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACN6"
FT                   /inference="protein motif:HMMPfam:IPR000194"
FT                   /inference="protein motif:HMMPfam:IPR000793"
FT                   /inference="protein motif:HMMPfam:IPR004100"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005722"
FT                   /inference="protein motif:ScanRegExp:IPR000194"
FT                   /inference="protein motif:superfamily:IPR004100"
FT                   /inference="similar to AA sequence:INSD:AAL22723.1"
FT                   /protein_id="ABV11249.1"
FT                   /translation="MATGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNEHLVLEVQQ
FT                   QLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGE
FT                   EERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQR
FT                   FLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIDEAVEKAK
FT                   KL"
FT   gene            complement(69245..70108)
FT                   /locus_tag="CKO_00071"
FT   CDS_pept        complement(69245..70108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3866 4.0e-144 atpG; membrane-bound ATP
FT                   synthase, F1 sector, gamma-subunit K02115; COG: COG0224
FT                   F0F1-type ATP synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11250"
FT                   /db_xref="GOA:A8ACN7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACN7"
FT                   /inference="protein motif:HMMPanther:IPR000131"
FT                   /inference="protein motif:HMMPfam:IPR000131"
FT                   /inference="protein motif:HMMTigr:IPR000131"
FT                   /inference="protein motif:ScanRegExp:IPR000131"
FT                   /inference="protein motif:superfamily:IPR000131"
FT                   /inference="similar to AA sequence:SwissProt:Q57HX8"
FT                   /protein_id="ABV11250.1"
FT                   /translation="MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQDRMAASRPY
FT                   ADTMRKVIGHLANGNLEYKHPYLEERDVKRVGYLVVSTDRGLCGGLNINLFKKLLADMK
FT                   AWSDKGVQCDLAMIGSKGVSFFSSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEG
FT                   RLDKLYIVSNKFINTMSQVPTITQLLPLPASEDDELKRKTWDYLYEPDPKALLDTLLRR
FT                   YVESQVYQGVVENLASEQAARMVSMKAATDNGGSLIKELQLVYNKARQASITQELTEIV
FT                   GGASAV"
FT   gene            complement(70159..71700)
FT                   /locus_tag="CKO_00073"
FT   CDS_pept        complement(70159..71700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_3933 5.7e-264 ATP synthase alpha chain
FT                   K02111; COG: COG0056 F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11252"
FT                   /db_xref="GOA:A8ACN8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACN8"
FT                   /inference="protein motif:HMMPanther:IPR005294"
FT                   /inference="protein motif:HMMPfam:IPR000194"
FT                   /inference="protein motif:HMMPfam:IPR000793"
FT                   /inference="protein motif:HMMPfam:IPR004100"
FT                   /inference="protein motif:HMMTigr:IPR005294"
FT                   /inference="protein motif:ScanRegExp:IPR000194"
FT                   /inference="protein motif:superfamily:IPR000793"
FT                   /inference="protein motif:superfamily:IPR004100"
FT                   /inference="similar to AA sequence:INSD:ABB63932.1"
FT                   /protein_id="ABV11252.1"
FT                   /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLA
FT                   DCMQGEMISLPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLL
FT                   GRVVNTLGAPIDGKGPVEHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQ
FT                   RELIIGDRQTGKTALAIDAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALQNTI
FT                   VVVATASESAALQYLAPYAGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPP
FT                   GREAFPGDVFYLHSRLLERAARVNVEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETNLFNSGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQ
FT                   YRELAAFSQFASDLDDATRKQLDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLAD
FT                   VELAKIGSFEAALLAYVDRDHAPLMQEINQSGGYNDEIEGKLKGILDSFKATQSW"
FT   gene            70249..71847
FT                   /locus_tag="CKO_00072"
FT   CDS_pept        70249..71847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00072"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11251"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACN9"
FT                   /inference="similar to AA sequence:INSD:AAN83093.1"
FT                   /protein_id="ABV11251.1"
FT                   /translation="MHQRSVITVDVSQQSGFEATDFRQFYIRQITTFCREQNQRLLRNG
FT                   HRRILFLFQQFSHFLTVVKLFTGCIVKVRCKLGERCQFTILRQRGTDTTGQFLHDLGLR
FT                   CTTNTGYGDTRVNRRTNTRVKQVGFQEDLTIGNRNYVGRNERRNVTRLGFDNRQRSQRT
FT                   GFPFHFTFSEGFNVFNVNTRSTLQQTRVEVEYVARECFTSWRTTEQQGDLTISNSLFGQ
FT                   VIVDDQRIFAAVAEVFAHCATGIRRQVLQCGRFRCGGNHNDGILQRAVFFQLTNHVRDG
FT                   GRFLADSHVDALDAGITLVDDGVDCQSGFTGLTVTDDQFTLTTTDWDHGVNGFITRLNW
FT                   LINGLTFDYARRDSFNSREAVVLNRTFTVDWRAQGVNHTAQQATANRNFQDTASTFNLH
FT                   AFGKVSVRPHHNRTYRVALQVQCDSVTVTRQGDHFTLHTIGQAVNADNTVTYRNNSTFV
FT                   VSFTHNIELSNALLDQFADFGGIQLHAPVPLRLQDVCKAFKTAAYAAINDHITRSDDNA
FT                   CHYRLIDFAIQLNFA"
FT   gene            complement(71713..72246)
FT                   /locus_tag="CKO_00075"
FT   CDS_pept        complement(71713..72246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3780 2.0e-85 atpH; membrane-bound ATP
FT                   synthase, F1 sector, delta-subunit K02113; COG: COG0712
FT                   F0F1-type ATP synthase, delta subunit (mitochondrial
FT                   oligomycin sensitivity protein); Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11254"
FT                   /db_xref="GOA:A8ACP0"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACP0"
FT                   /inference="protein motif:Gene3D:IPR000711"
FT                   /inference="protein motif:HMMPanther:IPR000711"
FT                   /inference="protein motif:HMMPfam:IPR000711"
FT                   /inference="protein motif:HMMTigr:IPR000711"
FT                   /inference="protein motif:ScanRegExp:IPR000711"
FT                   /inference="protein motif:superfamily:IPR000711"
FT                   /inference="similar to AA sequence:INSD:AAV79499.1"
FT                   /protein_id="ABV11254.1"
FT                   /translation="MSEFVTVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMA
FT                   ELLSGALAPETLAESFIAVCGEQLDENGQNLIRVMAENNRLNALPDVLEQFIHLRAASE
FT                   STSEVEVTSATALSEEQLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGS
FT                   VRGRLERLADVLQS"
FT   gene            71953..72480
FT                   /locus_tag="CKO_00074"
FT   CDS_pept        71953..72480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11253"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACP1"
FT                   /inference="similar to AA sequence:INSD:ABE09717.1"
FT                   /protein_id="ABV11253.1"
FT                   /translation="MNKLLQNIRERVQTIIFSHHPNQVLTVFVQLLTADCDKRLSERFR
FT                   RQRAREKLCHLFVLGYLGGKRQHVLPALYTLVFDGKVKSCFGVGASYRNKFRHQPLPPY
FT                   SSATSLSTMSLLAASSTERSMIFSAPATARIATCLRSSSRARLRSASISACAWATILVR
FT                   SCSASVLASSRI"
FT   gene            complement(72261..72731)
FT                   /locus_tag="CKO_00076"
FT   CDS_pept        complement(72261..72731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3909 2.2e-72 atpF; ATP synthase subunit
FT                   B K02109; COG: COG0711 F0F1-type ATP synthase, subunit b;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11255"
FT                   /db_xref="GOA:A8ACP2"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACP2"
FT                   /inference="protein motif:HMMPfam:IPR002146"
FT                   /inference="protein motif:HMMTigr:IPR005864"
FT                   /inference="similar to AA sequence:INSD:AAV79500.1"
FT                   /protein_id="ABV11255.1"
FT                   /translation="MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLA
FT                   SAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRAQILDEAKTEAEQERTKIVAQ
FT                   AQAEIDAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL"
FT   gene            complement(72791..73030)
FT                   /locus_tag="CKO_00077"
FT   CDS_pept        complement(72791..73030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z5235 1.0e-35 atpE; membrane-bound ATP
FT                   synthase, F0 sector, subunit c K02110; COG: COG0636
FT                   F0F1-type ATP synthase, subunit c/Archaeal/vacuolar-type
FT                   H+-ATPase, subunit K; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11256"
FT                   /db_xref="GOA:A8ACP3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACP3"
FT                   /inference="protein motif:Gene3D:IPR002379"
FT                   /inference="protein motif:HMMPfam:IPR002379"
FT                   /inference="protein motif:HMMTigr:IPR005953"
FT                   /inference="protein motif:ScanRegExp:IPR000454"
FT                   /inference="protein motif:superfamily:IPR002379"
FT                   /inference="similar to AA sequence:INSD:ABE09719.1"
FT                   /protein_id="ABV11256.1"
FT                   /translation="MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDL
FT                   IPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA"
FT   gene            complement(73078..73893)
FT                   /locus_tag="CKO_00078"
FT   CDS_pept        complement(73078..73893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs4680 1.4e-139 membrane-bound ATP
FT                   synthase subunit a AtpB K02108; COG: COG0356 F0F1-type ATP
FT                   synthase, subunit a; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11257"
FT                   /db_xref="GOA:A8ACP4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACP4"
FT                   /inference="protein motif:FPrintScan:IPR000568"
FT                   /inference="protein motif:Gene3D:IPR000568"
FT                   /inference="protein motif:HMMPanther:IPR000568"
FT                   /inference="protein motif:HMMPfam:IPR000568"
FT                   /inference="protein motif:HMMTigr:IPR000568"
FT                   /inference="protein motif:ScanRegExp:IPR000568"
FT                   /inference="protein motif:superfamily:IPR000568"
FT                   /inference="similar to AA sequence:INSD:ABP62779.1"
FT                   /protein_id="ABV11257.1"
FT                   /translation="MASENMTPQDYIGHHLNNLQLDLRTFSLVDPHNPPATFWTLNIDS
FT                   MFFSVVLGLLFLLMFRSVAKKATSGVPGKFQTAIELVIGFVHGSVKDMYHGKSKLIAPL
FT                   ALTIFVWVFLMNLMDLLPIDLLPYIGEHIFGLPALRVVPSADVNITLSMALGVFILILF
FT                   YSIKMKGIGGFTKELTLQPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIF
FT                   ILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMGLTIVYLSMASEEH"
FT   gene            complement(73902..74282)
FT                   /locus_tag="CKO_00079"
FT   CDS_pept        complement(73902..74282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_5214 2.0e-07 atpI; ATP synthase F0,
FT                   I subunit K02116; COG: COG3312 F0F1-type ATP synthase,
FT                   subunit I; Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11258"
FT                   /db_xref="GOA:A8ACP5"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACP5"
FT                   /inference="protein motif:HMMPfam:IPR005598"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152815.1"
FT                   /protein_id="ABV11258.1"
FT                   /translation="MSVSLLSRNVARKLLFIQLLAVIASGLLFSLKDPFWGASALCGGL
FT                   AVLLPNMLFMIFAWRHQAHTPAKGRVAWSFAFGEAFKVLAMLVLLVVALAVFKAVFLPL
FT                   IVTWVLVLVVQILAPAVINNKG"
FT   gene            complement(74898..75521)
FT                   /locus_tag="CKO_00080"
FT   CDS_pept        complement(74898..75521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z5240 5.1e-96 gidB; glucose-inhibited
FT                   division; chromosome replication? K03501; COG: COG0357
FT                   Predicted S-adenosylmethionine-dependent methyltransferase
FT                   involved in bacterial cell division; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11259"
FT                   /db_xref="GOA:A8ACP6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACP6"
FT                   /inference="protein motif:BlastProDom:IPR003682"
FT                   /inference="protein motif:HMMPfam:IPR003682"
FT                   /inference="protein motif:HMMTigr:IPR003682"
FT                   /inference="similar to AA sequence:INSD:ABE09722.1"
FT                   /protein_id="ABV11259.1"
FT                   /translation="MLNKLSRLLDEAGISLTDHQKNQLIAYVDMLHKWNKAYNLTSVRD
FT                   PNEMLVRHILDSIVMAPHLQGERFIDVGTGPGLPGIPLSIVRPESHFTLLDSLGKRVRF
FT                   LRQVQHELKLENITPVQSRVEEFPSEPPFDGVISRAFASLDDMLSWCRHLPGENGRFYA
FT                   LKGQLPEEEIASLPAAFSVESVVKLRVPQLEGERHLVVIKPNKI"
FT   gene            complement(75624..77513)
FT                   /locus_tag="CKO_00081"
FT   CDS_pept        complement(75624..77513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hpa:HPAG1_0214 2.8e-152 glucose inhibited
FT                   division protein A; COG: COG0445 NAD/FAD-utilizing enzyme
FT                   apparently involved in cell division; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11260"
FT                   /db_xref="GOA:A8ACP7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACP7"
FT                   /inference="protein motif:BlastProDom:IPR002218"
FT                   /inference="protein motif:HMMPanther:IPR002218"
FT                   /inference="protein motif:HMMPfam:IPR002218"
FT                   /inference="protein motif:HMMTigr:IPR004416"
FT                   /inference="protein motif:ScanRegExp:IPR002218"
FT                   /protein_id="ABV11260.1"
FT                   /translation="MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQM
FT                   SCNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLY
FT                   RQAVRTALENQPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKI
FT                   HIGLDNYSSGRAGDPPSIPLSRRLRELPLRVSRLKTGTPPRIDARTIDFSVLAQQHGDN
FT                   PMPVFSFMGNASQHPQQVPCYITHTNEKTHDVIRNNLDRSPMYAGVIEGIGPRYCPSIE
FT                   DKVMRFADRNQHQIFLEPEGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPG
FT                   YAIEYDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKE
FT                   GWAPARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEMGRELGLV
FT                   DDERWARFNEKLENIERERQRLKSTWVTPSAESAGEVNAHLTAPLSREASGEDLLRRPE
FT                   MTYAQLTSLTPFAPGLDDAQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDY
FT                   RQVSGLSNEVIAKLNDHKPVSIGQASRISGVTPAAISILLVWLKKQGMLRRSA"
FT   gene            complement(77886..78335)
FT                   /locus_tag="CKO_00082"
FT   CDS_pept        complement(77886..78335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sab:SAB2494c 7.1e-15 cysJ; sulfite reductase
FT                   flavoprotein K00380; COG: COG0716 Flavodoxins"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11261"
FT                   /db_xref="GOA:A8ACP8"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACP8"
FT                   /inference="protein motif:HMMPfam:IPR008254"
FT                   /inference="similar to AA sequence:INSD:ABG71912.1"
FT                   /protein_id="ABV11261.1"
FT                   /translation="MADITLISGSTLGGAEYVAEHLAEKLEDAGFSTETLHGPLLEDLS
FT                   ASGTWLVISSTHGAGDIPDNLAPFYEALQSQNPDLSQVRFGAIGIGSREYDTFCGAIDK
FT                   IEAALKTSGAKPIGETLKINILEHDIPEDPAEVWLGSWINLLKIV"
FT   gene            complement(78424..78882)
FT                   /locus_tag="CKO_00083"
FT   CDS_pept        complement(78424..78882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00083"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11262"
FT                   /db_xref="GOA:A8ACP9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACP9"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000485"
FT                   /inference="protein motif:HMMSmart:IPR000485"
FT                   /inference="protein motif:superfamily:IPR011008"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001178825.1"
FT                   /protein_id="ABV11262.1"
FT                   /translation="MENYQIDNLDRGILEALMANARTAYAELAKQFSVSPGTIHVRVEK
FT                   MKQAGIITGARIDVSPKQLGYDVCCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGH
FT                   YSIFIKVMCRSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIRP"
FT   gene            78974..80026
FT                   /locus_tag="CKO_00084"
FT   CDS_pept        78974..80026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4299 2.4e-169 asnA; asparagine
FT                   synthetase A K01914; COG: COG2502 Asparagine synthetase A;
FT                   Psort location: Cytoplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11263"
FT                   /db_xref="GOA:A8ACQ0"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ0"
FT                   /inference="protein motif:BlastProDom:IPR004618"
FT                   /inference="protein motif:HMMPfam:IPR004618"
FT                   /inference="protein motif:HMMTigr:IPR004618"
FT                   /inference="similar to AA sequence:REFSEQ:YP_859338.1"
FT                   /protein_id="ABV11263.1"
FT                   /translation="MNITLNLLLNHRQQDAGVYKMKTAYIAKQRQISFVKSHFSRQLEE
FT                   RLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVKALPDAQFEVVHSLAKWKRQTLGQH
FT                   DFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWERVMGDGERQFATLKSTVEAIWEG
FT                   IKATEAAVSKEFGLAPFLPEQIHFVHSQELLARYPDLDAKGRERAIAKELGAVFLVGIG
FT                   GKLSDGKRHDVRAPDYDDWSSASDLGHAGLNGDILVWNPVLEDAFELSSMGIRVDADAL
FT                   KRQLALTGDEDRLSLEWHQALLRGEMPQTIGGGIGQSRLTMLLLQLPHIGQVQCGVWPA
FT                   QVRESVASLL"
FT   gene            complement(80031..81482)
FT                   /locus_tag="CKO_00085"
FT   CDS_pept        complement(80031..81482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00085"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2425 Uncharacterized protein containing a
FT                   von Willebrand factor type A (vWA) domain; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11264"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACQ1"
FT                   /inference="protein motif:HMMSmart:IPR002035"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZKW3"
FT                   /protein_id="ABV11264.1"
FT                   /translation="MLTLDTLNVMLAVSEEGIIEEIILTLLASPQLAIFFEKFPRLKRA
FT                   ISDDLPRWREALRSRLKDARVPPELTEEVMCYQQSQLLGTTQFIVQLPQILALLHRLHS
FT                   PYAGQAQQLVDSNATFTPALHTLFLQRWRLSLIVQTTALNHQLLEEEREQLLSEVQERM
FT                   TLSGQLEPVLAENDHAAGRLWDMSAGQLKRGDYQLIVKYGDFLAEQPELKRLAEQLGRS
FT                   REAKSVPRKDAPMETFRTLVREPATVPEQVDGIQQSDDILRLLPPELATLGITELEYEF
FT                   YRRLVEKQLLTYRLHGEAWREKVTERPVVHQDFDEQPRGPFIVCVDTSGSMGGFNEQCA
FT                   KAFCLALMRVALADNRRCFIMLFSTEVVRYELSGPEGIEQAIRFLSQRFRGGTDIASCF
FT                   RAIIERMQGREWFDADAVVISDFIAQRLPDDVVNKVGELQRVHQHRFHAVAMSAHGKPG
FT                   IMRIFDHIWRFDTGMRSRLLRRWRR"
FT   gene            complement(81476..83005)
FT                   /locus_tag="CKO_00086"
FT   CDS_pept        complement(81476..83005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3792 1.3e-250 yieN; paral putative
FT                   regulator protein K03924; COG: COG0714 MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11265"
FT                   /db_xref="GOA:A8ACQ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ2"
FT                   /inference="protein motif:HMMPfam:IPR011704"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218779.1"
FT                   /protein_id="ABV11265.1"
FT                   /translation="MIHLAEGRHLIMAHPHLLAERISRLSSALEKGLYERSHAIRLCLL
FT                   AALSGESVFLLGPPGIAKSLIARRLKFAFQHARAFEYLMTRFSTPEEVFGPLSIQALKD
FT                   EGRYERLTTGYLPEAEIVFLDEIWKAGPAILNTLLTAINERHFRNGAHEEKIPMRLLVA
FT                   ASNELPEADSSLEALYDRMLIRLWLDKVQDKANFRSMLVSQQDESDNPVPASLQVTDEE
FT                   YYQWQKDISAITLPDHVFELIFTLRQQLDALPDAPYVSDRRWKKAIRLLQASAFFSGRD
FT                   AVAPIDLILLKDCLWYDAQSLNLMQQQLEILMTGHAWQQQAMLTRLGGIVQRRLQLQQQ
FT                   QSDKTAFTVVRQGGMFSRRPHYDLPPEASAPVLTLLLQQPLKLHDMEVIHIAFERSALE
FT                   QWLAKGGEIRGKLNGIGFAQTLNMEVDSAQHLVVRDVSLQGSRLALPGSSEEGMPGEIK
FT                   QQLEALDSEWHQQHSRFSEQQKCLFIHSDWLGRIEASLQDVGAQIRQAQQC"
FT   gene            83277..85145
FT                   /locus_tag="CKO_00087"
FT   CDS_pept        83277..85145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00087"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3158 K+ transporter; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11266"
FT                   /db_xref="GOA:A8ACQ3"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACQ3"
FT                   /inference="protein motif:HMMPfam:IPR003855"
FT                   /inference="protein motif:HMMTigr:IPR003855"
FT                   /protein_id="ABV11266.1"
FT                   /translation="MSTDNKQSLSAITLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVE
FT                   RDAVFGFLSLIFWLLIFVVSIKYLTFVMRADNAGEGGILTLMSLAGRNTSARMTSTLVI
FT                   MGLIGGSFFYGEVVITPAISVMSAIEGLEIVAPELDTWVVPLSIIVLTLLFMIQKHGTG
FT                   MVGKLFAPIMLTWFLILAGLGLRSIIANPDVLHALNPMWAAKFFLEYKTVSFIALGAVV
FT                   LSITGVEALYADMGHFGKLPIRLAWFSVVLPSLTLNYFGQGALLLKHPEAIKNPFFLLA
FT                   PEWALIPLLILAALATVIASQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMESGQIYIP
FT                   FVNWMLYFAVVIVIVSFERSSNLAAAYGIAVTGTMVLTSILSTTVARKNWHWNKYFVAL
FT                   ILVAFLCVDVPLFSANLDKLLSGGWLPLTLGIVMFIIMTTWKSERFRLLRRMHEHGNSL
FT                   EALIASLEKSPPVRVPGTAVYMSRALNVIPFALLHNLKHNKVLHERVILLTLRTEDAPY
FT                   VHNVRRVQIEQLSPTFWRVVASYGWRETPNVEEVFHRCGLEGLSCRMMETSFFMSHESL
FT                   ILGKRPWYLRLRGKLYLLLQRNALRAPDQFEIPPNRVIELGTQVEI"
FT   gene            85440..85736
FT                   /locus_tag="CKO_00088"
FT   CDS_pept        85440..85736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00088"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1869 ABC-type ribose transport system,
FT                   auxiliary component; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11267"
FT                   /db_xref="GOA:A8ACQ4"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACQ4"
FT                   /inference="protein motif:HMMPfam:IPR007721"
FT                   /inference="similar to AA sequence:INSD:ABP62769.1"
FT                   /protein_id="ABV11267.1"
FT                   /translation="MALTQGVPSFMQVLDVVTREMQVEAAILATEIKEHNPQLHETLLS
FT                   HIEQLQQHQGNTIEIRYTTHEHFKKLTADSQAVIRSGECSPYANVILCAGVTF"
FT   gene            85744..87249
FT                   /locus_tag="CKO_00089"
FT   CDS_pept        85744..87249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3795 6.6e-254 rbsA; ABC superfamily
FT                   (atp_bind), D-ribose high-affinity transport protein
FT                   K02056; COG: COG1129 ABC-type sugar transport system,
FT                   ATPase component; Psort location: CytoplasmicMembrane,
FT                   score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11268"
FT                   /db_xref="GOA:A8ACQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ5"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218782.1"
FT                   /protein_id="ABV11268.1"
FT                   /translation="MDALLQLKGIDKAFPGVKALSGAALNVYPGRVMALVGENGAGKST
FT                   MMKVLTGIYTRDAGSLLWLGKETTFNGPKSSQEAGIGIIHQELNLIPQLTIAENIFLGR
FT                   EFVNRFGKIDWKKMYAEADVLLARLNLRFKSDRLVGELSIGDQQMVEIAKVLSFESRVI
FT                   IMDEPTDALTDTETESLFRVIRELKSQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAE
FT                   REVASLTEDSLIEMMVGRKLEDQYPRLDKAPGEVRLKVDNLCGPGVNNVSFTLRKGEIL
FT                   GISGLMGAGRTELMKVLYGALPRTSGYVTLDGHEVITRSPQDGLANGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSRAGGNLKHKDEQQAVSDFIRLFNVKTPSMEQAIGLLSGG
FT                   NQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKADGLSIILVSSEMPEV
FT                   LGMSDRIIVMHEGHLGGEFTREQATQEVLMAAAVGKLNRVNQE"
FT   gene            87255..88220
FT                   /locus_tag="CKO_00090"
FT   CDS_pept        87255..88220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_4171 7.1e-67 ribose transport system
FT                   permease protein RbsC; COG: COG1172
FT                   Ribose/xylose/arabinose/galactoside ABC-type transport
FT                   systems, permease components; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11269"
FT                   /db_xref="GOA:A8ACQ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ6"
FT                   /inference="protein motif:HMMPfam:IPR001851"
FT                   /inference="similar to AA sequence:INSD:ABP62767.1"
FT                   /protein_id="ABV11269.1"
FT                   /translation="MTIQAVSGRRYFTKAWLMEQKSLIALLVLIAIVSTMSPNFFTVNN
FT                   LFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGIEVNALVAVAAA
FT                   LALGAAIGAVTGVIVAKGRVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFTDNADLFGW
FT                   FGIGRPLGVPTPVWIMGIVFLAAWYMLHHTRLGRYIYALGGNEAATRLSGISVSKVKII
FT                   VYSLCGLLASLAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIG
FT                   ALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKKQ"
FT   gene            88245..89135
FT                   /locus_tag="CKO_00091"
FT   CDS_pept        88245..89135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00091"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_3095 2.5e-41 D-ribose-binding
FT                   periplasmic protein; COG: COG1879 ABC-type sugar transport
FT                   system, periplasmic component; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11270"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ7"
FT                   /inference="protein motif:HMMPfam:IPR001761"
FT                   /inference="similar to AA sequence:INSD:ABJ03221.1"
FT                   /protein_id="ABV11270.1"
FT                   /translation="MNMKKLATLVSAVALSATVSANAMAKDTIALVISTLNNPFFVTLK
FT                   EGAQKEADKLGYNLVVLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMAN
FT                   QAKIPVITLDRQATKGDVVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTSAA
FT                   RERGEGFQQAVAAHKFNVLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGA
FT                   LRALQTAGKSDVMVVGFDGTPDGEKAVNDGKLAATIAQLPDQIGAKGVETADKVLKGEK
FT                   VQAKYPVDLKLVIKQ"
FT   gene            89276..90205
FT                   /locus_tag="CKO_00092"
FT   CDS_pept        89276..90205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA3724 2.5e-144 rbsK; ribokinase K00852;
FT                   COG: COG0524 Sugar kinases, ribokinase family; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11271"
FT                   /db_xref="GOA:A8ACQ8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ8"
FT                   /inference="protein motif:FPrintScan:IPR002139"
FT                   /inference="protein motif:HMMPfam:IPR011611"
FT                   /inference="protein motif:HMMTigr:IPR011877"
FT                   /inference="protein motif:ScanRegExp:IPR002173"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152827.1"
FT                   /protein_id="ABV11271.1"
FT                   /translation="MKTAGNLVVLGSINADHILNLESFPAPGETVTGTQYQVAFGGKGA
FT                   NQAVAAGRSGANIAFIACTGDDDIGESVRKQLASDNIDIVPVSVINGESTGVALIFVNG
FT                   EGENVIGIHAGANAALSPALVEAQRERIAGASALLMQLESPIESVLAAAKIAHQNNTTV
FT                   ALNPAPARELSDELLALVDIITPNETEAEKLTGIRVESDEDAAKAAQVLHDKGIHTVLI
FT                   TLGSRGVWASVKGEGRRVPGFKVNAVDTIAAGDTFNGALVTALLEETPLPEAIRFAHAA
FT                   AAIAVTRKGAQPSVPWREEIEAFLGQQR"
FT   gene            90218..91207
FT                   /locus_tag="CKO_00093"
FT   CDS_pept        90218..91207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1922 4.7e-08 transcriptional regulator,
FT                   LacI family/carbohydrate kinase, PfkB family protein
FT                   K00852; COG: COG1609 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11272"
FT                   /db_xref="GOA:A8ACQ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACQ9"
FT                   /inference="protein motif:HMMPfam:IPR000843"
FT                   /inference="protein motif:HMMPfam:IPR001761"
FT                   /inference="protein motif:HMMSmart:IPR000843"
FT                   /inference="protein motif:ScanRegExp:IPR000843"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:REFSEQ:NP_462785.1"
FT                   /protein_id="ABV11272.1"
FT                   /translation="MKDVARLAGVSTSTVSHVINKDRFVSEAITGKVEAAIKELNYAPS
FT                   ALARSLKLNQTRTIGMLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMNRN
FT                   LETLMQKRVDGLLLLCTETHQPSREIMQRYPSIPTVMMDWSPFDDEGDCDLIQDNSLLG
FT                   GDLATQYLIDKGFTRIACITGPLDKTPARLRLEGYREAMKRAGLEIPEGYEITGDFEFG
FT                   GGFETMQMLLSHKQRPQAVFAGNDAMAVGAYQALYQVGLRIPQDMAVIGYDDIELARYM
FT                   TPPLTTIHQPKDELGELAIDVLIHRMAQPTLQQQRLQLTPVLMARGAV"
FT   gene            complement(91173..92600)
FT                   /locus_tag="CKO_00094"
FT   CDS_pept        complement(91173..92600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1466 2.2e-08 dethiobiotin synthase
FT                   K01935; COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11273"
FT                   /db_xref="GOA:A8ACR0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR0"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR004638"
FT                   /inference="similar to AA sequence:INSD:AAL22745.1"
FT                   /protein_id="ABV11273.1"
FT                   /translation="MSEKKARSMAGLPWIAAMAFFMQALDATILNTALPAIAHSLNRSP
FT                   LAMQSAIISYTLTVAMLIPVSGWLADRFGTRRVFIIAVSLFTLGSLACALSGSLAELVV
FT                   FRVVQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLVGPILGPVLGGILVTWAS
FT                   WHWIFLINIPIGIVGILYARKYMPNFTTPRRRFDMTGFFLFGLSLVLFSSGMELFGEKI
FT                   VATWIALTIILSSIVLLLAYIRHARRHPTPLISLSLFRTRTFSVGIAGNLATRLGTGCV
FT                   PFLMPLMIQVGFGYPALIAGCMMAPTALGSILAKSAVTQVLRKLGYKTTLVGITVFIGL
FT                   MIAQFSLQSPAMPVWMLILPLFVLGMAMSTQFTAMNTITLADLTDDNASSGNSLLAVTQ
FT                   QLSISLGVAISAAVLRLYEGIEGTNTVEQFHYTFITMGAITVVSALMFMLLKAKDGRNL
FT                   IKERHKPKPPPAPSEQE"
FT   gene            complement(92612..93316)
FT                   /locus_tag="CKO_00095"
FT   CDS_pept        complement(92612..93316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00095"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A3019 0.0056 hutC; histidine
FT                   utilization repressor; COG: COG2186 Transcriptional
FT                   regulators; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11274"
FT                   /db_xref="GOA:A8ACR1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR1"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR011711"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:REFSEQ:NP_807269.1"
FT                   /protein_id="ABV11274.1"
FT                   /translation="MPLSAQQLAAQKNLSYVLAEKLAQRILKGEYAPGTILPGEIELGE
FT                   QFGVSRTAVREAVKTLTAKGMVLPRPRIGTRVMPQANWNFLDQELLTWWMTEENFHQVI
FT                   NHFLVMRISLEPQACSLAATIGSAEQKAHLNTLMEEMVALKKNFRRERWIEVDMAWHEH
FT                   IYEMSANPFLISFASLFHSVYHTYFTSITYNDVVKLDLHQAIVDAIADSDGDRAFKACQ
FT                   ALLIAPNEQPDK"
FT   gene            93319..93453
FT                   /locus_tag="CKO_00096"
FT   CDS_pept        93319..93453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11275"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR2"
FT                   /protein_id="ABV11275.1"
FT                   /translation="MFVLSLFLFISMPSGSVIKVVKTANCLFYGMLIVVLLKKKAVGK"
FT   unsure          93429..98931
FT                   /note="Unresolved repeat"
FT   gene            93820..94351
FT                   /locus_tag="CKO_00097"
FT   rRNA            93820..94351
FT                   /locus_tag="CKO_00097"
FT                   /product="small subunit ribosomal RNA"
FT                   /note="Rfam score 354.41; 5' domain"
FT                   /inference="nucleotide motif:Rfam:RF00177"
FT   gene            95422..95494
FT                   /locus_tag="CKO_00098"
FT   tRNA            95422..95494
FT                   /locus_tag="CKO_00098"
FT                   /product="tRNA-Glu"
FT   gene            96133..96282
FT                   /locus_tag="CKO_00099"
FT   CDS_pept        96133..96282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11276"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR3"
FT                   /protein_id="ABV11276.1"
FT                   /translation="MNQYREGKAKRTPARGVKKNLKPCTYKQWEPLYGVTAYLLYNGSA
FT                   TYIL"
FT   gene            98685..98800
FT                   /locus_tag="CKO_00100"
FT   rRNA            98685..98800
FT                   /locus_tag="CKO_00100"
FT                   /product="5S ribosomal RNA"
FT                   /note="Rfam score 84.4"
FT                   /inference="nucleotide motif:Rfam:RF00001"
FT   gene            98854..98927
FT                   /locus_tag="CKO_00101"
FT   tRNA            98854..98927
FT                   /locus_tag="CKO_00101"
FT                   /product="tRNA-Asp"
FT   gene            98939..99011
FT                   /locus_tag="CKO_00102"
FT   tRNA            98939..99011
FT                   /locus_tag="CKO_00102"
FT                   /product="tRNA-Trp"
FT   gene            complement(99118..99963)
FT                   /locus_tag="CKO_00103"
FT   CDS_pept        complement(99118..99963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 1.2e-05 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11277"
FT                   /db_xref="GOA:A8ACR4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR4"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:AAX67710.1"
FT                   /protein_id="ABV11277.1"
FT                   /translation="MESVVDTELLKTFLEVSRTRHFGRAAEALYLTQSAVSFRIRQLEN
FT                   QLGVNLFTRHRNNIRLTAAGEKLLPYAETLMNTWQAARKEVAHTSRHNEFSIGASASLW
FT                   ECMLNGWLARLYQSLEPQASLQFEARIAQRQSLVKQLHERQLDLLITTEAPKMDEFSSQ
FT                   LLGHFTLALYCSSPSQMKDELNYLRLEWGPDFQQHEVGLIASDEVPVLTTSSAELARQQ
FT                   LSALNGCSWLPVGWAKEKGGLHTVADSATLSRPLYAIWLQNSDKHTLIRDLLKTNVLED
FT                   "
FT   gene            100070..100408
FT                   /locus_tag="CKO_00104"
FT   CDS_pept        100070..100408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00104"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3085 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11278"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR5"
FT                   /inference="protein motif:HMMPfam:IPR007335"
FT                   /inference="similar to AA sequence:INSD:ABF05757.1"
FT                   /protein_id="ABV11278.1"
FT                   /translation="MAESFTTTNRYFDNKYYPRGFSRHGDFTIKEAQLLERHGYAFNEL
FT                   DLGKREPVTEEERLFVAVCRGEREPVTEAERVWSKYMTRIKRPKRFHTLSGGKPQMEGA
FT                   EDYTESDD"
FT   gene            complement(100435..101955)
FT                   /locus_tag="CKO_00105"
FT   CDS_pept        complement(100435..101955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4322 4.0e-231 yifB; putative
FT                   2-component regulator K07391; COG: COG0606 Predicted ATPase
FT                   with chaperone activity; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11279"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR6"
FT                   /inference="protein motif:HMMPanther:IPR001208"
FT                   /inference="protein motif:HMMPfam:IPR000523"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR004482"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="similar to AA sequence:INSD:BAB38123.1"
FT                   /protein_id="ABV11279.1"
FT                   /translation="MSLSIVHTRAALGVNAPPITIEVHISNGLPGLTMVGLPETTVKEA
FT                   RDRVRSAIINSGYEFPAKKITINLAPADLPKEGGRYDLPIAIALLAASEQLTTNKLNEY
FT                   ELVGELALTGALRGVPGAISSATEAIRAGRHIIVAKENATEVGLISGEGCLIADHLQTV
FT                   CAFLEGKLDLEKPVSTDSDACLLHDDLSDVIGQEQGKRGLEITAAGGHNLLLIGPPGTG
FT                   KTMLASRINGLLPSLSDKEALESAAILSLVNADTVQRQWKRRPFRSPHHSASLTAMVGG
FT                   GSIPAPGEISLAHNGILFLDELPEFERRTLDALREPIESGQIHLSRTRAKITYPARFQL
FT                   IAAMNPSPTGHYQGNHNRCSPEQTLRYLSRLSGPFLDRFDLSLEIPLPPPGILSQAAVK
FT                   GEDSATVKVRVISARKRQYERQGKLNAHLDSQGIRKYCSLHSDDAHWLEETLIHLGLSI
FT                   RAWQRLLKVARTIADLEQTENITRLHLQEAVGYRAIDRLLIHLQKLLT"
FT   gene            101967..102206
FT                   /locus_tag="CKO_00106"
FT   CDS_pept        101967..102206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11280"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR7"
FT                   /protein_id="ABV11280.1"
FT                   /translation="MRELCCIKNQEYPARSLTFGAYSGNFIAFSKYALLFGSVLAKNHR
FT                   CEKKMGVAAVYEAKSENFSFPVFCIKNNDFLLNR"
FT   gene            102546..104192
FT                   /locus_tag="CKO_00107"
FT   CDS_pept        102546..104192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3901 2.1e-282 ilvG; acetolactate
FT                   synthase large subunit K01652; COG: COG0028 Thiamine
FT                   pyrophosphate-requiring enzymes [acetolactate synthase,
FT                   pyruvate dehydrogenase (cytochrome), glyoxylate
FT                   carboligase, phosphonopyruvate decarboxylase]; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11281"
FT                   /db_xref="GOA:A8ACR8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR8"
FT                   /inference="protein motif:HMMPfam:IPR011766"
FT                   /inference="protein motif:HMMPfam:IPR012000"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR000399"
FT                   /inference="protein motif:HMMPIR:IPR004407"
FT                   /inference="protein motif:HMMTigr:IPR012846"
FT                   /inference="protein motif:ScanRegExp:IPR000399"
FT                   /inference="similar to AA sequence:INSD:AAL22751.1"
FT                   /protein_id="ABV11281.1"
FT                   /translation="MNGAQWVVHALRAQGVETVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAMAAIGYARSTGKTGVCIATSGPGATNLITGLADALLDSVPVVAITGQVSAPFI
FT                   GTDAFQEVDVLGLSLACTKHSFLVQSLEELPRIMAEAFRVANSGRPGPVLVDIPKDIQL
FT                   ANGSLEPYFTTVENETAFPHADVEQARRMMAQAQKPMLYVGGGVGMAQAVPALREFIAA
FT                   TQMPVTCTLKGLGAVDADYPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGKL
FT                   NTFAPSASVIHMDIDPAEMNKLRQAHVALQGDLNALLPALQQPLNIDAWRQHNAELRTE
FT                   HAWRYDHPGEAIYAPLLLKQLSERKPADSVVTTDVGQHQMWSAQHMTYTRPENFITSSG
FT                   LGTMGFGLPAAVGAQVARPNDTVICISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFQERYSETTLTDNPDFLMLASAFGIPGQHITRKDQVEAALDTMLNSDGP
FT                   YLLHVSIDELENVWPLVPPGASNSEMLEKLS"
FT   gene            104189..104452
FT                   /locus_tag="CKO_00108"
FT   CDS_pept        104189..104452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3807 4.1e-39 ilvM; acetolactate synthase
FT                   II, small subunit K01653; COG: COG3978 Acetolactate
FT                   synthase (isozyme II), small (regulatory) subunit; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11282"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACR9"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218794.1"
FT                   /protein_id="ABV11282.1"
FT                   /translation="MMQHQVNVAARFNPETLERVLRVVRHRGFQVCSMNMEAATDAQNI
FT                   NIELTVASPRSVDLLFSQLSKLVDVAHVAICQSTTTSQQIRA"
FT   gene            104470..105399
FT                   /locus_tag="CKO_00109"
FT   CDS_pept        104470..105399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs4704 3.8e-164 branched-chain amino-acid
FT                   aminotransferase K00826; COG: COG0115 Branched-chain amino
FT                   acid aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11283"
FT                   /db_xref="GOA:A8ACS0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS0"
FT                   /inference="protein motif:BlastProDom:IPR001544"
FT                   /inference="protein motif:HMMPanther:IPR001544"
FT                   /inference="protein motif:HMMPfam:IPR001544"
FT                   /inference="protein motif:HMMTigr:IPR005785"
FT                   /inference="protein motif:ScanRegExp:IPR001544"
FT                   /inference="protein motif:superfamily:IPR001544"
FT                   /inference="similar to AA sequence:INSD:BAE77527.1"
FT                   /protein_id="ABV11283.1"
FT                   /translation="MTTKKADYIWFNGEMIRWEDAKVHVMSHALHYGTSVFEGIRCYDS
FT                   HKGPVVFRHREHMQRLHDSAKIYRFPVSQSVDELMEACRDVIRKNNLTSAYIRPLVFVG
FT                   DVGMGVNPPPGYSTDVIIAAFPWGAYLGAEALDQGIDAMVSSWNRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGIT
FT                   RDAIIKLAKELDIEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPV
FT                   TKRIQQAFFGLFTGETEDKWGWLDQVNP"
FT   gene            105508..107316
FT                   /locus_tag="CKO_00110"
FT   CDS_pept        105508..107316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00110"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4327 0. ilvD; dihydroxy-acid
FT                   dehydratase K01687; COG: COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11284"
FT                   /db_xref="GOA:A8ACS1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS1"
FT                   /inference="protein motif:BlastProDom:IPR000581"
FT                   /inference="protein motif:HMMPanther:IPR000581"
FT                   /inference="protein motif:HMMPfam:IPR000581"
FT                   /inference="protein motif:HMMTigr:IPR004404"
FT                   /inference="protein motif:ScanRegExp:IPR000581"
FT                   /inference="protein motif:superfamily:IPR001697"
FT                   /protein_id="ABV11284.1"
FT                   /translation="MAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKL
FT                   VAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVC
FT                   ISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVS
FT                   DDQSNQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAG
FT                   KRIVELTKRYYEQDDASALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEID
FT                   FTMSDIDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVLGILGELDRAGLMNRDVKNVLG
FT                   LTLPQTLEQYDVMVSQNEAVKQMFRAGPAGIRTTQAFSQDCRWDSLDTDRAEGCIRSLE
FT                   HAYSKDGGLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVA
FT                   GDVVVIRYEGPKGGPGMQEMLYPTTFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPE
FT                   AASGGNIAIIEDGDMIAIDIPNRGIQLQLSDAEIAARREAQEARGDKAWTPKDRQRPVS
FT                   FALRAYASLATSADKGAVRDKSKLGG"
FT   gene            107316..108863
FT                   /locus_tag="CKO_00111"
FT   CDS_pept        107316..108863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4328 1.9e-265 ilvA; threonine
FT                   dehydratase biosynthetic K01754; COG: COG1171 Threonine
FT                   dehydratase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11285"
FT                   /db_xref="GOA:A8ACS2"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS2"
FT                   /inference="protein motif:HMMPfam:IPR001721"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005787"
FT                   /inference="protein motif:ScanRegExp:IPR000634"
FT                   /inference="similar to AA sequence:INSD:ABE09749.1"
FT                   /protein_id="ABV11285.1"
FT                   /translation="MMAESQPLSAAPEGAEYLRAVLRAPVYEAAQVTPLQKMEKLSSRL
FT                   DNVILVKREDRQPVHSFKLRGAYAMMAGLTEEQKAHGVITASAGNHAQGVAFSSARLGV
FT                   KALIVMPLATADIKVDAVRGFGGEVLLHGANFDEAKAKAIELAQQQGFTWVPPFDHPMV
FT                   IAGQGTLALELLQQDAHLDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLK
FT                   AALDAGHPVDLPRVGLFAEGVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFED
FT                   VRAVAEPSGALALAGMKKYIAQHNIRGERLAHVLSGANVNFHGLRYVSERCELGEQREA
FT                   LLAVTIPEEKGSFLKFCQLLGGRSVTEFNYRFADAQDACIFVGVRLSRGLEERKEILAL
FT                   LHEGGYSVVDLSDDEMAKLHVRYMVGGRPSKPLQERLYSFEFPESPGALLKFLHTLGTH
FT                   WNISLFHYRSHGTDYGRVLAAFELGENEPDFETRLNELGYECHNESDNPAFRFFLAG"
FT   gene            complement(108956..109774)
FT                   /locus_tag="CKO_00112"
FT   CDS_pept        complement(108956..109774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 2.4e-12 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11286"
FT                   /db_xref="GOA:A8ACS3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS3"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:BAE77524.1"
FT                   /protein_id="ABV11286.1"
FT                   /translation="MHVSPSTLSRQIQRLEEDLGQPLFIRDNRTVTLTEAGEELRTFAQ
FT                   QTLLQYQQLRHTIDQQGPSLSGELHIFCSVTAAYSHLPPILDRFRAEHPSVEIKLTTGD
FT                   AADAMEKVVTGEADLAIAGKPETLPGAVAFSMLENLAVVLIAPALPCPVRNQVSVDKPD
FT                   WSTVPFIMADQGPVRRRIELWFRRQKISNPSIYATVGGHEAMVSMVALGCGVALLPEVV
FT                   LENSPEPVRNRVMILERSDEKTPFELGVCAQKKRLHEPLIDAFWNILPNH"
FT   gene            110012..111487
FT                   /locus_tag="CKO_00113"
FT   CDS_pept        110012..111487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4330 1.6e-257 ilvC; ketol-acid
FT                   reductoisomerase K00053; COG: COG0059 Ketol-acid
FT                   reductoisomerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11287"
FT                   /db_xref="GOA:A8ACS4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACS4"
FT                   /inference="protein motif:HMMPfam:IPR000506"
FT                   /inference="protein motif:HMMPfam:IPR013116"
FT                   /inference="protein motif:HMMTigr:IPR013023"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /inference="similar to AA sequence:INSD:ABE09751.1"
FT                   /protein_id="ABV11287.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMGRDEFADGASYLQGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDIAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSDVVRSVQPLMKDGAALGYSHGFNIVEVGEQIRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVEEGTDPAYAEKLIQYGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALSEQLKTIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLTWREETGKTAFE
FT                   TAPQYEGKIGEQEYFDKGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFSYACVPLLKAFMTEIQPGDLGKAIAEGAVDNAQL
FT                   RDVNEAIRGHAIEKVGQKLRGYMTDMKRIAVAG"
FT   gene            complement(111607..111888)
FT                   /locus_tag="CKO_00116"
FT   CDS_pept        complement(111607..111888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_3946 2.0e-46 ppiC; peptidyl-prolyl
FT                   cis-trans isomerase C K03769; COG: COG0760 Parvulin-like
FT                   peptidyl-prolyl isomerase; Psort location: OuterMembrane,
FT                   score:9.92"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11290"
FT                   /db_xref="GOA:A8ACS5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS5"
FT                   /inference="protein motif:HMMPfam:IPR000297"
FT                   /inference="protein motif:ScanRegExp:IPR000297"
FT                   /inference="similar to AA sequence:INSD:ABJ03237.1"
FT                   /protein_id="ABV11290.1"
FT                   /translation="MAKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGK
FT                   RGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN"
FT   gene            111755..112081
FT                   /locus_tag="CKO_00114"
FT   CDS_pept        111755..112081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11288"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS6"
FT                   /protein_id="ABV11288.1"
FT                   /translation="MPDGQIECFFASLPKSAPFLICSRRSSASFSSFTRICSAAAVFAI
FT                   ISLSCLKGCPPLYHSLGRRTYTLRHRRTDVPPGLMNREMNDTFIRHIPSATGQPSCLSI
FT                   SGER"
FT   gene            111775..112086
FT                   /locus_tag="CKO_00115"
FT   CDS_pept        111775..112086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00115"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11289"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS7"
FT                   /protein_id="ABV11289.1"
FT                   /translation="MLFRQFAKVGAILDLFQKIQRQLLFFYQDMQCCCGFRHYFALMSQ
FT                   RLPATLSFLRASDIYSSPSQDRCPTGFNEPGDERHFYQTYSLCNRTAVLSFHLRREIT"
FT   gene            112092..112784
FT                   /locus_tag="CKO_00117"
FT   CDS_pept        112092..112784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3860 2.0e-06 crp; CRP-cAMP
FT                   transcriptional dual regulator K00924; COG: NOG28604 non
FT                   supervised orthologous group; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11291"
FT                   /db_xref="GOA:A8ACS8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS8"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000595"
FT                   /inference="protein motif:HMMSmart:IPR000595"
FT                   /inference="protein motif:ScanRegExp:IPR010916"
FT                   /inference="protein motif:superfamily:IPR000595"
FT                   /inference="similar to AA sequence:INSD:CAD09406.1"
FT                   /protein_id="ABV11291.1"
FT                   /translation="MKNAEFSGDWLTGLTQIVRDPQLYELLKYCPLDIMQRWRVEEIPR
FT                   GALICRQGDICRQFSLIVSGEVDVFYEAEDGRRYRQAHYRKGDMLGELEIFESRHYICS
FT                   VMAVGSVQLLSLPQADFHRWLALDNHFNQRMLRFFSQQYYQLSKKASSDNLYSLYQRVC
FT                   QALWQRYQHDESTTILLDKQNLSQEFAATTRSINRILHDLKSLKIIDTDGERIVLLAPE
FT                   KLKQEAEI"
FT   gene            112843..113556
FT                   /locus_tag="CKO_00118"
FT   CDS_pept        112843..113556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3644 6.3e-107 probable uridine
FT                   phosphorylase K00757; COG: COG2820 Uridine phosphorylase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11292"
FT                   /db_xref="GOA:A8ACS9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACS9"
FT                   /inference="protein motif:HMMPfam:IPR000845"
FT                   /inference="protein motif:ScanRegExp:IPR000845"
FT                   /inference="similar to AA sequence:INSD:CAD09405.1"
FT                   /protein_id="ABV11292.1"
FT                   /translation="MTGARYALLPGDPERVDRIAHFLDNPEILGQNREFRAARGTYKGI
FT                   EILVLSTGIGGPSTAIAIEELRQIGVDTLIRIGSCGALQDTLALGDLIIANGAVADDGT
FT                   SKTYAPACYPACADPQLIATLIQQAKQMNIPAICGLVRSHDSFYTDREAELDAEWSARG
FT                   ILGADMETAALMVVGALRGLRTASLLNVVVAHNGCLDSSINDYVQQETLCLRGEERQIS
FT                   LALQVIYFDSQQGEQ"
FT   gene            113553..114284
FT                   /locus_tag="CKO_00119"
FT   CDS_pept        113553..114284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00119"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3201 Nicotinamide mononucleotide
FT                   transporter; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11293"
FT                   /db_xref="GOA:A8ACT0"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT0"
FT                   /inference="protein motif:HMMPfam:IPR006419"
FT                   /inference="protein motif:HMMTigr:IPR006419"
FT                   /inference="similar to AA sequence:INSD:AAO70909.1"
FT                   /protein_id="ABV11293.1"
FT                   /translation="MMDFFSINNVMVNIPLGEGGYALSWIEAIGTVFGLLCIWCASREK
FT                   IINYLFGLINVTLFAAIFFQIQLYASLLLQVFFFAANIYGWYAWSRQNEAQEAALKVRW
FT                   LSRQQTLVLSGVCIVAILLMTRFIDPVFAMLTHIMLGMLQTVGVQVAMPELQPDAFPFW
FT                   DSTMLVLSIAAMVLMTRKYVENWLLWVLIDVISVVIYAVQGVYAMSLEYVLLTAIAIMG
FT                   SYSWILSAKRNGYAPLAASAS"
FT   gene            114384..116405
FT                   /locus_tag="CKO_00120"
FT   CDS_pept        114384..116405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3912 0. rep; rep helicase, a
FT                   single-stranded DNA dependent ATPase K03656; COG: COG0210
FT                   Superfamily I DNA and RNA helicases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11294"
FT                   /db_xref="GOA:A8ACT1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT1"
FT                   /inference="protein motif:HMMPanther:IPR000212"
FT                   /inference="protein motif:HMMPfam:IPR000212"
FT                   /inference="protein motif:HMMTigr:IPR005752"
FT                   /protein_id="ABV11294.1"
FT                   /translation="MRLNPGQQHAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGY
FT                   QARHIAAVTFTNKAAREMKERVGQTLGRKEARGLMISTFHTLGLDIIKREYAALGMKSN
FT                   FSLFDDTDQVALLKELTDGLIEDDKVILQQLISTISNWKNDLMTPAQAAASAKGERDRI
FT                   FAHCYGLYDAHLKACNVLDFDDLILLPTLLLQRNEEVRERWQNRIRYLLVDEYQDTNTS
FT                   QYELVKLLVGSRARFTVVGDDDQSIYSWRGARPQNLVLLSKDFPALQVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKRLFSELGYGAELKVLSANNEEHEAERVTGELIAHHFVNKT
FT                   EYKDYAILYRGNHQSRVFEKFLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDD
FT                   SAFLRIVNTPKREIGPATLQKLGEWAMTRNKSLFTASFDVGLNQTLTGRGYDSLTRFTH
FT                   WLGEIQRLSEREPIAAVRDLIHGIDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLE
FT                   GNELDEPMTLTQVVTRFTLRDMMERGESEEELDQVQLMTLHASKGLEFPYVFMVGMEEG
FT                   FLPHQSSIDEDNIDEERRLAYVGITRAQKELIFTLCKERRQYGELVRPEPSRFLLELPQ
FT                   DDLIWEQERKVVTAEERMQKGQASIANIRAMMAKAKAK"
FT   gene            complement(116453..117937)
FT                   /locus_tag="CKO_00121"
FT   CDS_pept        complement(116453..117937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3641 4.5e-239 gppA;
FT                   guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase
FT                   (guanosine pentaphosphatase) K01524; COG: COG0248
FT                   Exopolyphosphatase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11295"
FT                   /db_xref="GOA:A8ACT2"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACT2"
FT                   /inference="protein motif:HMMPfam:IPR003695"
FT                   /inference="similar to AA sequence:INSD:CAD09402.1"
FT                   /protein_id="ABV11295.1"
FT                   /translation="MLTSTSLYAAIDLGSNSFHMLVVREVAGSIQTLTRIKRKVRLAAG
FT                   LNSDNSLSAEAMERGWQCLRLFAERLQDIPQPQICVVATATLRLAVNAGEFIAKAQEIL
FT                   GCPVQVISGEEEARLIYQGVAHTTGGADQRLVVDIGGASTELVTGTGAQTTSLFSLSMG
FT                   CVTWLERYFTDRNLAQENFDEAEKAAREVLRPVADELRKHGWKVCVGASGTVQALQEIM
FT                   MAQGMDERITLAKLQQLKQRAIHCGRLEELEIEGLTLERALVFPSGLAILIAIFTELDI
FT                   QCMTLAGGALREGLVYGMLHLAVDQDIRSRTLRNIQRRFMVDTEQAHRVADLAVNFLDQ
FT                   VEDKWHLEPISRELLTSACQLHEIGLSVDFKQAPQHAAYLVRNLDLPGFTPAQKKLLAT
FT                   LLLNQTNPIDLSSLHQQNAVPPRVAEHLCRLLRLAIIFASRRRDDLVPQITLQAQDENL
FT                   TLTLPQGWLEHHPLGKELIDQESQWQSYVHWPLDVH"
FT   gene            complement(117946..119211)
FT                   /locus_tag="CKO_00122"
FT   CDS_pept        complement(117946..119211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3914 6.6e-222 rhlB; putative helicase
FT                   K03732; COG: COG0513 Superfamily II DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11296"
FT                   /db_xref="GOA:A8ACT3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACT3"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="protein motif:ScanRegExp:IPR000629"
FT                   /inference="similar to AA sequence:INSD:CAD09401.1"
FT                   /protein_id="ABV11296.1"
FT                   /translation="MSKTHLTEQKFSDFALHPKVIEALENKGFHNCTPIQALALPLTLA
FT                   GRDVAGQAQTGTGKTMAFLTSSFHYLLSHPAIDDRKVNQPRALIMAPTRELAVQIHADA
FT                   EPLAQTTGLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPPANQRLNMLFSATLSYRVRELAFEQMNNAEYVEVE
FT                   PEQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRAIVFANTKHRCEDIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILDEFTRGDLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGASGHSISLACEEYALNLPAIEAYIGHSIPVSKYNPEALMTNLPKPLRL
FT                   TRSRPGNGPRRTGAPRNRRRSG"
FT   gene            119310..119684
FT                   /locus_tag="CKO_00123"
FT   CDS_pept        119310..119684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4335 4.1e-55 trxA; thioredoxin 1
FT                   K03671; COG: COG0526 Thiol-disulfide isomerase and
FT                   thioredoxins; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11297"
FT                   /db_xref="GOA:A8ACT4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT4"
FT                   /inference="protein motif:FPrintScan:IPR006662"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013766"
FT                   /inference="protein motif:HMMTigr:IPR005746"
FT                   /inference="protein motif:ScanRegExp:IPR006662"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAV79538.1"
FT                   /protein_id="ABV11297.1"
FT                   /translation="MKAKPTHQAYSCGVIMSDKIIHLTDDSFDTDVLKADGAILVDFWA
FT                   EWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAA
FT                   TKVGALSKGQLKEFLDANLA"
FT   gene            120025..121284
FT                   /locus_tag="CKO_00124"
FT   CDS_pept        120025..121284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa0112 3.5e-193 rho; transcription
FT                   termination factor K03628; COG: COG1158 Transcription
FT                   termination factor; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11298"
FT                   /db_xref="GOA:A8ACT5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT5"
FT                   /inference="protein motif:HMMPfam:IPR000194"
FT                   /inference="protein motif:HMMPfam:IPR011112"
FT                   /inference="protein motif:HMMPfam:IPR011113"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMSmart:IPR011129"
FT                   /inference="protein motif:HMMTigr:IPR004665"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:INSD:ABR79655.1"
FT                   /protein_id="ABV11298.1"
FT                   /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDDFFDMMKRS"
FT   gene            121487..122617
FT                   /locus_tag="CKO_00125"
FT   CDS_pept        121487..122617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3918 3.3e-181 rfe;
FT                   undecaprenyl-phosphate N-acetylglucosaminyltransferase
FT                   K02851; COG: COG0472 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11299"
FT                   /db_xref="GOA:A8ACT6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT6"
FT                   /inference="protein motif:HMMPfam:IPR000715"
FT                   /inference="protein motif:HMMTigr:IPR012750"
FT                   /inference="similar to AA sequence:INSD:AAV79540.1"
FT                   /protein_id="ABV11299.1"
FT                   /translation="MIYAESTYTVNLLAALSELISIFLFTTIFIFLARKVAIKIGLVDK
FT                   PNFRKRHQGVVPLVGGISVFAGISFMFALSDYYIPHASLYLFSAGVLVLVGALDDRFDI
FT                   SVKIRAVVQAAIAVVMMVIGKLHLSSLGYIFGPWELVLGPFGYFLTLFAVWAAINAFNM
FT                   VDGIDGLLGGLSSVSFAAMGLILWFDGQTSLAVWCFAMIAAILPYIMLNLGVLGRRYKV
FT                   FMGDAGSTLIGFTVIWILLETTQGKTHPISPVTALWIIAIPLMDMVAIMYRRLRKGMSP
FT                   FSPDRQHIHHLIMRAGFTSRQAFVLITLAAAILASIGVAAEYSHFVPEWVMLVLFLLAF
FT                   FLYGYCIKRAWKVARFIKRVKRRLRRNRDNNPTITK"
FT   gene            122630..123676
FT                   /locus_tag="CKO_00126"
FT   CDS_pept        122630..123676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00126"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3765 Chain length determinant protein; Psort
FT                   location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11300"
FT                   /db_xref="GOA:A8ACT7"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT7"
FT                   /inference="protein motif:HMMPfam:IPR003856"
FT                   /inference="similar to AA sequence:INSD:AAV79541.1"
FT                   /protein_id="ABV11300.1"
FT                   /translation="MTQPLPGAHAVSAENELDIRGLFRTLWAGKLWIVGIGLAFALIAL
FT                   AYTFFARQEWSATAISDRPTVNMLGGYYSQQQFLRNLDIKASLAPADQPSVMDEAYKEF
FT                   VMQLASWDTRRDFWLQTDYYKQRMVGNSKADAAMLDEMINNIQFTPGDFTRNTNDSVKL
FT                   IAETAPDANNLLRQYVAFASQRAASHLNDELKGAWAARTIQMKAQVKRQEEVAKSIFSR
FT                   RVHSIEQALKIAEQHNISRTATDVPADELPDSELFLLGRPMLQARLENLQAVGPAFDLD
FT                   YDQNRAMLNTLNVGPTLDPRFQTYRYLRTPEEPVKRDSPRRAFLMVMWGIVGALIGAGV
FT                   ALTRRRAI"
FT   gene            123732..124862
FT                   /locus_tag="CKO_00127"
FT   CDS_pept        123732..124862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3920 1.9e-185 wecB; UDP-N-acetyl
FT                   glucosamine -2-epimerase K01791; COG: COG0381
FT                   UDP-N-acetylglucosamine 2-epimerase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11301"
FT                   /db_xref="GOA:A8ACT8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT8"
FT                   /inference="protein motif:HMMPfam:IPR003331"
FT                   /inference="protein motif:HMMTigr:IPR003331"
FT                   /inference="similar to AA sequence:REFSEQ:NP_462810.1"
FT                   /protein_id="ABV11301.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAKDPHFEAKVCVTAQHREMLDQ
FT                   VLNLFSIVPDYDLNIMQPGQGLTEITCRILEGLKPILADFKPDVVLVHGDTTTTLATSL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRTLTGRLAMYHFAPTENSRQNLLREQIPD
FT                   NHIFVTGNTVIDALIWVRDRVLASDTLRAELAKRYPFLCDDKKMILVTGHRRESFGRGF
FT                   EQICHALAEIAATNQDVQIVYPVHLNPNVSEPVNRILGHVENVILIEPQDYLPFVWLMN
FT                   HAWLILTDSGGIQEEAPSLGKPVLVMREMTERPEAVTAGTVRLVGTDSHRIVEEVTRLL
FT                   HDENEYQTMSRAHNPYGDGQACGRILHALKNNRVSL"
FT   gene            124859..126121
FT                   /locus_tag="CKO_00128"
FT   CDS_pept        124859..126121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t3376 4.1e-206 rffD; UDP-ManNAc
FT                   dehydrogenase K02472; COG: COG0677
FT                   UDP-N-acetyl-D-mannosaminuronate dehydrogenase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11302"
FT                   /db_xref="GOA:A8ACT9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACT9"
FT                   /inference="protein motif:HMMPanther:IPR001732"
FT                   /inference="protein motif:HMMPfam:IPR001732"
FT                   /inference="protein motif:ScanRegExp:IPR001680"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /inference="similar to AA sequence:SwissProt:Q8Z389"
FT                   /protein_id="ABV11302.1"
FT                   /translation="MSFTTISVIGLGYIGLPTAAAFASRQKHVIGVDINQQAVDTINRG
FT                   AIHIVEPDLDSVVKTAVEGGFLRATTTPVAADAYLIAVPTPFKGDHDPDMVYVEAAAKS
FT                   IAPVLKKGALVILESTSPVGATEQMAAWLAEMRPDLTFPQQAGEQADVNIAYCPERVLP
FT                   GQVMVELIKNDRVIGGMTPVCSARASELYKIFLEGECVVTNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICADQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQNPQQ
FT                   ARLIRTAREVNDGKPHWVVAQVKAAVADCLTATNKRASDIKIACFGLAFKPNIDDLRES
FT                   PAMGIAQEIAQWHAGETLVVEPNIHQLPKKLEGRCTLATLENALAEADVLVMLVDHHPF
FT                   KAINGDAVRQRYIVDTKGVWR"
FT   gene            126121..127188
FT                   /locus_tag="CKO_00129"
FT   CDS_pept        126121..127188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3922 1.5e-176 rffG; dTDP-glucose
FT                   4,6-dehydratase K01710; COG: COG1088 dTDP-D-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11303"
FT                   /db_xref="GOA:A8ACU0"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU0"
FT                   /inference="protein motif:HMMPfam:IPR001509"
FT                   /inference="protein motif:HMMTigr:IPR005888"
FT                   /inference="similar to AA sequence:REFSEQ:NP_807039.1"
FT                   /protein_id="ABV11303.1"
FT                   /translation="MKRILVTGGAGFIGSAVVRHIIDETPDAVVVVDKLTYAGNLMSLA
FT                   PVAQHERFAFERVDICDRASLDRVFQQYQPDYVMHLAAESHVDRSIDGPAAFIETNIVG
FT                   TYTLLEAARTYWATLNDEKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQ
FT                   IRDWLYVEDHARALYRVLTAGEVGETYNIGGHNERKNLEVVETICDLLEELAPQKPLGV
FT                   AHYRSLIAFVDDRPGHDLRYAIDAAKIARELGWTPQETFESGMRKTVQWYLANEAWWKP
FT                   VQDGSYQGERLGLKG"
FT   gene            127206..128087
FT                   /locus_tag="CKO_00130"
FT   CDS_pept        127206..128087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S3897 2.2e-152 rffH; glucose-1-phosphate
FT                   thymidylyltransferase K00973; COG: COG1209 dTDP-glucose
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11304"
FT                   /db_xref="GOA:A8ACU1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU1"
FT                   /inference="protein motif:HMMPfam:IPR005835"
FT                   /inference="protein motif:HMMTigr:IPR005907"
FT                   /inference="similar to AA sequence:INSD:ABJ03248.1"
FT                   /protein_id="ABV11304.1"
FT                   /translation="MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IREILIITTPEDKHYFQRLLGDGSEFGIELQYAEQPSPDGLAQAFIIGETFLNGEPSCL
FT                   VLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAVSLEEKPKQ
FT                   PKSNWAVTGLYFYDSKVVEYAKRVKPSERGELEITSINQMYLNDGKLTVELLGRGFAWL
FT                   DTGTHDSLIEASTFVQTVEKRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQY
FT                   LLELLRARPRQY"
FT   gene            128065..128742
FT                   /locus_tag="CKO_00131"
FT   CDS_pept        128065..128742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4346 6.6e-96 rffC, rff, wecD, yifH;
FT                   TDP-fucosamine acetyltransferase K00680; COG: COG0454
FT                   Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11305"
FT                   /db_xref="GOA:A8ACU2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU2"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMTigr:IPR012752"
FT                   /inference="similar to AA sequence:INSD:ABJ03249.1"
FT                   /protein_id="ABV11305.1"
FT                   /translation="MPVRASIEPLTWENTFFGVNSAIVRVNPAAPVLTPEALQPWSRVQ
FT                   AKISAARTDELDALQQLGFSLVEGEVDFSLPVAGVERISGVEIAQIADIPALRQQASAA
FT                   FAQSRFRAPWYAPDASARFYAQWIENAVRGTFDHQCLVIRAANNDIRGFVSLRELNDTD
FT                   ARIGLLAGRGAGAELMQAALAWAQSRGKTTLRVATQMGNTAALKRYIQSGGNVESTAYW
FT                   LYR"
FT   gene            128747..129877
FT                   /locus_tag="CKO_00132"
FT   CDS_pept        128747..129877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4347 1.2e-192 rffA, rff, fcnA,
FT                   wecE, G349, yifI; TDP-4-oxo-6-deoxy-D-glucose transaminase;
FT                   COG: COG0399 Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11306"
FT                   /db_xref="GOA:A8ACU3"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU3"
FT                   /inference="protein motif:HMMPfam:IPR000653"
FT                   /inference="protein motif:HMMTigr:IPR012749"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00709253.1"
FT                   /protein_id="ABV11306.1"
FT                   /translation="MIPFNAPPVVGTELDYMQSALGSGKLCGDGGFTRRCQQWLEQRFG
FT                   SAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIIFVDIRPDT
FT                   MNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMAIAKRHNLFVVEDAAQGVMSTWKG
FT                   RALGTIGHIGCFSFHETKNYTAGGEGGATLINDRSLIERAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWAQLEAAERINQQRLALWQTYYDALAPLARAGRIDLPS
FT                   IPDDCRHNAHMFYIKLRDITDRSALINFLKEAEIMAVFHYIPLHDCPAGDKFGEFRGED
FT                   RYTTKESERLLRLPLFYNLSPVNQRTVISTLLNYFS"
FT   gene            129879..131129
FT                   /locus_tag="CKO_00133"
FT   CDS_pept        129879..131129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00133"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2244 Membrane protein involved in the export
FT                   of O-antigen and teichoic acid; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11307"
FT                   /db_xref="GOA:A8ACU4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU4"
FT                   /inference="protein motif:HMMPfam:IPR002797"
FT                   /inference="similar to AA sequence:INSD:AAL22775.1"
FT                   /protein_id="ABV11307.1"
FT                   /translation="MSLAKASLWTAASTLVKIGAGLLVVKLLAVSFGPAGVGQAGNFRQ
FT                   MVTVLGVLAGAGIFNGVTKYVAQHHDNPARLRNVVGTSSAMVLGFSTLLALVFVLAAAP
FT                   ISQGLFGHSHYQGLVRLVALVQMGIAWANLLLALMKGFRDAAGNALSLIVGSLVGVVAY
FT                   YGCYRLGGYEGALLGLALVPALVVIPAAIMLIKRGAIPLSYLKPSWDKGLAGQLSKFTL
FT                   MALITSVTLPVAYVMMRNLLAAHYSWDDVGIWQGVSSISDAYLQFITASFSVYLLPTLS
FT                   RLTEKQAITREVVKSLKFVLPAVAAASFTVWLLRDFAIWLLFSAKFTAMRDLFAWQLVG
FT                   DVLKVGAYVFGYLVIAKASLRFYILAEISQFILLMAFAHWLIPAHGALGAAQAYMATYV
FT                   VYFSLCCGVFLLWRRRA"
FT   gene            131126..132205
FT                   /locus_tag="CKO_00134"
FT   CDS_pept        131126..132205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3832 6.0e-173 putative inner membrane
FT                   protein K00754; COG: NOG06293 non supervised orthologous
FT                   group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11308"
FT                   /db_xref="GOA:A8ACU5"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACU5"
FT                   /inference="protein motif:HMMPfam:IPR009993"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152861.1"
FT                   /protein_id="ABV11308.1"
FT                   /translation="MTVLIHVLGSDIPHHNQTVLRFFNDALAATSEHARVFMVAGQDAG
FT                   LRESCPALSLSFYAGKKTLAEAVIAKAKANRQQRFFFHGQFNTSLWLALLSGGIKPEQF
FT                   YWHIWGADLYEVSRGLKFRLFYPVRRMAQNRVGCVFATRGDLSYFARQHPRVRGELLYF
FT                   PTRMDSSLNNMANDRPREGKMTVLVGNSGDRSNEHIAALRAVYQQFGDTVNVIVPMGYP
FT                   ANNDAYIDEVRQAGLALFSAENLHILSEKLEFDAYLALLRQCDLGYFIFARQQGIGTLC
FT                   LLIQAGVPCVLNRENPFWQDMAEQHLPVLFTTDALNEGVVREAQRQLASVDKSGITFFS
FT                   PNYLEPWHNALRIAAGEAA"
FT   gene            132202..133554
FT                   /locus_tag="CKO_00135"
FT   CDS_pept        132202..133554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA3768 5.7e-232 rffT; probable
FT                   4-alpha-l-fucosyltransferase K02853; COG: NOG06062 non
FT                   supervised orthologous group; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11309"
FT                   /db_xref="GOA:A8ACU6"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACU6"
FT                   /inference="protein motif:HMMPfam:IPR010691"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152862.1"
FT                   /protein_id="ABV11309.1"
FT                   /translation="MSLMQFSGLLVVWLLSTLFIATLTWFEFRRVRFNFNVFFSLLFLL
FT                   TFFFGFPLTSVLVFRFDVGVAPPEILLQALLSAACFYAVYYVTYKTRLRKRVTDVPRKP
FT                   LFTMNRVETHLTWVMLMGIALVSVGIFFMHNGFLLFRLHSYSQIFSSEVSGVALKRFFY
FT                   FFIPAMLVIYFLRQDSKAWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRG
FT                   WISLWMLVAAGVLGIVGMFWLALKRYGLNVSGDEAFYTFLYLTRDTFSPWENLALLLQN
FT                   YDNIDFQGLAPIVRDFYVFIPSWLWPGRPGIVLNSANYFTWEVLNNHSGLAISPTLIGS
FT                   LVVMGGALFIPLGAVAVGLIIKWFDWLYELGNRETNRYKAAILHSFCFGAIFNMIVLAR
FT                   EGLDSFVSRVVFFLVIFGACLLVAKLLFWLFDCAGLVHQRAKPQPQTQVEG"
FT   gene            133557..134297
FT                   /locus_tag="CKO_00136"
FT   CDS_pept        133557..134297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00136"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b3794 4.0e-121 wecG, rff; probable
FT                   UDP-N-acetyl-D-mannosaminuronic acid transferase; synthesis
FT                   of enterobacterial common antigen (ECA) K02852; COG:
FT                   COG1922 Teichoic acid biosynthesis proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11310"
FT                   /db_xref="GOA:A8ACU7"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACU7"
FT                   /inference="protein motif:HMMPfam:IPR004629"
FT                   /inference="protein motif:HMMTigr:IPR004629"
FT                   /inference="similar to AA sequence:REFSEQ:NP_418242.1"
FT                   /protein_id="ABV11310.1"
FT                   /translation="MTDNTTAPLYSLRGLQLIGWRDMQHALNYLFADGQMKQGTLVAIN
FT                   AEKMLTAEDDPEVRALIDAAEFKYADGISVVRSVRKKFPQAQVSRVAGADLWEELMARA
FT                   GKEGTPVFLVGGKPEVLAQTEAKLRAQWNVNIVGSQDGYFKPEQRQALFERIHASGAKI
FT                   VTVAMGSPKQEILMRDCRVIHPQALYMGVGGTYDVFTGHVKRAPKMWQTLGLEWLYRLL
FT                   SQPSRITRQLRLLRYLRWHYTGNL"
FT   gene            134504..135889
FT                   /locus_tag="CKO_00137"
FT   CDS_pept        134504..135889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C0120 2.3e-93 aroP; aromatic amino
FT                   acid transport protein AroP K03293; COG: COG1113
FT                   Gamma-aminobutyrate permease and related permeases; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11311"
FT                   /db_xref="GOA:A8ACU8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU8"
FT                   /inference="protein motif:HMMPanther:IPR002293"
FT                   /inference="protein motif:HMMPfam:IPR004841"
FT                   /inference="protein motif:ScanRegExp:IPR004840"
FT                   /inference="similar to AA sequence:INSD:AAF33457.1"
FT                   /protein_id="ABV11311.1"
FT                   /translation="MAEKKPELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSV
FT                   LLAYIVAGLFVFFIMRSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVG
FT                   ISEITAIGVYVQFWFPDMAQWIPALIAVGLVALANLAAVRLYGEIEFWFAMIKVTTIIV
FT                   MIVVGLGVIFFGFGNGGQAIGFGNLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGIT
FT                   AGEAKNPQVTLRSAVGKVLWRILIFYVGAIFVIVTIFPWNEIGSNGSPFVLTFAKIGIT
FT                   AAAGIINFVVLTAALSGCNSGMYSCGRMLYALAKNRQLPAAMAKVSRHGVPVAGVALSI
FT                   AILLIGSCLNYIIPNPQRVFVYVYSASVLPGMVPWFVILISQLRFRRAHKDAMISHPFR
FT                   SIMFPWANYLTMAFLVCVLIGMYLNEDTRMSLFVGIIFLLAVTLVYKVFGLNRAGTAHK
FT                   VGE"
FT   gene            135992..136065
FT                   /locus_tag="CKO_00138"
FT   tRNA            135992..136065
FT                   /locus_tag="CKO_00138"
FT                   /product="tRNA-Arg"
FT   gene            136123..136195
FT                   /locus_tag="CKO_00139"
FT   tRNA            136123..136195
FT                   /locus_tag="CKO_00139"
FT                   /product="tRNA-His"
FT   gene            136218..136301
FT                   /locus_tag="CKO_00140"
FT   tRNA            136218..136301
FT                   /locus_tag="CKO_00140"
FT                   /product="tRNA-Leu"
FT   gene            complement(136322..136507)
FT                   /locus_tag="CKO_00142"
FT   CDS_pept        complement(136322..136507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00142"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACU9"
FT                   /protein_id="ABV11312.1"
FT                   /translation="MRQRYRGIGKEEEEEVKTKNPAEAGFKIGRRERIRTSDPLVPNQL
FT                   RYQAALLADVLLFLNF"
FT   gene            136348..136421
FT                   /locus_tag="CKO_00141"
FT   tRNA            136348..136421
FT                   /locus_tag="CKO_00141"
FT                   /product="tRNA-Pro"
FT   gene            136745..136918
FT                   /locus_tag="CKO_00143"
FT   misc_RNA        136745..136918
FT                   /locus_tag="CKO_00143"
FT                   /product="SraJ RNA"
FT                   /note="Rfam score 224.05"
FT                   /inference="nucleotide motif:Rfam:RF00083"
FT   gene            complement(137050..138249)
FT                   /locus_tag="CKO_00144"
FT   CDS_pept        complement(137050..138249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00144"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3071 Uncharacterized enzyme of heme
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11313"
FT                   /db_xref="GOA:A8ACV0"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV0"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR010817"
FT                   /inference="protein motif:HMMPfam:IPR013105"
FT                   /inference="protein motif:HMMTigr:IPR005254"
FT                   /inference="similar to AA sequence:INSD:AAL22780.1"
FT                   /protein_id="ABV11313.1"
FT                   /translation="MMLKVLLLFVLLIAGIVIGPMIAGHQGYVLIQTDNYNIETSVTGL
FT                   VIILIVMMVILFAIEWLLRRVFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQV
FT                   EKLMAKNADHAEQPVVNYLLAAEAAQQRGDEARANQHLERAAELAGNDTIPVEIARVRL
FT                   QLARNENHAARHGVDKLLEVTPRHPEVLRLAEQAYIRTGAWSSLLDIIPSMAKANVGDE
FT                   EHRAMLEQQAWIGLMDQARADQGSEGLREWWKNQSRKTRHQVPLQVAMAEHLIECDDHD
FT                   MAQQIIIDGLKRQYDDRLVLPIPRLKTNNPEQLEKVLRQQIKTVGDRPLLWSTLGQSLM
FT                   KHGEWQEATFAFRAALKQRPDAYDYAWLADALDRLHQPEEAATMRRDGLMLTLQNNPPQ
FT                   "
FT   gene            complement(138249..139430)
FT                   /locus_tag="CKO_00145"
FT   CDS_pept        complement(138249..139430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3936 4.6e-182 hemX; uroporphyrinogen
FT                   III methylase K02496; COG: COG2959 Uncharacterized enzyme
FT                   of heme biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11314"
FT                   /db_xref="GOA:A8ACV1"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV1"
FT                   /inference="protein motif:HMMPfam:IPR007470"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00697828.1"
FT                   /protein_id="ABV11314.1"
FT                   /translation="MTEQEKSSAVVEETREAVETTPQPVNAEKKSKNGAALVLSAVAIA
FT                   IALAAGVGLYGWGKQQAVKQTATSDALVNQLTALQKAQESQKAELEGIIKQQATQLDDA
FT                   NRQQAALAKQLDEVQQKVATISGSDAKTWLLAQSDFLVKLAGRKLWSDQDVTTAAALLK
FT                   SADASLADMNDPSLIAARRAITDDIASLSAVAQVDYDGIILKVNQLSNQIDNLRLADND
FT                   TDDSPMDSDSSELSSSISEWRVNLQKSWQNFMDSFITIRRRDDTAVPLLAPNQDVYLRE
FT                   NIRSRLLVAAQAVPRHQEETYRQALDNVSTWVRAYYDTDDATTKAFLDDVDKLSQQSIT
FT                   MDVPETLQSQPILEKLMQTRVRNLLAQPAAATTEAAQAPAPQAEAPAAAPQGE"
FT   gene            complement(139452..140192)
FT                   /locus_tag="CKO_00146"
FT   CDS_pept        complement(139452..140192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3937 9.7e-118 hemD; uroporphyrinogen
FT                   III synthase K01719; COG: COG1587 Uroporphyrinogen-III
FT                   synthase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11315"
FT                   /db_xref="GOA:A8ACV2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV2"
FT                   /inference="protein motif:HMMPfam:IPR003754"
FT                   /inference="protein motif:superfamily:IPR003754"
FT                   /inference="similar to AA sequence:SwissProt:Q9L6Q3"
FT                   /protein_id="ABV11315.1"
FT                   /translation="MSILVTRPSPSGEELVSRLRTLGQVAWSFPLIEFTPGRELATLAD
FT                   RLAALTDNDLVFALSQHAVAFAHAQLQQQGLDWPVQPRYFAIGRTTALALHTVSGCDIR
FT                   YPLDREISEVLLQLPELQNIAGKRALILRGNGGRELLGKTLTERGAEVTFCECYQRSAK
FT                   HYDGAEEAMRWHSRGVTTIVVTSGEMLQQLWSLIPQWYREHWLLRCRLLVVSERLAHLA
FT                   RELGWQDIKVADNADNDALLRALQ"
FT   gene            complement(140189..141145)
FT                   /locus_tag="CKO_00147"
FT   CDS_pept        complement(140189..141145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3938 4.5e-152 hemC; porphobilinogen
FT                   deaminase (hydroxymethylbilane synthase) K01749; COG:
FT                   COG0181 Porphobilinogen deaminase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11316"
FT                   /db_xref="GOA:A8ACV3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV3"
FT                   /inference="protein motif:BlastProDom:IPR000860"
FT                   /inference="protein motif:Gene3D:IPR000860"
FT                   /inference="protein motif:HMMPanther:IPR000860"
FT                   /inference="protein motif:HMMPfam:IPR000860"
FT                   /inference="protein motif:HMMTigr:IPR000860"
FT                   /inference="protein motif:ScanRegExp:IPR000860"
FT                   /inference="protein motif:superfamily:IPR000860"
FT                   /inference="similar to AA sequence:INSD:AAF33453.1"
FT                   /protein_id="ABV11316.1"
FT                   /translation="MTVTSMLDNVLRIATRQSPLALWQAHYVKDALIAQHPGLVVELVP
FT                   MVTRGDVILDTPLAKVGGKGLFVKELEVALLEKRADIAVHSMKDVPVEFPQGLGLVTIC
FT                   EREDPRDAFVSNQYNNLDELPAGSIVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLSK
FT                   LDNGDYDAIILAVAGLKRLGLTSRIRTALPPEISLPAVGQGAVGIECRLDDARTQALLA
FT                   PLNHEETALRVKAERAMNTRLEGGCQVPIGSYAEIIDGEVWLRALVGAPDGSQMIRGER
FT                   RGLPQDAAQMGISLAEELLANGARAILTEVYNGEAPA"
FT   gene            141449..144064
FT                   /locus_tag="CKO_00148"
FT   CDS_pept        141449..144064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3620 0. cyaA; adenylate cyclase K05851;
FT                   COG: COG3072 Adenylate cyclase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11317"
FT                   /db_xref="GOA:A8ACV4"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV4"
FT                   /inference="protein motif:HMMPfam:IPR000274"
FT                   /inference="protein motif:HMMPIR:IPR000274"
FT                   /inference="protein motif:ScanRegExp:IPR000274"
FT                   /protein_id="ABV11317.1"
FT                   /translation="MVWLSALAMAIRRMTGSNIRRYVLYLYIETLKQRLDAINQLRVDR
FT                   ALAAMGPAFQQVYSLLPTLLHYHNPLMPGYLDGNVPKGICFYTPDETQRHYLNELELYR
FT                   GMSPQDPPKGELPITGVYSMGSTSSVGQSCSSDLDIWVCHQSWLDSEERQLLQRKCSLL
FT                   ESWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRIL
FT                   WNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLSAEEYFGASLWQLYKSIDSP
FT                   YKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLDPYCMMLERVTEYLTAIE
FT                   DPTRLDLVRRCFYLKVCEKLSRERACVGWRREVLSQLVNEWGWDDARLTMLDNRANWKI
FT                   DQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTL
FT                   VNPQISPDLSEPNLTFIHVPPGRANRSGWYLYNRAPNMDSIISHQPLEYNRYLNKLVAW
FT                   AWFNGLLTSRTHLFIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTPKALYSPCEIRHLA
FT                   IIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGEEQNCLVGSVDLLYRNSWNEVRTLHFNG
FT                   EQAMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRQ
FT                   ETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSVQVETNHVKLP
FT                   SVVDGFASEGIIQFFFEETGDEKGFNIYILDESNRAEVYHHCEGSKEELVRDVSRFYSS
FT                   SHDRFTYGSSFINFNLPQFYQIVNTDGREQVIPFRTQPISAVPPANQDNDAPLLQQYFS
FT                   "
FT   gene            complement(144144..144464)
FT                   /locus_tag="CKO_00149"
FT   CDS_pept        complement(144144..144464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00149"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1965 Protein implicated in iron transport,
FT                   frataxin homolog; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11318"
FT                   /db_xref="GOA:A8ACV5"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACV5"
FT                   /inference="protein motif:BlastProDom:IPR002908"
FT                   /inference="protein motif:HMMPfam:IPR002908"
FT                   /inference="protein motif:ScanRegExp:IPR002908"
FT                   /inference="similar to AA sequence:INSD:BAE77494.1"
FT                   /protein_id="ABV11318.1"
FT                   /translation="MNDSEFHRLTDTLWMTIEERLDDWDGDSDIDCEINGGVLTITFEN
FT                   GSKIIINRQEPLHQVWLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGEAVS
FT                   FR"
FT   gene            144603..144806
FT                   /locus_tag="CKO_00150"
FT   CDS_pept        144603..144806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00150"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5567 Predicted small periplasmic
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11319"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV6"
FT                   /inference="similar to AA sequence:INSD:AAO70879.1"
FT                   /protein_id="ABV11319.1"
FT                   /translation="MKNVFQALAVLLTLFSLTGCGLKGPLYFPPADKNAPPPTHEVDSQ
FT                   IQSTTPDQNDRATGDGPSQVNY"
FT   gene            144840..145667
FT                   /locus_tag="CKO_00151"
FT   CDS_pept        144840..145667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3947 1.9e-146 dapF; diaminopimelate
FT                   epimerase K01778; COG: COG0253 Diaminopimelate epimerase;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11320"
FT                   /db_xref="GOA:A8ACV7"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV7"
FT                   /inference="protein motif:HMMPfam:IPR001653"
FT                   /inference="protein motif:HMMTigr:IPR001653"
FT                   /inference="protein motif:ScanRegExp:IPR001653"
FT                   /inference="similar to AA sequence:INSD:AAX67752.1"
FT                   /protein_id="ABV11320.1"
FT                   /translation="MMQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLSDRHLGVGFDQ
FT                   LLVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDIRVSTANGR
FT                   MVLSVTDDELVRVNMGEPNFEPAQVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHCVI
FT                   QVDNIDTAAVETLGPVLESHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGA
FT                   CAAVAVGIQQGLLAEEVRVELPGGRLDIAWKGPGHPLYMTGPAAHVYDGFIHL"
FT   gene            145664..146371
FT                   /locus_tag="CKO_00152"
FT   CDS_pept        145664..146371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00152"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo0595 6.1e-05 3',5'-cyclic-nucleotide
FT                   phosphodiesterase K01120; COG: COG3159 Uncharacterized
FT                   protein conserved in bacteria; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11321"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV8"
FT                   /inference="protein motif:HMMPfam:IPR007435"
FT                   /inference="similar to AA sequence:REFSEQ:NP_807017.1"
FT                   /protein_id="ABV11321.1"
FT                   /translation="MKQPGEELQETQMELDDRAVVDYLLRNPEFFIRNARAVEAMRVPH
FT                   PVRGTVSLVEWHMARARNHIHVLEENMTLLMEQANANESLFYRLLHLQGRLVSASSLDE
FT                   MLMRFHRWARELGLAGATIRLFPDRWRLGAPSNHTHLALSRQAFEPLRIQRLGQAQHYL
FT                   GPLNGPELLVVLPEAKAIGSVAMSMLGRDGDLGVILFSSRDVHHYQQGQGTQLLQEIAL
FT                   MLPELLERWIERV"
FT   gene            146368..147270
FT                   /locus_tag="CKO_00153"
FT   CDS_pept        146368..147270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00153"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4973 Site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11322"
FT                   /db_xref="GOA:A8ACV9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACV9"
FT                   /inference="protein motif:Gene3D:IPR013762"
FT                   /inference="protein motif:HMMPfam:IPR002104"
FT                   /inference="protein motif:HMMPfam:IPR004107"
FT                   /inference="protein motif:HMMTigr:IPR011931"
FT                   /inference="protein motif:superfamily:IPR010998"
FT                   /inference="protein motif:superfamily:IPR011010"
FT                   /inference="similar to AA sequence:INSD:AAL22793.1"
FT                   /protein_id="ABV11322.1"
FT                   /translation="MTELSLSQDVARFLRYLGVERQLSPITLLNYQRQLDAIIALAGET
FT                   GLQSWQQCDAAMVRAFAVRSRRKGLGPASLALRLSALRSFFDWLVSQGELNANPAKGVS
FT                   APKAPRHLPKNIDVDDINRLLDIDLNDPLAVRDRAMLEVMYGAGLRLSELVGLDIKHLD
FT                   LDTGEVWVMGKGSKERRLPIGRNAVAWIEHWLDLRGLFGSDDDALFLSKLGKRISARNV
FT                   QKRFAEWGIKQGLNSHVHPHKLRHSFATHMLESSGDLRGVQELLGHANLSTTQIYTHLD
FT                   FQHLASVYDAAHPRAKRGK"
FT   gene            147270..147986
FT                   /locus_tag="CKO_00154"
FT   CDS_pept        147270..147986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B2556 9.3e-26 HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1 K01560; COG: COG1011
FT                   Predicted hydrolase (HAD superfamily); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11323"
FT                   /db_xref="GOA:A8ACW0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW0"
FT                   /inference="protein motif:HMMPfam:IPR005834"
FT                   /inference="protein motif:HMMTigr:IPR006439"
FT                   /inference="similar to AA sequence:INSD:BAB38165.1"
FT                   /protein_id="ABV11323.1"
FT                   /translation="MRFYRPLGHISALTFDLDDTLYDNRPVILRTEQEALTFVQNYHPA
FT                   LRTLQNADLYRLRQAVREAEPEIYHDVTRWRHRAVERAMLEAGLSAEEAMAGANAAMIN
FT                   FAKWRSRIDVPQVTHDTLKRLAKKWPLVAITNGNAQPELFGLGDYFEFVLRAGPDGRSK
FT                   PFSDMYSLAAEKLNMPIGEILHVGDDLTTDVAGAIRCGMQACWIKPENADLMQTTDSRL
FT                   LPHIEISRLASLTSLI"
FT   gene            148073..150235
FT                   /locus_tag="CKO_00155"
FT   CDS_pept        148073..150235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3850 0. uvrD; DNA-dependent ATPase I and
FT                   helicase II K03657; COG: COG0210 Superfamily I DNA and RNA
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11324"
FT                   /db_xref="GOA:A8ACW1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW1"
FT                   /inference="protein motif:HMMPanther:IPR000212"
FT                   /inference="protein motif:HMMPfam:IPR000212"
FT                   /inference="protein motif:HMMTigr:IPR005753"
FT                   /protein_id="ABV11324.1"
FT                   /translation="MDVSYLLESLNDKQREAVAAPRSNMLVLAGAGSGKTRVLVHRIAW
FT                   LLSVENNSPYSIMAVTFTNKAAAEMRHRIGQLMGTTQGGMWVGTFHGLAHRLLRAHHMD
FT                   ANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQKDEGLRPHHIQSYG
FT                   NPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRERFTNILVDEF
FT                   QDTNNIQYAWIRLLAGDTGKVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQ
FT                   NYRSTSNILSAANTLIENNNGRLGKKLWTDGIDGEPISLYCAFNELDEARFVVNRIKTW
FT                   QDNGGALEQCAILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIA
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKALAGRAASAL
FT                   QRFIELIDALAQETADMPLHVQTDRVIKDSGLRMMYEQEKGEKGQTRIENLEELVTATR
FT                   QFSYNEEDEDLMPLQAFLSHAALEAGEGQADTWQDAVQLMTLHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGE
FT                   LPEDCVEEVRLRATVSRPVSHQRMGTPMAENDTGYKLGQRVRHPKFGEGTIVNLEGSGE
FT                   HTRLQIAFQGQGIKWFVASYVQFENA"
FT   gene            complement(150192..150359)
FT                   /locus_tag="CKO_00156"
FT   CDS_pept        complement(150192..150359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11325"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW2"
FT                   /protein_id="ABV11325.1"
FT                   /translation="MRACYASKNLTSTRNETLKNNYCPSAYKASRLLQNNDIFLKVTHF
FT                   RIEHKKQQTI"
FT   gene            150595..151545
FT                   /locus_tag="CKO_00157"
FT   CDS_pept        150595..151545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00157"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0598 Mg2+ and Co2+ transporters; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11326"
FT                   /db_xref="GOA:A8ACW3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW3"
FT                   /inference="protein motif:HMMPanther:IPR002523"
FT                   /inference="protein motif:HMMPfam:IPR002523"
FT                   /inference="protein motif:HMMTigr:IPR004488"
FT                   /inference="similar to AA sequence:INSD:CAD07940.1"
FT                   /protein_id="ABV11326.1"
FT                   /translation="MLSAFQLENNRLTRLEVEESQTLIDAVWVDLVEPDDDERLRVQSE
FT                   LGQSLATRPELEDIEASARFFEDEDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTL
FT                   RERELPAFRLYRMRARNQAMVDGNAYELLLDLFETKIEQLADEIENIYSDLEELSRVIM
FT                   EGHQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWSFGYPGAIIFMILAGLAPYLYFKRKNWL"
FT   gene            complement(151624..152517)
FT                   /locus_tag="CKO_00158"
FT   CDS_pept        complement(151624..152517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00158"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2962 Predicted permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11327"
FT                   /db_xref="GOA:A8ACW4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW4"
FT                   /inference="protein motif:HMMPfam:IPR000620"
FT                   /inference="protein motif:HMMTigr:IPR004626"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218841.1"
FT                   /protein_id="ABV11327.1"
FT                   /translation="MDAKQTRQGVLLALAAYFIWGIAPAYFKLIYYVPADEILTHRVIW
FT                   SFFFMIALMSISRQWSGVKTLLQTPKKIFMLALSAVLIGGNWLLFIWAVNNHHMLEASL
FT                   GYFINPLVNILLGMLFLGERFRRMQWLAVILAACGVLVQLWTFGSLPIIALGLAFSFAF
FT                   YGLVRKKIAVEAQTGMLIETLWLLPVAAIYLFGIADSPTSHMGQNPLSLNLLLIAAGIV
FT                   TTVPLLCFTGAATRLRLSTLGFFQYIGPTLMFLLAVTFYGEIPGADKMVTFAFIWVALA
FT                   IFVMDAIYTQRRKVRG"
FT   gene            complement(152561..153046)
FT                   /locus_tag="CKO_00159"
FT   CDS_pept        complement(152561..153046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00159"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2050 Uncharacterized protein, possibly
FT                   involved in aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11328"
FT                   /db_xref="GOA:A8ACW5"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW5"
FT                   /inference="protein motif:HMMPfam:IPR006683"
FT                   /inference="protein motif:HMMTigr:IPR003736"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218842.1"
FT                   /protein_id="ABV11328.1"
FT                   /translation="MECLDRMSSVLTAEQALKLVGEMFVYHMPFNRALGLELERYEKEF
FT                   AQLAFNNQPMMVGNWAQSILHGGVIASALDVAAGLVCVGSTLTRHETISEDELRQRMSR
FT                   MGTIDLRVDYLRPGRGNRFTATSSLLRAGNKVAVARVELHNEEQLYIASATATYMVG"
FT   gene            153194..154063
FT                   /locus_tag="CKO_00160"
FT   CDS_pept        153194..154063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3602 1.8e-150 pldA; detergent-resistant
FT                   phospholipase A K01058; COG: COG2829 Outer membrane
FT                   phospholipase A; Psort location: OuterMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11329"
FT                   /db_xref="GOA:A8ACW6"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW6"
FT                   /inference="protein motif:Gene3D:IPR003187"
FT                   /inference="protein motif:HMMPfam:IPR003187"
FT                   /inference="similar to AA sequence:INSD:AAO70868.1"
FT                   /protein_id="ABV11329.1"
FT                   /translation="MRAILGWLLPAAMLPLAVYAQEATVKEIHDAPAVQGSIIANMLQV
FT                   HDNPFTLYPYDTNYLIYTNTSDLNKEAISSYNWSENARKDEVKFQLSLAFPFWRGIVGP
FT                   NSVLGASYTQKSWWQLSNSEESSPFRETNYEPQLFLGFATDYHFAGWTLRDVEMGYNHN
FT                   SNGRSDPTSRSWNRLYTRLMAQNGNWLMEVKPWYVVGGTGDNPDITKYMGYYQLKIGYH
FT                   LGDAVLSAKGQYNWNTGYGGAEVGLSYPMTKHVRLYTQVYSGYGESLIDYNFNQTRVGV
FT                   GVMLNDIF"
FT   gene            154154..155983
FT                   /locus_tag="CKO_00161"
FT   CDS_pept        154154..155983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3857 0. recQ; ATP-dependent DNA helicase
FT                   K03654; COG: COG0514 Superfamily II DNA helicase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11330"
FT                   /db_xref="GOA:A8ACW7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW7"
FT                   /inference="protein motif:HMMPanther:IPR004589"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR002121"
FT                   /inference="protein motif:HMMPfam:IPR002857"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR002121"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="protein motif:HMMTigr:IPR004589"
FT                   /inference="protein motif:HMMTigr:IPR006293"
FT                   /inference="protein motif:superfamily:IPR010997"
FT                   /protein_id="ABV11330.1"
FT                   /translation="MAQAEVLNLELGAKQVLQETFGYQQFRPGQEEIIETVVSGRDCLV
FT                   VMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQSREQQ
FT                   HEVMAGCRTGQVRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRPEYA
FT                   ALGQLRQRFPSLPFMALTATADDTTRLDIVRLLGLNDPLIQISSFDRPNIRYMLMEKFK
FT                   PLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLENNVRADVQEK
FT                   FQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFY
FT                   DPADMAWLRRCLEEKPAGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCGN
FT                   CDICLDPPKQYDGLMDARKALSTIYRVNQRFGMGYVVEVLRGANNQRIRDLAHDKLPVY
FT                   GIGRDQSHEHWVSVIRQLIHLGMVTQNIAQHSALQLTEAARPVLRGEVPLQLAVPRIVA
FT                   LKPRVMQKSFGGNYDRKLFAKLRKLRKAIADEENIPPYVVFNDATLIEMAEQMPVSPSE
FT                   MLSVNGVGMRKLERFGKEFMALIRAHVDGDDEE"
FT   gene            156047..156667
FT                   /locus_tag="CKO_00162"
FT   CDS_pept        156047..156667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00162"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1280 Putative threonine efflux protein;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11331"
FT                   /db_xref="GOA:A8ACW8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW8"
FT                   /inference="protein motif:HMMPfam:IPR001123"
FT                   /inference="protein motif:HMMTigr:IPR004778"
FT                   /inference="similar to AA sequence:INSD:EAY46699.1"
FT                   /protein_id="ABV11331.1"
FT                   /translation="MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGI
FT                   TCGVMVWAGVALLGLHLIIEKMAWLHTIIMVGGGLYLCWMGYQMLRGALKKQDVAAPAP
FT                   QIELAQSGRSFVKGLLTNLANPKAIIYFGSVFSLFVGDNVGVAARWGIFALIIVETLAW
FT                   FTVVASLFALPKMRRGYQRLAKWIDGFAGALFAGFGIHLIISR"
FT   gene            156601..156753
FT                   /locus_tag="CKO_00163"
FT   CDS_pept        156601..156753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11332"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACW9"
FT                   /protein_id="ABV11332.1"
FT                   /translation="MDRRLCRCVVCRFRHSPDYFALIIVGRISVSAIRQFLRHALRTPA
FT                   AHPPA"
FT   gene            complement(156664..156765)
FT                   /locus_tag="CKO_00164"
FT   CDS_pept        complement(156664..156765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11333"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX0"
FT                   /protein_id="ABV11333.1"
FT                   /translation="MVRCLCWWVRCWRPQGMPEKLPDGANAYPAYDN"
FT   gene            complement(156710..157330)
FT                   /locus_tag="CKO_00165"
FT   CDS_pept        complement(156710..157330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00165"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1280 Putative threonine efflux protein;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11334"
FT                   /db_xref="GOA:A8ACX1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX1"
FT                   /inference="protein motif:HMMPfam:IPR001123"
FT                   /inference="protein motif:HMMTigr:IPR004778"
FT                   /inference="similar to AA sequence:INSD:ABP62627.1"
FT                   /protein_id="ABV11334.1"
FT                   /translation="MTFEWWFAYLLTSIILSLSPGSGAINTMTTAISHSYRGATASIAG
FT                   LQTGLGIHIVLVGVGLGTLFSRSVVAFEVLKWAGAAYLIWLGIQQWRAAGAIDLNTLAH
FT                   AQSRSRLFRRAVFVNLTNPKSIVFLAALFPQFIKPQEPQLMQYVVLGITTIVVDIIVMI
FT                   GYATLATRIAGWIKGPKQMKALNKVFGSLFMLVGALLASARHA"
FT   gene            157442..158434
FT                   /locus_tag="CKO_00166"
FT   CDS_pept        157442..158434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00166"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs4755 1.8e-157 lysophospholipase L(2)
FT                   K01048; COG: COG2267 Lysophospholipase; Psort location:
FT                   CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11335"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX2"
FT                   /inference="protein motif:HMMPfam:IPR000073"
FT                   /inference="similar to AA sequence:INSD:ABP62626.1"
FT                   /protein_id="ABV11335.1"
FT                   /translation="MFQQQKDWETRENAFAAFSMGPLTDFWRQREEAEFTGVDDVPVHF
FT                   VRFHAQKNDRVIVICPGRIESYVKYAELAYDLFHLGFDVLIIDHRGQGRSGRLLSDTHR
FT                   GHVVNFNDYVDDLTAFWQQEVQSGPWRKRYILAHSMGGAIATLFLQRNAVQCDAIALCA
FT                   PMFGIVMRLPEWMVRHILDWAEGHQRIREGYAIGTGRWRALPFSMNVLTHSRQRYRRNL
FT                   RFYADEPRLRVGGPTYHWVREGILAGEQALAGAGDDATPVLLVQAEEERVVDNRAHDRF
FT                   CEIRAAAGHPVEGERPLVIKGAYHEILFEKDAMRSVALNAIVEFFDRHN"
FT   gene            158478..159278
FT                   /locus_tag="CKO_00167"
FT   CDS_pept        158478..159278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_5077 2.5e-23 hydrolase, haloacid
FT                   dehalogenase-like family; COG: COG0561 Predicted hydrolases
FT                   of the HAD superfamily; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11336"
FT                   /db_xref="GOA:A8ACX3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX3"
FT                   /inference="protein motif:HMMPfam:IPR013200"
FT                   /inference="protein motif:HMMTigr:IPR000150"
FT                   /inference="protein motif:HMMTigr:IPR006379"
FT                   /inference="protein motif:ScanRegExp:IPR000150"
FT                   /inference="similar to AA sequence:INSD:CAD07930.1"
FT                   /protein_id="ABV11336.1"
FT                   /translation="MYQVVASDLDGTLLSPDHTLSPYAKETLKLLTACGVNFVFATGRH
FT                   HVDVGQIRDNLEIKSYMITSNGARVHDTDGNLVFTHNLDRDIASDLFGVVNASPDIVTN
FT                   VYRDDEWFMNRHRPDEMRFFKEAVFHYSLFEPAMLEPEGVSKVFFTSDAHEKLLPLEQA
FT                   INARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVSKAMGYKLQDCIAFGDGMNDAEML
FT                   SMAGKGCIMGNAHQRLKDLHPGLEIIGINADDAVPHYLRKLFLR"
FT   gene            159359..160258
FT                   /locus_tag="CKO_00168"
FT   CDS_pept        159359..160258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00168"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0697 Permeases of the drug/metabolite
FT                   transporter (DMT) superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11337"
FT                   /db_xref="GOA:A8ACX4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX4"
FT                   /inference="protein motif:HMMPfam:IPR000620"
FT                   /inference="protein motif:HMMTigr:IPR004779"
FT                   /inference="similar to AA sequence:INSD:AAG59023.1"
FT                   /protein_id="ABV11337.1"
FT                   /translation="MALLIITTILWAFSFSLFGEYLAGHVDSYFAVLVRVGLAALVFLP
FT                   FLRTRGHSVKTIGLYMLVGAMQLGIMYMLSFRAYLYLTVSELLLFTVLTPLYITLIYDL
FT                   MSKRRLRWGYAFSALLAVIGAGIIRYDQVTDHFWTGLLLVQLSNISFAIGMVGYKRLME
FT                   TRPMPQHNAFAWFYVGAFLVAVVAWSMLGNAQNMPETTLQWSILIFLGVAASGIGYFMW
FT                   NYGATQVDAGTLGIMNNMHVPAGLLVNLAIWHQQPHWPSFITGALVILASLWVHRKWVA
FT                   PRSVQTADGRMRGSAPSE"
FT   gene            complement(159365..159766)
FT                   /locus_tag="CKO_00169"
FT   CDS_pept        complement(159365..159766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00169"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11338"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX5"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00701836.1"
FT                   /protein_id="ABV11338.1"
FT                   /translation="MIGNLVVTNNPSADDRQQRAEGITPAQATLAHQIINQRDIKRRED
FT                   GKQQQFGDRQIEIGAETQHIHNAKLHRPHQHIQANGFYAMPTGTQKWEKHQRCQPNTHQ
FT                   HRKIAINMTREILAEQAKGEGPQDSGNDE"
FT   gene            complement(160146..161099)
FT                   /locus_tag="CKO_00170"
FT   CDS_pept        complement(160146..161099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 1.1e-11 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11339"
FT                   /db_xref="GOA:A8ACX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX6"
FT                   /inference="protein motif:FPrintScan:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:ABF05695.1"
FT                   /protein_id="ABV11339.1"
FT                   /translation="MIEIKHLKTLQALRNSGSLAAAAATLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTPQGEILLQLANQVLPQISRALQACNEPQQTRLRIAIECHSCIQWL
FT                   TPALENFHARWPQVEMDFKSGVTFDPQPALQQGELDLVMTSDILPRSGLHYSPMFDFEV
FT                   RLVLAPDHPLASKTQITPEDLASETLLIYPVQRSRLDVWRHFLQPAGISPSLKNVDNTL
FT                   LLIQMVAARMGIAALPHWVVESFERQGLVVTKTLGDGLWSRLYAAVRDGEQRQAVTEAF
FT                   IRSARNHACDHLPFVRSAERPTSDVPTGKPVSQARL"
FT   gene            161348..163609
FT                   /locus_tag="CKO_00171"
FT   CDS_pept        161348..163609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW3805 0. metE;
FT                   5-methyltetrahydropteroyltriglutamate- homocysteine
FT                   S-methyltransferase K00549; COG: COG0620 Methionine
FT                   synthase II (cobalamin-independent); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11340"
FT                   /db_xref="GOA:A8ACX7"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACX7"
FT                   /inference="protein motif:BlastProDom:IPR002629"
FT                   /inference="protein motif:HMMPfam:IPR002629"
FT                   /inference="protein motif:HMMPfam:IPR013215"
FT                   /inference="protein motif:HMMTigr:IPR006276"
FT                   /inference="protein motif:superfamily:IPR011254"
FT                   /protein_id="ABV11340.1"
FT                   /translation="MTIRNHTLGFPRVGLRRELKKAQESYWAGNATREDLLATGRELRA
FT                   RHWDQQKQAGIDLLPVGDFAWYDHVLTTSLLLGNVPARHQNSDGSVDIDTLFRIGRGRA
FT                   PTGEPAAAAEMTKWFNTNYHYMVPEFVKGQQFKLTWTQLLDEVDEALALGHKVKPVLLG
FT                   PVTYLWLGKVKGESFDRLSLLNDILPVYKQVLTELAKRGVEWVQIDEPALVLELPQEWL
FT                   DAYKPAYDALQGQVKLLLTTYFEGVTPNLDTIAALPVQGLHVDLVHGKDDVAELHKRLP
FT                   SDWLLSAGLVNGRNVWRADLTEKYAQIKDIVGKRDLWVASSCSLLHSPIDLSVETRLDA
FT                   EVKSWFAFALQKCGELALLRDALNSGDTAKLEAWSAPIQARRHSTRVHNAAVEKRLAAI
FT                   TAQDSQRASPYAARAQAQRNRFNLPSWPTTTIGSFPQTTEIRGLRLDFKKGNLDANHYR
FT                   TGIAEHIKQAIVEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCV
FT                   KPPVVIGDVSRPEPITVEWAKYAQSLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQ
FT                   IALALRDEVADLEAAGIGIIQIDEPALREGLPLRRSDWDAYLQWGVEAFRINAAVAKDD
FT                   TQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEEFEYPNEIGPGVYDIH
FT                   SPNVPSVEWIEALLNKAAQRIPAERLWVNPDCGLKTRGWPETRAALANMVKAAQNLRQA
FT                   "
FT   gene            complement(163706..164515)
FT                   /locus_tag="CKO_00172"
FT   CDS_pept        complement(163706..164515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3967 3.7e-134 dlhH; putative
FT                   dienelactone hydrolase family K01061; COG: COG0412
FT                   Dienelactone hydrolase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11341"
FT                   /db_xref="GOA:A8ACX8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX8"
FT                   /inference="protein motif:HMMPfam:IPR002925"
FT                   /inference="similar to AA sequence:INSD:AAO70858.1"
FT                   /protein_id="ABV11341.1"
FT                   /translation="MTTIQQSGFAPAASPLATTTVHTPDDAIIAGVTSIPTQGDEMPAW
FT                   HARPKVNDGALPVVIVVQEIFGVHEHIRDVCRRLALEGYLAIAPELYFREGDPNDFADI
FT                   PTLLSGLVAKVPDSQVLADLDHVASWASRNGGDVHRLMITGFCWGGRITWLYAAHNPQL
FT                   KAAVAWYGKLVGDKTLNSPRHPVDIATDLNAPVLGLYGGQDTGIPVDTVETMRQALRAA
FT                   NAKAEIVVYPDAGHAFNADYRPSYHEESAKDGWQRMLEWFAQYGGKK"
FT   gene            164774..165535
FT                   /locus_tag="CKO_00173"
FT   CDS_pept        164774..165535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_4040 4.6e-127 uridine phosphorylase
FT                   K00757; COG: COG2820 Uridine phosphorylase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11342"
FT                   /db_xref="GOA:A8ACX9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACX9"
FT                   /inference="protein motif:HMMPfam:IPR000845"
FT                   /inference="protein motif:HMMTigr:IPR010058"
FT                   /inference="protein motif:ScanRegExp:IPR000845"
FT                   /inference="similar to AA sequence:INSD:ABP62617.1"
FT                   /protein_id="ABV11342.1"
FT                   /translation="MSKSDVFHLGLTKNDLQGATLAIVPGDPERVEKIAALMEKPVKLA
FT                   SHREFTTWRAELDGKAIIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPHINV
FT                   GDVLVTTASVRLDGASLHFAPMEFPAVADFECTTALVEAAKSVGATTHVGVTASSDTFY
FT                   PGQERYDTFSGRVVRRFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKQTESHAVKIVVEAARRLL"
FT   gene            complement(164819..165691)
FT                   /locus_tag="CKO_00175"
FT   CDS_pept        complement(164819..165691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11344"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY0"
FT                   /inference="similar to AA sequence:INSD:AAN83205.1"
FT                   /protein_id="ABV11344.1"
FT                   /translation="MIVISTTPPASRNYPHKIELCCINVQFERVFLRGATQKEKAERVG
FT                   LSWGREELQQTTRCFHDNFHRMAFGLFHRFRIRDLLLSAVNDNARHHTGTQTLACAHGQ
FT                   QRGGFHFVVHDAHRLPLFHRTFETTNDAAREGVVTFLTRIEGVRRGGNANVSGRAHGFR
FT                   RFNQRSRTFKIGDGRELHRRKVQARSVQTYRRGCDQHIAHVDMRLNSASGADTQESTNT
FT                   QLRQFLYRNRGGRAANTGRADDDSFTIQLSTPGGEFAMRCQLNRLFHQRGDLFHTLRVA
FT                   RDDSQRSPL"
FT   gene            165672..167102
FT                   /locus_tag="CKO_00174"
FT   CDS_pept        165672..167102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB0915 2.3e-05 sbcC; putative
FT                   ATP-dependent dsDNA exonuclease K03546; COG: COG1322
FT                   Uncharacterized protein conserved in bacteria; Psort
FT                   location: OuterMembrane, score:9.49"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11343"
FT                   /db_xref="GOA:A8ACY1"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY1"
FT                   /inference="protein motif:HMMPfam:IPR003798"
FT                   /inference="similar to AA sequence:INSD:BAE77469.1"
FT                   /protein_id="ABV11343.1"
FT                   /translation="MVDITIILYAVLALAGVGVGWLIASYQQAQHKAEQLAEREEIVAS
FT                   LSAARQQVALSEHWREECELLNNELRNLRDINTSLEADLREVTTRLEATQLHAEDKIRQ
FT                   MINSEQRLSEQFENLANRIFEQSNRRVDEQNRQSLNSLLTPLREQLDGFRRQVQDSFGQ
FT                   EARERHTLAHEIRNLQQLNAQMTQEAVNLTRALKGDNKTQGNWGEVVLTRVLEASGLRE
FT                   GYEYETQVSIENDARSRMQPDVIVRLPQGKDVVIDAKMTLVAYERYFNAEDEYTRESAL
FT                   QEHIASVRNHIRLLGRKDYQQLPGLRTLDYVLMFIPVEPAFLLALDRQPELITEALKNN
FT                   IMLVSPTTLLVALRTIANLWRYEHQSRNAQHIADRASKLYDKMRLFIDDMSSIGQSLDK
FT                   AQDNYRQAMKKLSSGRGNVLAQAEAFRELGVEIKREINPDLVERATSQDEEYRLRAVPE
FT                   DQQDTPCADDERVNQQSH"
FT   gene            167197..167952
FT                   /locus_tag="CKO_00176"
FT   CDS_pept        167197..167952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY3589 8.1e-130 ubiE;
FT                   ubiquinone/menaquinone biosynthesis methyltransferase UbiE
FT                   K03183; COG: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11345"
FT                   /db_xref="GOA:A8ACY2"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACY2"
FT                   /inference="protein motif:HMMPanther:IPR004033"
FT                   /inference="protein motif:HMMPfam:IPR004033"
FT                   /inference="protein motif:HMMTigr:IPR004033"
FT                   /inference="protein motif:ScanRegExp:IPR004033"
FT                   /inference="similar to AA sequence:INSD:AAF33422.1"
FT                   /protein_id="ABV11345.1"
FT                   /translation="MVEDSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSF
FT                   GIHRLWKRFTIDCSGVRRGQTVLDLAGGTGDLTAKFSRLVGETGNVILADINDSMLKMG
FT                   REKLRNIGVIGNVKYVQANAEALPFPDNTFDCITISFGLRNVTEKEKALRSMYRVLKPG
FT                   GRLLVLEFSKPIIEPLSKAYDAYSFHILPRIGSVVANDADSYRYLAESIRMHPDQDTLK
FT                   AMMQDAGFESVDYYNLTAGVVALHRGYKF"
FT   gene            167966..168571
FT                   /locus_tag="CKO_00177"
FT   CDS_pept        167966..168571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00177"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3165 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11346"
FT                   /db_xref="GOA:A8ACY3"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY3"
FT                   /inference="protein motif:HMMPfam:IPR010668"
FT                   /inference="similar to AA sequence:INSD:EAY46688.1"
FT                   /protein_id="ABV11346.1"
FT                   /translation="MPFTPFVTAGIENLLNTFLYRSPALKSARARLQDKVLRVELKGFS
FT                   TPLVLVFSERQVDVLGAWEGEADCTVITHASVLPELRDRQRLTALIRSGELEVQGDIQV
FT                   VQNFVALADLAEFDPAELLAPYTGDIAAEGISKVLRGGAKFLRHNIQRQQRYIAEAMTE
FT                   EWRMAPGPLEVAWFAEETAAVERAVDALTKRLEKLEAK"
FT   gene            168568..170208
FT                   /locus_tag="CKO_00178"
FT   CDS_pept        168568..170208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_0086 6.9e-204 ubiB; 2-polyprenylphenol
FT                   6-hydroxylase K00492; COG: COG0661 Predicted unusual
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11347"
FT                   /db_xref="GOA:A8ACY4"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACY4"
FT                   /inference="protein motif:HMMPfam:IPR004147"
FT                   /inference="protein motif:HMMTigr:IPR010232"
FT                   /inference="protein motif:superfamily:IPR011009"
FT                   /inference="similar to AA sequence:REFSEQ:YP_859438.1"
FT                   /protein_id="ABV11347.1"
FT                   /translation="MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMP
FT                   NRHKDKPLGERLRLALQELGPVWIKFGQMLSTRRDLFPPQIADQLALLQDKVAPFDGAL
FT                   AKAQIEEAMGGLPVEEWFDDFDIQPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVI
FT                   KADLKLIYRLARWVPRLLPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEN
FT                   SPMLYVPEVYSDYCSQDMMVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFR
FT                   DSFFHADMHPGNIFVSYEHPENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKV
FT                   AELHVDSGWVPPDTNVEEFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQ
FT                   PQLVLLQKTLLYVEGVGRQLYPQLDLWKTAKPFLESWIKDQVGIPALTRALKEKAPFWV
FT                   EKMPEIPELVYDSLRQGKYLQHSVDKIARELQENHVRQGQSRYLLGIGATLLLSGTFLL
FT                   VSRPEWGLMPCWLMAGGLVAWLIGWRKTR"
FT   gene            170282..170548
FT                   /locus_tag="CKO_00179"
FT   CDS_pept        170282..170548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00179"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1826 Sec-independent protein secretion
FT                   pathway components"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11348"
FT                   /db_xref="GOA:A8ACY5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY5"
FT                   /inference="protein motif:HMMPfam:IPR003369"
FT                   /inference="protein motif:HMMTigr:IPR006312"
FT                   /inference="similar to AA sequence:INSD:CAD07919.1"
FT                   /protein_id="ABV11348.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSD
FT                   DDAKQDKTSQDADFTAKSIADKQGEAQGEAKKEDAKSHDKEQV"
FT   gene            170552..171100
FT                   /locus_tag="CKO_00180"
FT   CDS_pept        170552..171100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spi:MGAS10750_Spy0910 0.0077 lplB;
FT                   lipoate-protein ligase A K01932; COG: COG1826
FT                   Sec-independent protein secretion pathway components"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11349"
FT                   /db_xref="GOA:A8ACY6"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY6"
FT                   /inference="protein motif:FPrintScan:IPR003998"
FT                   /inference="protein motif:HMMTigr:IPR003998"
FT                   /inference="similar to AA sequence:SwissProt:P57048"
FT                   /protein_id="ABV11349.1"
FT                   /translation="MFDIGFSELLLVFVIGLIVLGPQRLPVAVKTVAGWVRALRSLATT
FT                   VQNELTQELKLQEFQDSLKKVEKASLQNLTPELKASMDELRQAAESMKRSYSANDPEKA
FT                   SDEAHTIHNPVVKDNEAQHEGVTPAAAETQANSPEQTPETADAGQPEQTEAASVNEMDA
FT                   EKKSAATVVESSPSSSDKS"
FT   gene            171103..171882
FT                   /locus_tag="CKO_00181"
FT   CDS_pept        171103..171882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00181"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0805 Sec-independent protein secretion
FT                   pathway component TatC; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11350"
FT                   /db_xref="GOA:A8ACY7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY7"
FT                   /inference="protein motif:FPrintScan:IPR002033"
FT                   /inference="protein motif:HMMPfam:IPR002033"
FT                   /inference="protein motif:HMMTigr:IPR002033"
FT                   /inference="protein motif:ScanRegExp:IPR002033"
FT                   /inference="similar to AA sequence:INSD:AAF33418.1"
FT                   /protein_id="ABV11350.1"
FT                   /translation="MAVDDTQPLITHLIELRKRLLNCIIAVIVIFLALVYFANDIYHMV
FT                   AAPLIEQMPQGATMIATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHER
FT                   RLVVPLLVSSSLLFYIGMAFAYFVVFPLAFGFLANTAPQGVQVSTDIASYLSFVMALFM
FT                   AFGVSFEVPVAIVLLCWMGVTTPEDLRKKRPYVVVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YCLFEVGVFFSRFYVGKRRPREEDDEAETEQAGKTEE"
FT   gene            171912..172706
FT                   /locus_tag="CKO_00182"
FT   CDS_pept        171912..172706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S3836 8.9e-124 yigW; putative Mg-dependent
FT                   DNase K03424; COG: COG0084 Mg-dependent DNase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11351"
FT                   /db_xref="GOA:A8ACY8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACY8"
FT                   /inference="protein motif:HMMPanther:IPR001130"
FT                   /inference="protein motif:HMMPfam:IPR001130"
FT                   /inference="protein motif:HMMPIR:IPR012278"
FT                   /inference="protein motif:ScanRegExp:IPR001130"
FT                   /inference="similar to AA sequence:INSD:AAN45352.2"
FT                   /protein_id="ABV11351.1"
FT                   /translation="MGGSMFDIGVNLTSSQFVKDRDDVVTRALAAGVSGMLLTGTNLHE
FT                   SQQAQKLAQRYACCWSTAGVHPHDSSQWQSETEDAIVALARQPDVVAIGECGLDFNRNF
FT                   STPQEQERAFQAQLRIAAELQMPVFMHCRDAHARFLALLEPWLDKLPGAVLHCFTGTRE
FT                   EMQECIDRGLYIGITGWVCDERRGLELRELLPFIPAEKLLIETDAPYLLPRDLTPKPAS
FT                   RRNEPAHLAHILARVAHWRGEDPQWLAATTDANVKTLFGIAF"
FT   gene            complement(172714..173202)
FT                   /locus_tag="CKO_00183"
FT   CDS_pept        complement(172714..173202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00183"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11352"
FT                   /db_xref="GOA:A8ACY9"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACY9"
FT                   /inference="protein motif:HMMPfam:IPR001062"
FT                   /inference="protein motif:HMMSmart:IPR006645"
FT                   /inference="protein motif:HMMTigr:IPR010215"
FT                   /inference="similar to AA sequence:INSD:AAV79594.1"
FT                   /protein_id="ABV11352.1"
FT                   /translation="MQSWYLLYCKRGQLQRAQEHLERQAVNCLTPMITLEKMVRGKRTA
FT                   VSEPLFPNYLFVEFDPEVIHTTTINATRGVSHFVRFGAHPATVPSNVIHQLSVYKPEGV
FT                   VDPETPYPGDSVIITEGAFEGLKAIFTEPDGEARSMLLLNLLNKEVKQSVKNTAFRKV"
FT   gene            173446..174930
FT                   /locus_tag="CKO_00184"
FT   CDS_pept        173446..174930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S3833 4.9e-265 yigC; putative
FT                   oxidoreductase K03182; COG: COG0043
FT                   3-polyprenyl-4-hydroxybenzoate decarboxylase and related
FT                   decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11353"
FT                   /db_xref="GOA:A8ACZ0"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACZ0"
FT                   /inference="protein motif:HMMPfam:IPR002830"
FT                   /inference="protein motif:HMMTigr:IPR002830"
FT                   /inference="protein motif:superfamily:IPR009010"
FT                   /inference="similar to AA sequence:INSD:AAP18844.1"
FT                   /protein_id="ABV11353.1"
FT                   /translation="MKYHDLRDFLTLLEQQGELKRITLAVDPHLEMTEIADRTLRAGGP
FT                   ALLFENPKGYAMPVLCNLFGTPRRVAMGMGQEDVTALREVGKLLAFLKEPEPPKGFRDL
FT                   FDKLPQFKQVLNMPTKRLRGAPCQQKVFSGDDVDLQRIPIMTCWPEDAAPLITWGLTVT
FT                   RGPHKERQNLGIYRQQLIGKNKLIMRWLSHRGGALDFQEWCAAHPGERFPIAVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGTKTEVVKCLSSDLEVPASAEIVLEGYIEPGEMAA
FT                   EGPYGDHTGYYNEVDNFPVFTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPI
FT                   LQKQFPEIVDFYLPPEGCSYRLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCD
FT                   DDVNARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFASPISGLGSKMGLDATNKWPG
FT                   ETQREWGRPIKKDPEVTARIDAIWDELAIFNDGKGA"
FT   gene            174972..175673
FT                   /locus_tag="CKO_00185"
FT   CDS_pept        174972..175673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3877 2.0e-119 fre; FMN reductase
FT                   K05368:K03180; COG: COG0543 2-polyprenylphenol hydroxylase
FT                   and related flavodoxin oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11354"
FT                   /db_xref="GOA:A8ACZ1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACZ1"
FT                   /inference="protein motif:FPrintScan:IPR001221"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR008333"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218864.1"
FT                   /protein_id="ABV11354.1"
FT                   /translation="MTTLSCKVTSVEAITDTVYRVRLVPDAAFSFRAGQYLMVVMDERD
FT                   KRPFSMASTPDEHGFIELHIGASELNLYAMAVMDRILKDREIVVDIPHGEAWLRDDEER
FT                   PLILIAGGTGFSYVRSILLTALARNPNRDVTIYWGGREEKHLYDLAELEALSVQHPNLR
FT                   VEPVVEQPEEGWRGRTGTVLTAVLQDHGTLAGHDIYIAGRFEMAKIARDLFCNERNARE
FT                   DRLFGDAFAFI"
FT   gene            complement(175666..175818)
FT                   /locus_tag="CKO_00186"
FT   CDS_pept        complement(175666..175818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11355"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACZ2"
FT                   /protein_id="ABV11355.1"
FT                   /translation="MQAGQAKRPRRPCRMTTLRRLIRPTTQMPLYNNLVAVLPACQGRV
FT                   FLLLR"
FT   gene            complement(175830..176999)
FT                   /locus_tag="CKO_00187"
FT   CDS_pept        complement(175830..176999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4430 4.2e-197 fadA; 3-ketoacyl-CoA
FT                   thiolase K00632; COG: COG0183 Acetyl-CoA acetyltransferase;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11356"
FT                   /db_xref="GOA:A8ACZ3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACZ3"
FT                   /inference="protein motif:HMMPanther:IPR002155"
FT                   /inference="protein motif:HMMPfam:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR012805"
FT                   /inference="protein motif:ScanRegExp:IPR001412"
FT                   /inference="protein motif:ScanRegExp:IPR002155"
FT                   /inference="similar to AA sequence:SwissProt:A1AI32"
FT                   /protein_id="ABV11356.1"
FT                   /translation="MEQVVIVDAIRTPMGRSKGGAFRNVRAEDLSAHLMRSLLARNPAL
FT                   EATAIDDIYWGCVQQTLEQGFNIARNAALLAEIPHSVPAVTVNRLCGSSMQALHDAARM
FT                   IMTGDAQTCLIGGVEHMGHVPMSHGVDFHPGLSRNVAKAAGMMGLTAEMLSRMHGISRE
FT                   MQDAFAARSHARAWAATQSGAFKNEIIPTGGHDADGVLKQFSYDEVIRPETTVEALSTL
FT                   RPAFDPVSGTVTAGTSSALSDGAAAMLVMSESRARELGLQPRARIRSMAVVGCDPSIMG
FT                   YGPVPASKLALKKAGLAASDIDLFEMNEAFAAQILPCIKDLGLMEQIDEKINLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMERKDAQFGLATMCIGLGQGIATVFERVQS"
FT   gene            complement(177009..179198)
FT                   /locus_tag="CKO_00188"
FT   CDS_pept        complement(177009..179198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3983 0. fadB; enoyl-CoA hydratase /
FT                   dodecenoyl-CoA delta-isomerase / 3-hydroxyacyl-CoA
FT                   dehydrogenase / 3-hydroxybutyryl-CoA epimerase
FT                   K00022:K01692:K01782:K01825; COG: COG1250 3-hydroxyacyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11357"
FT                   /db_xref="GOA:A8ACZ4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACZ4"
FT                   /inference="protein motif:Gene3D:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR001753"
FT                   /inference="protein motif:HMMPfam:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR006176"
FT                   /inference="protein motif:HMMTigr:IPR012799"
FT                   /inference="protein motif:ScanRegExp:IPR001753"
FT                   /inference="protein motif:ScanRegExp:IPR006180"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /protein_id="ABV11357.1"
FT                   /translation="MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDV
FT                   LEKQTDLKGLLLRSNKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVP
FT                   TLSAINGYALGGGCECVLATDYRLVTPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSA
FT                   LEIIAAGKDIGAEQALKIGLVDGVVKPEKLLDGAIAVLRQAIDGSLDWKAKRQPKLEPL
FT                   KLSKIEAAMSFTIAKGMVAQTAGKHYPAPMIAVKTIEAAARFGREEALNLENKSFVPLA
FT                   HTNEARALVGIFLNDQFVKGKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVI
FT                   MKDINDKSLTLGMTEAAKLLNKQLERGRIDGLKLAGVISTIHPTLNYAGFDRVDVVVEA
FT                   VVENPKVKKAVLAETEDNVRPDTVLASNTSTIPISELASALKRPENFCGMHFFNPVHRM
FT                   PLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDG
FT                   ADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALF
FT                   DASRYGQKNGLGFWRYKEDSKGKPKKEEDAAVDSLLAEVSQPKRDFSDEEIIARMMIPM
FT                   VNEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLG
FT                   PLYEVPEGLRNKARHNEPYYPPVEPARPVGDLKTA"
FT   gene            complement(179042..179323)
FT                   /locus_tag="CKO_00189"
FT   CDS_pept        complement(179042..179323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG ecc:c4793 0.00031 fadB; fatty oxidation complex
FT                   alpha subunit K00022:K01692:K01782:K01825"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACZ5"
FT                   /protein_id="ABV11358.1"
FT                   /translation="MISAERDRIGIFLISHLHFFNTKYTLVSSGMTRSPCGFRRLTCFT
FT                   KATPCTSTGWKMASPNWCSMPQDRSINSTLRPSPASARRWTCWKSKQI"
FT   gene            179387..180718
FT                   /locus_tag="CKO_00190"
FT   CDS_pept        179387..180718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM3984 4.2e-236 pepQ; proline dipeptidase
FT                   K01271; COG: COG0006 Xaa-Pro aminopeptidase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11359"
FT                   /db_xref="GOA:A8ACZ6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ACZ6"
FT                   /inference="protein motif:Gene3D:IPR000994"
FT                   /inference="protein motif:HMMPanther:IPR000994"
FT                   /inference="protein motif:HMMPfam:IPR000994"
FT                   /inference="protein motif:ScanRegExp:IPR001131"
FT                   /inference="similar to AA sequence:REFSEQ:YP_152911.1"
FT                   /protein_id="ABV11359.1"
FT                   /translation="MESLAALYKNHIVTLQERTRDALARFKLDALLIHSGELINVFLDD
FT                   HPYPFKVNPQFKAWVPVTQVPNCWLLVDGVNKPKLWFYLPVDYWHNVEPLPTSFWTEEV
FT                   EVIALPKADGIGSQLPAARGNIGYIGPVPERALQLDIAASNINPKGVIDYLHYYRAYKT
FT                   DYELACMREAQKTAVNGHRAAEEAFRSGMSEFDINLAYLTATGHRDTDVPYSNIVALNE
FT                   HASVLHYTKLDHRAPSEMRSFLLDAGAEYNGYAADLTRTWAANNDTDYAQLIKDVNDEQ
FT                   LALIATMKAGVSYVDYHIQFHQRIAKLLRKHQIVTDISEEAMVENNLTGPFMPHGIGHQ
FT                   LGLQVHDVAGFMQDDTGTHLAAPSKYPYLRCTRVLQPRMVLTIEPGIYFIESLLAPWRE
FT                   GQFSKHFNWQKIEALKPFGGIRIEDNVVIHENGVENMTRDLKLA"
FT   gene            180718..181332
FT                   /locus_tag="CKO_00191"
FT   CDS_pept        180718..181332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C4433 7.5e-95 yigZ; hypothetical
FT                   protein K00560; COG: COG1739 Uncharacterized conserved
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11360"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACZ7"
FT                   /inference="protein motif:HMMPfam:IPR001498"
FT                   /inference="protein motif:HMMTigr:IPR001498"
FT                   /inference="protein motif:ScanRegExp:IPR001498"
FT                   /inference="protein motif:superfamily:IPR009022"
FT                   /inference="similar to AA sequence:REFSEQ:YP_218869.1"
FT                   /protein_id="ABV11360.1"
FT                   /translation="MDSWLIPAAPVTVEEEIKKSRFITLLAHTDGVEAAKAFVDAVRAA
FT                   HPDARHHCVAWVAGAPDDSQQLGFSDDGEPAGTAGKPMLAQLMGSGVGEITAVVVRYYG
FT                   GILLGTGGLVKAYGGGVNQALRQLTTQRKTPLTEYTLQCEYGQLAGIEALLGQFAGQIV
FT                   TSDYQAFVRLRVALPYANVDEFSARLADFSRGSLQLLAIEE"
FT   gene            181370..182821
FT                   /locus_tag="CKO_00192"
FT   CDS_pept        181370..182821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0031 2.9e-77 potassium uptake
FT                   protein, TrkH family K00961; COG: COG0168 Trk-type K+
FT                   transport systems, membrane components; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11361"
FT                   /db_xref="GOA:A8ACZ8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACZ8"
FT                   /inference="protein motif:HMMPfam:IPR003445"
FT                   /inference="protein motif:HMMTigr:IPR004772"
FT                   /inference="similar to AA sequence:INSD:AAV79601.1"
FT                   /protein_id="ABV11361.1"
FT                   /translation="MHFRAITRIVGLLVILFSGTMILPGLVALIYRDGAGRAFTQTFFV
FT                   ALVIGSLLWWPNRREKGELKSREGFLIVVLFWTVLGSVGALPFIFSESPNLTITDAFFE
FT                   SFSGLTTTGATTLVGLDSLPHAILFYRQMLQWFGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTVACALALWFAGMPAFDAIGHSFSTIAIGG
FT                   FSTHDASVGYFDSPTINSIMAIFLLISGCNYGLHFSLLSGRSLKVYWRDPEFRMFIGVQ
FT                   LTLVVICTLVLWFHDIYNSALTTLNQAFFQVVSMATTAGFTTDSIARWPLFLPVLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFKQGNRELKRLVHPNAVYSIKLGHRALPERILEAVWG
FT                   FFSAYALVFIVSMLAIIATGVDDFSAFASVVATLNNLGPGLGVVADNFASMNPVAKWIL
FT                   IANMLFGRLEVFTLLVLFTPTFWRE"
FT   gene            182833..183378
FT                   /locus_tag="CKO_00193"
FT   CDS_pept        182833..183378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3883 2.3e-86 hemG; protoporphyrin
FT                   oxidase K00230; COG: COG4635 Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11362"
FT                   /db_xref="GOA:A8ACZ9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8ACZ9"
FT                   /inference="protein motif:ScanRegExp:IPR001226"
FT                   /inference="similar to AA sequence:INSD:AAX67789.1"
FT                   /protein_id="ABV11362.1"
FT                   /translation="MKTLILFSTRDGQTREIASYLASELKELGIWADVINLHRTEELDW
FT                   QSYDRVVIGASIRYGHYHAAFQEFVKKHATRLNAMPSAFYSVNLVARKPEKRTPQTNSY
FT                   ARKFLMSAQWRPDLCAVIAGALRYPRYRWYDRLMIKLIMKMSGGETDTSKEVVYTDWEQ
FT                   VANFARDIAQLTNKSLAK"
FT   unsure          183389..188940
FT                   /note="Unresolved repeat"
FT   gene            183783..184314
FT                   /locus_tag="CKO_00194"
FT   rRNA            183783..184314
FT                   /locus_tag="CKO_00194"
FT                   /product="small subunit ribosomal RNA"
FT                   /note="Rfam score 354.21; 5' domain"
FT                   /inference="nucleotide motif:Rfam:RF00177"
FT   gene            185385..185457
FT                   /locus_tag="CKO_00195"
FT   tRNA            185385..185457
FT                   /locus_tag="CKO_00195"
FT                   /product="tRNA-Glu"
FT   gene            185648..188554
FT                   /locus_tag="CKO_05140"
FT   rRNA            185648..188554
FT                   /locus_tag="CKO_05140"
FT                   /product="23S ribosomal RNA"
FT                   /note="Gene model created based on homology with SPA4016"
FT   gene            188754..188869
FT                   /locus_tag="CKO_00196"
FT   rRNA            188754..188869
FT                   /locus_tag="CKO_00196"
FT                   /product="5S ribosomal RNA"
FT                   /note="Rfam score 84.4"
FT                   /inference="nucleotide motif:Rfam:RF00001"
FT   gene            189051..190400
FT                   /locus_tag="CKO_00197"
FT   CDS_pept        189051..190400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:orf19.2425 8.7e-05 highly conserved
FT                   hypothetical protein K01804; COG: COG0477 Permeases of the
FT                   major facilitator superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11363"
FT                   /db_xref="GOA:A8AD00"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD00"
FT                   /inference="protein motif:HMMPfam:IPR005828"
FT                   /inference="protein motif:HMMTigr:IPR004736"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311481.1"
FT                   /protein_id="ABV11363.1"
FT                   /translation="MKSTDELGWIFGGSIFLMTESSVTVNGSLASSDTRRRVWAIVGAS
FT                   SGNLVEWFDFYVYSFCSLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIA
FT                   DKHGRKKSMLLSVCMMCMGSLVIACLPGYATIGTWAPALLLLARLFQGLSVGGEYGTSA
FT                   TYMSEVAVEGRKGFYASFQYVTLIGGQLLALLVVVILQQTLEESSLREWGWRIPFALGA
FT                   VLAVVALWLRRQLDETSKQETRALKEAGSLKGLWRNRKAFIMVLGFTAAGSLCFYTFTT
FT                   YMQKYLVNTAGMHANVASGIMTAALFVYMIIQPLFGALSDKIGRRTSMLCFGALAALFT
FT                   VPILSALQNVTSPYAAFGLVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVAN
FT                   ALFGGSAEYVALSLKSVGMETSFFWYVTIMAIVAFLVSLMLHRKGKGLRL"
FT   gene            complement(190397..190669)
FT                   /locus_tag="CKO_00198"
FT   CDS_pept        complement(190397..190669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00198"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5544 Predicted periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11364"
FT                   /db_xref="InterPro:IPR017028"
FT                   /db_xref="InterPro:IPR018736"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD01"
FT                   /inference="similar to AA sequence:INSD:ABR78319.1"
FT                   /protein_id="ABV11364.1"
FT                   /translation="MSNDSWSGQDKAQHFITSAMLSAAGNEYARHQGMSHDRSATVGLL
FT                   FSISLGASKEMWDSRPGGSGWSWKDFAWDVAGATTGYAVWQMARN"
FT   gene            complement(190769..192124)
FT                   /locus_tag="CKO_00199"
FT   CDS_pept        complement(190769..192124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0265 5.2e-238 pssA;
FT                   CDP-diacylglycerol-serine O-phosphatidyltransferase K00998;
FT                   COG: COG1502
FT                   Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
FT                   n synthases and related enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11365"
FT                   /db_xref="GOA:A8AD02"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR016270"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD02"
FT                   /inference="protein motif:HMMPfam:IPR001736"
FT                   /inference="protein motif:HMMSmart:IPR001736"
FT                   /inference="similar to AA sequence:INSD:AAL21546.1"
FT                   /protein_id="ABV11365.1"
FT                   /translation="MLSKFKRNKHQQHLAQLPKISQPVDDVDFFYAPANFRETLLEKIA
FT                   SATQRICIIALYLEQDDGGKGILDALYEAKRQRPELDVRVLVDWHRAQRGRIGAAASNT
FT                   NADWYCRMAQENPGIDIPVYGVPINTREALGVLHFKGFIIDDSVLYSGASLNDVYLHQH
FT                   DKYRYDRYQLIRNAKMADIMYEWVTQNLLNGRGVNRLDSAQRPKSPEIKNDIRLYRQEL
FT                   RDASYHFQGDADNEQLSVTPLVGLGKSSLLNKTIFHLMPCAEHKLTICTPYFNLPALLV
FT                   RNIIQLLREGKKVEIIVGDKTANDFYIPEDEPFKIIGALPYLYEINLRRFLSRLQYYVN
FT                   TDQLVVRLWKDDDNTYHLKGMWVDDKWMLLTGNNLNPRAWRLDLENAILIHDPKQELAP
FT                   QREKELELIRTHTTVVKHYRDLQSIADYPVKVRKLIRRLRRIRIDRLISRIL"
FT   gene            complement(192239..194899)
FT                   /locus_tag="CKO_00200"
FT   CDS_pept        complement(192239..194899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2907 0. yfiQ; hypothetical protein
FT                   YfiQ K09181; COG: COG1042 Acyl-CoA synthetase (NDP
FT                   forming); Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11366"
FT                   /db_xref="GOA:A8AD03"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD03"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR003781"
FT                   /protein_id="ABV11366.1"
FT                   /translation="MSQRGLEALLRPKSIAVLGASMKPNRAGYLMMRNLLAGGFNGPVL
FT                   PVTPAWKAVLGVLAWPDIASLPFTPDLAVLCTNASRNIALLEALGEKGCKTCIILSAPA
FT                   AQHAELLACAQRYKMRLLGPNSLGLLAPWQGLNASFSPVPIKRGKLAFISQSAAVSNTI
FT                   LDWAQQREMGFSYFIALGDSLDIDVDELLDYLARDSKTSAILLYLEHLSDARRFVSAAR
FT                   SASRNKPILVIKSGRSPAAQRLLNTSVGMDPAWDAAIQRAGLLRVQDTHELFSAVETLS
FT                   HMRPLRGDRLMIISNGAAPAALALDELWSRNGKLATLSEETRLKLSEALPAHVDIANPL
FT                   DLRDDASCEHYVKTLNILLASQDFDALMVIHSPSAAAPGTESAHALIEAVKHHPRGKFV
FT                   TLLTNWCGEFSSQEARKMFSEAGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPVLPGN
FT                   LTSDTAQAHNLLQQAIAEGATSLDTHEVQPILQAYGLHTLPTWIAGDSAEAVHIAEQIG
FT                   YPVALKLRSPDIPHKSEVQGVMLYLRTATEVQQAANAIFDRVKMAWPQARIHGLLVQSM
FT                   ANRAGAQELRVVVEHDPVFGPLIMLGEGGVEWRPEEQAVVALPPLNMNLARYLVIQGIK
FT                   SKKIRGRSALRPLDITGLSQLLVQVSNLIVDCPEIQRLDIHPLLASAGEFTALDVTLDI
FT                   APYDGDNESRLAIRPYPQQLEEWVEMKNGERCLFRPILPEDEPYLQQFISQVTKEDLYY
FT                   RYFSEINEFTHEDLANMTQIDYDREMAFVAVRRIDQTEEILGVTRAISDPDNIDAEFAV
FT                   LVRSDLKGLGLGRRLMEKLIAYTRDHGLRRLNGITMPNNRGMVALARKLGFDVDIQLEE
FT                   GIVGLTLNLAQYEES"
FT   gene            complement(194935..195459)
FT                   /locus_tag="CKO_00201"
FT   CDS_pept        complement(194935..195459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00201"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3148 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11367"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD04"
FT                   /inference="protein motif:HMMPfam:IPR005636"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00721433.1"
FT                   /protein_id="ABV11367.1"
FT                   /translation="MFDTEPMKPSNTGRLIADILPDTTAFQWSRTEPPQALLDLVNNLD
FT                   YQPMVVFPASYAGEEREVIFTPPAGKPPLFIMLDGTWPEARKMFRKSPYLDNLPVISVD
FT                   LSRLSAYHLREVHAEGQYCTAEVAIALLDLAGDTAAATHLGDHFSRFKTRYLAGKTQHQ
FT                   GSVTTETAESV"
FT   gene            complement(195703..196122)
FT                   /locus_tag="CKO_00202"
FT   CDS_pept        complement(195703..196122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00202"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2584 7.5e-72 thioredoxin 2 K03672;
FT                   COG: COG0526 Thiol-disulfide isomerase and thioredoxins;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11368"
FT                   /db_xref="GOA:A8AD05"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD05"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013766"
FT                   /inference="protein motif:HMMTigr:IPR005746"
FT                   /inference="protein motif:ScanRegExp:IPR006662"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:ABF04741.1"
FT                   /protein_id="ABV11368.1"
FT                   /translation="MNTVCTSCQAINRIPDDRIQDAAKCGRCGHDLFDGEVINATGETL
FT                   DKLLKDDLPVVVDFWAPWCGPCRNFAPIFEDIAEERSGKVRFVKVNTEAERELSARFGI
FT                   RSIPTIMIFKNGEVIDMLNGAVPKAPFDSWLNESL"
FT   gene            196331..197377
FT                   /locus_tag="CKO_00203"
FT   CDS_pept        196331..197377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00203"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0262 1.4e-171 yfiF; putative RNA
FT                   methyltransferase K03214; COG: COG0566 rRNA methylases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11369"
FT                   /db_xref="GOA:A8AD06"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR016479"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD06"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR013123"
FT                   /inference="similar to AA sequence:INSD:CAD05832.1"
FT                   /protein_id="ABV11369.1"
FT                   /translation="MNDELKNKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPGKSRTD
FT                   GGRRPARDARDERSGQIRDRKREDSPWRTVSRAPGDDTPEKADHGGISGKSFIDPEVLR
FT                   RQRAEETRVYGENACQALFQSRPDAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEA
FT                   ELAKASGTEHHGGVCFLIKKRNGTTVKQWVSQADAQDCVLALEDVANPHNLGGMMRSCA
FT                   HFGVKGVVVQDAALLESGAAIRTAEGGAEHVQPITGDSIVDVLDDFRQAGYTIVTTSSD
FT                   QGKPLFSTALPAKMVLVLGRELESLPEAAREPGDLCVKIDGTGNVENLNVSVATGVLLG
FT                   EWWRQNKA"
FT   gene            complement(197542..198231)
FT                   /locus_tag="CKO_00204"
FT   CDS_pept        complement(197542..198231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2652 3.7e-118 ung;
FT                   uracil-DNA-glycosylase K03648; COG: COG0692 Uracil DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11370"
FT                   /db_xref="GOA:A8AD07"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD07"
FT                   /inference="protein motif:BlastProDom:IPR003249"
FT                   /inference="protein motif:HMMPfam:IPR005122"
FT                   /inference="protein motif:HMMTigr:IPR002043"
FT                   /inference="protein motif:ScanRegExp:IPR002043"
FT                   /inference="similar to AA sequence:INSD:AAV76293.1"
FT                   /protein_id="ABV11370.1"
FT                   /translation="MATDLTWHDVLADEKQQPYFVNTLHTVAGERQSGMTVYPPQKDVF
FT                   NAFRFTELGNVKVVILGQDPYHGPGQAHGLAFSVRPGIATPPSLLNMYKELETSIPGFT
FT                   RPAHGYLESWARQGVLLLNTVLTVRAGQAHSHASLGWETFTDKVISLVNEHREGVVFLL
FT                   WGSHAQKKGAIIDRQRHYVLRAPHPSPLSAHRGFFGCNHFVLANQWLEQHGEKPIDWMP
FT                   VLPAESE"
FT   gene            198550..198933
FT                   /locus_tag="CKO_00205"
FT   CDS_pept        198550..198933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00205"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF2115 3.2e-48 formate acetyltransferase
FT                   K00656; COG: COG3445 Acid-induced glycyl radical enzyme;
FT                   Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11371"
FT                   /db_xref="GOA:A8AD08"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD08"
FT                   /inference="protein motif:HMMPfam:IPR001150"
FT                   /inference="protein motif:HMMPIR:IPR011140"
FT                   /inference="protein motif:ScanRegExp:IPR001150"
FT                   /inference="similar to AA sequence:INSD:AAL21540.1"
FT                   /protein_id="ABV11371.1"
FT                   /translation="MITGIQITKAANDDLLNSFWLLDSEKGEARCIAAKAGFAEDEVVA
FT                   VNKLGEIEYREIPMEVKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVIARTFTESL"
FT   gene            complement(198979..200316)
FT                   /locus_tag="CKO_00206"
FT   CDS_pept        complement(198979..200316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2898 8.5e-222 ATP-dependent RNA
FT                   helicase K05590; COG: COG0513 Superfamily II DNA and RNA
FT                   helicases; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11372"
FT                   /db_xref="GOA:A8AD09"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028621"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD09"
FT                   /inference="protein motif:HMMPfam:IPR001650"
FT                   /inference="protein motif:HMMPfam:IPR011545"
FT                   /inference="protein motif:HMMSmart:IPR001650"
FT                   /inference="protein motif:HMMSmart:IPR014001"
FT                   /inference="protein motif:ScanRegExp:IPR000629"
FT                   /inference="similar to AA sequence:INSD:EAY47323.1"
FT                   /protein_id="ABV11372.1"
FT                   /translation="MTVTTFSELELDESLLDALQDKGFTRPTAIQAAAIPPALDGRDVL
FT                   GSAPTGTGKTAAYLLPALQHLLDFPRKKSGPPRILILTPTRELAMQVADHARELAKHTH
FT                   LDIATITGGVAYMNHAEVFSENQDIVVATTGRLLQYIKEENFDCRAVETLILDEADRML
FT                   DMGFAQDIEHIAGETRWRKQTMLFSATLEGGAINDFAERLLEDPVEVSATPSTRERKKI
FT                   HQWYYRADDIQHKTALLVHLLKQPEATRSIVFVRKRERVHELAGWLREAGINNCYLEGE
FT                   MVQGKRNEAIKRLTDGRVNVLIATDVAARGIDIPDVSHVFNFDMPRSSDTYLHRIGRTG
FT                   RAGRKGTAISLVEAHDHLLLGKVGRYIEETLKARVIDELRPTTRAPSEKLTGKPSKKVL
FT                   AKRAEKKKQEKEKPRVKKRHRDTKNIGKRRKPAGTGTDAQKQSNEE"
FT   gene            200526..201185
FT                   /locus_tag="CKO_00207"
FT   CDS_pept        200526..201185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00207"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2897 2.4e-98 yfiC; hypothetical
FT                   protein YfiC K00599; COG: COG4123 Predicted
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11373"
FT                   /db_xref="GOA:A8AD10"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD10"
FT                   /inference="protein motif:HMMPfam:IPR007848"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311468.1"
FT                   /protein_id="ABV11373.1"
FT                   /translation="MKVGTDGILLGAWAPVAGVTRILDIGTGSGLLALMLAQRTDESVT
FT                   IDAVELDSEAATQAQENIAHSPWPQRITVHTEDVRQWVPRQTARFDLIISNPPYYEQGV
FT                   ECATPQREQARYTTTLDHEALLTTAAECITEEGFFCVVLPEQTGNTFTQQALSMGWHLR
FT                   LRTDVAETESRLPHRVLLAFSPRTGECFSDRLVIRGPDQLYSEGYTALTQAFYLFM"
FT   gene            complement(201170..202792)
FT                   /locus_tag="CKO_00208"
FT   CDS_pept        complement(201170..202792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2574 2.9e-276 nadB, nic, nicB;
FT                   L-aspartate oxidase K00278; COG: COG0029 Aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11374"
FT                   /db_xref="GOA:A8AD11"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD11"
FT                   /inference="protein motif:HMMPfam:IPR003953"
FT                   /inference="protein motif:HMMPfam:IPR004112"
FT                   /inference="protein motif:HMMTigr:IPR005288"
FT                   /inference="protein motif:superfamily:IPR004112"
FT                   /inference="similar to AA sequence:SwissProt:P10902"
FT                   /protein_id="ABV11374.1"
FT                   /translation="MTTTPELSCDVLIIGSGAAGLSLALRLAEKHQVIVLSKGPVSEGS
FT                   TFYAQGGIAAVFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLF
FT                   DTQVQPNGEESYHLTREGGHSHRRILHAADATGKEVETTLVSKAQNHPNIRVLERSNAV
FT                   DLIISDKIGLPGTRRVVGAWIWNRNKESVETCHAKSVVLATGGASKVYQYTTNPDISSG
FT                   DGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAHLKRPDGTRFMPDV
FT                   DERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPEAFVRQHFPMIYEKLLGLGIDLT
FT                   KEPVPVVPAAHYTCGGVMVDDFGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYG
FT                   WSAAEDIDRRMPYARSVSTLPAWDESRVENPDELVVIQHNWHELRLFMWDYVGIVRTTK
FT                   RLERALRRITMLQQEIDEYYANFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHYTL
FT                   DYPALLPESGPSVLSPLNAYMNK"
FT   gene            203218..203793
FT                   /locus_tag="CKO_00209"
FT   CDS_pept        203218..203793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2563 1.7e-58 rpoE1; DNA-directed RNA
FT                   polymerase sigma subunit (RpoE,sigma24) K00960; COG:
FT                   COG1595 DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11375"
FT                   /db_xref="GOA:A8AD12"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD12"
FT                   /inference="protein motif:HMMPfam:IPR007627"
FT                   /inference="protein motif:HMMPfam:IPR013249"
FT                   /inference="protein motif:ScanRegExp:IPR000838"
FT                   /inference="protein motif:superfamily:IPR013324"
FT                   /inference="protein motif:superfamily:IPR013325"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00922252.1"
FT                   /protein_id="ABV11375.1"
FT                   /translation="MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGD
FT                   VPDVVQESFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIDAE
FT                   NFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIM
FT                   DCPVGTVRSRIFRAREAIDNKVQPLIRR"
FT   gene            203825..204475
FT                   /locus_tag="CKO_00210"
FT   CDS_pept        203825..204475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00210"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3073 Negative regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11376"
FT                   /db_xref="GOA:A8AD13"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD13"
FT                   /inference="protein motif:HMMPfam:IPR005572"
FT                   /inference="protein motif:HMMPfam:IPR005573"
FT                   /inference="similar to AA sequence:INSD:AAP17955.1"
FT                   /protein_id="ABV11376.1"
FT                   /translation="MQKEKLSALMDGETLDSELLEELAHDPEMQKTWESYHLIRDSMRG
FT                   DTADVLHFDISARVMAAIENEPVRQTAPLIPEAQPAPHQWQKMPFWQKMRPWAAQLTQM
FT                   GVAACVSLAVIVGVQHYNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSDATANGGQQ
FT                   QQVQEQRRRINAMLQDYELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ"
FT   gene            204475..205431
FT                   /locus_tag="CKO_00211"
FT   CDS_pept        204475..205431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00211"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3026 Negative regulator of sigma E activity;
FT                   Psort location: Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11377"
FT                   /db_xref="InterPro:IPR005588"
FT                   /db_xref="InterPro:IPR033434"
FT                   /db_xref="InterPro:IPR033436"
FT                   /db_xref="InterPro:IPR038484"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD14"
FT                   /inference="protein motif:HMMPfam:IPR005588"
FT                   /inference="similar to AA sequence:INSD:AAZ89317.1"
FT                   /protein_id="ABV11377.1"
FT                   /translation="MKQLWFAMSLVAGSLFFSVNASANTASGALLQQMNLASQSLNYEL
FT                   SFVSINKQGVESLRYRHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNG
FT                   DYIVDSLPSLIYADFKRLSPWYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWLDTE
FT                   TKLPMRVDLLDRDGETLEQFRVISFAVNQDVGNSMQMLAKANLPPLLSVPVGEKAKFNW
FT                   SPTWLPQGFSEVSSSRRPLPTMDNLPIESRLYSDGLFSFSVNVNRATQNSTDQMLRTGR
FT                   RTVSTSVRENAEITIVGELPPQTAKRIADNIKFGAAQ"
FT   gene            205428..205907
FT                   /locus_tag="CKO_00212"
FT   CDS_pept        205428..205907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00212"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3086 Positive regulator of sigma E activity"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11378"
FT                   /db_xref="GOA:A8AD15"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD15"
FT                   /inference="protein motif:HMMPfam:IPR007359"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149615.1"
FT                   /protein_id="ABV11378.1"
FT                   /translation="MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGP
FT                   QTTHTIVVPSAEPLAPGQKVELGIAEGSLLGSAMLVYLSPLVGLFIFAALFQVLFGSDI
FT                   AALSGAVLGGVGGFLIARGYSRKLAEREAWQPVILNVALPPGLVRVETPSSETNP"
FT   gene            206190..207989
FT                   /locus_tag="CKO_00213"
FT   CDS_pept        206190..207989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00213"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2891 0. lepA; GTP-binding
FT                   elongation factor LepA K03596; COG: COG0481 Membrane GTPase
FT                   LepA; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11379"
FT                   /db_xref="GOA:A8AD16"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD16"
FT                   /inference="protein motif:FPrintScan:IPR000795"
FT                   /inference="protein motif:Gene3D:IPR000640"
FT                   /inference="protein motif:HMMPfam:IPR000640"
FT                   /inference="protein motif:HMMPfam:IPR000795"
FT                   /inference="protein motif:HMMPfam:IPR004161"
FT                   /inference="protein motif:HMMPfam:IPR013842"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR006297"
FT                   /inference="protein motif:ScanRegExp:IPR000795"
FT                   /inference="protein motif:superfamily:IPR009022"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /protein_id="ABV11379.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMD
FT                   LERERGITIKAQSVTLDYKAADGETYHLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAMEMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSA
FT                   KTGVGVQDVLERLVRDIPPPEGDPEGPLQALIIDSWFDNYLGVVSLVRIKNGTMRKGDK
FT                   VKVMSTGQVYNADRLGIFTPKQIDRTKLKCGEVGWLVCAIKDIHGAPVGDTLTLARNPA
FT                   EKALPGFKKVKPQVYAGLFPVSSDDYENFRDALGKLSLNDASLFYEPESSTALGFGFRC
FT                   GFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETTAKEIIYVDSPSKLPPLNNIYEL
FT                   REPIAECHMLLPQAYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRL
FT                   KSTSRGYASLDYNFKRFQASDMVRVDVLINNERVDALALITHRGNSQSRGRELVEKMKE
FT                   LIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKCYGGDISRKKKLLQKQKEGKKRMK
FT                   QIGNVELPQEAFLAILHVGKDSK"
FT   gene            208005..208979
FT                   /locus_tag="CKO_00214"
FT   CDS_pept        208005..208979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2570 5.0e-169 signal peptidase I
FT                   K03100; COG: COG0681 Signal peptidase I; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11380"
FT                   /db_xref="GOA:A8AD17"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD17"
FT                   /inference="protein motif:FPrintScan:IPR000223"
FT                   /inference="protein motif:HMMPanther:IPR000223"
FT                   /inference="protein motif:HMMPfam:IPR006198"
FT                   /inference="protein motif:HMMTigr:IPR000223"
FT                   /inference="protein motif:ScanRegExp:IPR000223"
FT                   /inference="protein motif:superfamily:IPR011056"
FT                   /inference="similar to AA sequence:INSD:ABJ01988.1"
FT                   /protein_id="ABV11380.1"
FT                   /translation="MANMFALILVIATLVTGILWCVDKFIFAPKRRERQAAAQAAAGDS
FT                   LDKATLKKVAPKPGWLETGASVFPVLAIVLVVRSFIYEPFQIPSGSMMPTLLIGDFILV
FT                   EKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPRLDYIKRAVGLPGDKVTYDPVAK
FT                   EVTVQPGCRSGQACENALPVTYSDVQPSDFVQTFARRNGGEASSGFFEVPLNETKDNGI
FT                   RLAERKETLGDVTHRILTVPIAQDQAGMYYRQPGQQLATWIVPPGQYFMMGDNRDNSAD
FT                   SRYWGFVPEANLVGKATAIWMSFDKQEGEWPTGVRLSRIGGIH"
FT   gene            209092..209255
FT                   /locus_tag="CKO_00215"
FT   misc_RNA        209092..209255
FT                   /locus_tag="CKO_00215"
FT                   /product="rncO"
FT                   /note="Rfam score 161.69"
FT                   /inference="nucleotide motif:Rfam:RF00552"
FT   gene            209878..210783
FT                   /locus_tag="CKO_00216"
FT   CDS_pept        209878..210783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A2554 1.4e-72 GTPase; COG: COG1159
FT                   GTPase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11381"
FT                   /db_xref="GOA:A8AD18"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD18"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMPfam:IPR004044"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="protein motif:HMMTigr:IPR005662"
FT                   /inference="similar to AA sequence:REFSEQ:YP_853700.1"
FT                   /protein_id="ABV11381.1"
FT                   /translation="MSEDKSYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH
FT                   RIVGIHTEGAYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD
FT                   DEMVLNKLRDGKAPVILAVNKVDNVQEKADLLPHLQFLASQMNFLDIVPVSAETGMNVD
FT                   TIAGIVRKHLPEATHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFV
FT                   SNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFEAPVHLELWVKV
FT                   KSGWADDERALRSLGYVDDL"
FT   gene            210855..211532
FT                   /locus_tag="CKO_00217"
FT   CDS_pept        210855..211532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00217"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1381 Recombinational DNA repair protein
FT                   (RecF pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11382"
FT                   /db_xref="GOA:A8AD19"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD19"
FT                   /inference="protein motif:HMMPfam:IPR003717"
FT                   /inference="protein motif:HMMTigr:IPR003717"
FT                   /inference="similar to AA sequence:INSD:ABR78300.1"
FT                   /protein_id="ABV11382.1"
FT                   /translation="MLDVFTEESGRVRLVAKGARSKRSSLKGALQPFTPLLLRFGGRGE
FT                   VKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLNCIQSLAGAT
FT                   GSPEPALRRFELALLGHLGYGVDFLHCAGSGETVDDTMTYRYREEKGFMASVVIDNSTF
FT                   TGRHLKALDAREFPDVDTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRPGRAENT
FT                   NND"
FT   gene            211544..212275
FT                   /locus_tag="CKO_00218"
FT   CDS_pept        211544..212275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2564 9.2e-122 pdxJ; carries out
FT                   condensation and ring closure step after PdxA in pyridoxine
FT                   biosynthesis K03474; COG: COG0854 Pyridoxal phosphate
FT                   biosynthesis protein; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11383"
FT                   /db_xref="GOA:A8AD20"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD20"
FT                   /inference="protein motif:BlastProDom:IPR004569"
FT                   /inference="protein motif:HMMPfam:IPR004569"
FT                   /inference="protein motif:HMMTigr:IPR004569"
FT                   /inference="similar to AA sequence:SwissProt:P0A794"
FT                   /protein_id="ABV11383.1"
FT                   /translation="MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVH
FT                   LREDRRHITDRDVRILRQTLDTRMNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTE
FT                   GGLDVAGQRDKMRDACKRLADAGILVSLFIDADEEQIKAAADVGAPYIEIHTGCYADAK
FT                   TDAEQAQELARIAKAATFAASLGLKVNAGHGLTYHNVQAIAALPEMHELNIGHAIIGRA
FT                   VMSGLKEAVAEMKRLMLEARG"
FT   gene            212275..212655
FT                   /locus_tag="CKO_00219"
FT   CDS_pept        212275..212655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00219"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2823 1.4e-61 acpS; holo-[acyl-carrier
FT                   protein] synthase K00997; COG: COG0736 Phosphopantetheinyl
FT                   transferase (holo-ACP synthase); Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11384"
FT                   /db_xref="GOA:A8AD21"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD21"
FT                   /inference="protein motif:BlastProDom:IPR004568"
FT                   /inference="protein motif:HMMPfam:IPR008278"
FT                   /inference="protein motif:HMMTigr:IPR002582"
FT                   /inference="protein motif:HMMTigr:IPR004568"
FT                   /inference="protein motif:superfamily:IPR008278"
FT                   /inference="similar to AA sequence:INSD:AAV76310.1"
FT                   /protein_id="ABV11384.1"
FT                   /translation="MAILGLGTDIVEIARIEAVISRSGERLARRVLSDNEWAIWETHQQ
FT                   PVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAERLGV
FT                   AHMHVTLADERHYACATVIIES"
FT   gene            complement(212727..212987)
FT                   /locus_tag="CKO_00220"
FT   CDS_pept        complement(212727..212987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmp:MMP1692 4.7e-06 vhuB; polyferredoxin,
FT                   associated with F420-non-reducing hydrogenase; COG: COG1145
FT                   Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11385"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD22"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="similar to AA sequence:INSD:CAD02778.1"
FT                   /protein_id="ABV11385.1"
FT                   /translation="MALLITKKCINCDMCEPECPNEAISMGDSIYEINSDKCTECVGHY
FT                   ETPTCQKVCPIPNTILKDPAHVETEEQLWDKFVLMHHADKL"
FT   gene            complement(213043..213891)
FT                   /locus_tag="CKO_00221"
FT   CDS_pept        complement(213043..213891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1550 7.8e-23
FT                   glucokinase/transcriptional regulator, RpiR family, fusion
FT                   K00845; COG: COG1737 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11386"
FT                   /db_xref="GOA:A8AD23"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD23"
FT                   /inference="protein motif:HMMPfam:IPR000281"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="similar to AA sequence:INSD:AAX66473.1"
FT                   /protein_id="ABV11386.1"
FT                   /translation="MNCLIRIRQRYPDLAQSDKKLADYILAQPDDTRHLSSQQLAVEAG
FT                   VSQSSVVKFAQKLGFKGFPALKLAISEALASNPNPHSIPVHNQIRGDDPMRLVGEKLIE
FT                   ENVAAMHATLDVNSEEKLFESVMMLRNARRVVITGIGTSGLVAQNFAWKLMKIGFNVVA
FT                   EHDMHALLATVQALAPDDLLLAISYSGERRELNMAADETLRVGGKVLAITGFTPNALQQ
FT                   RATRCLYTIAEEQATRSAAISSTHAQTMLTDLLFMALVQQDLGRAPERIRHSEALVKKL
FT                   V"
FT   gene            214052..214900
FT                   /locus_tag="CKO_00222"
FT   CDS_pept        214052..214900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpa:MAP0936 6.3e-07 gmhA; phosphoheptose
FT                   isomerase K03271; COG: COG2103 Predicted sugar phosphate
FT                   isomerase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11387"
FT                   /db_xref="GOA:A8AD24"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD24"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005488"
FT                   /inference="protein motif:ScanRegExp:IPR005486"
FT                   /inference="similar to AA sequence:SwissProt:Q8ZN25"
FT                   /protein_id="ABV11387.1"
FT                   /translation="MDLDALPTLELVHRFNQQDTLVAQAVKETLPDVARAVDAAADALK
FT                   AGGRIIYMGAGTSGRLGVLDASECPPTFGVPHGLVIGLIAGGPGALLKAVEGAEDSQQL
FT                   GEDDLLALNVTAQDLVVGLAASGRTPYVIGGLKYARQVGCVTVAISCNPDSPIAREADI
FT                   AISPVVGPEALTGSTRLKSGTAQKLVLNMISTGAMVKFGKVYQNLMVDMKATNVKLVDR
FT                   ACRMVVEATGITREEAEALLKQTDFEVKPAILMALTGLNAEDARAKLSAHQGFLRAALE
FT                   R"
FT   gene            215007..215642
FT                   /locus_tag="CKO_00223"
FT   CDS_pept        215007..215642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00223"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0560 Phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11388"
FT                   /db_xref="GOA:A8AD25"
FT                   /db_xref="InterPro:IPR006435"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD25"
FT                   /inference="protein motif:HMMTigr:IPR006435"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461504.1"
FT                   /protein_id="ABV11388.1"
FT                   /translation="MVNHERRVVFFDLDGTLHQQDMFGSFLRYLLRRQPLNALLVLPLL
FT                   PVIGIGLLIKGRAARWPMSLLLWGCTFGHSEARLKAHQADFVRWFRDNVTAFPVVQERL
FT                   TTYLLSSDADIWLITGSPQSLVEQVYFDTLWLPRVNLIASQMRRGYGGWLLTMRCLGHE
FT                   KVAQLERQIGAPLRLYSGYSDSKQDNPLLYFCQHRWRVTPRGELQQLE"
FT   gene            215660..216202
FT                   /locus_tag="CKO_00224"
FT   CDS_pept        215660..216202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0289 2.6e-85 yfhC; hypothetical protein
FT                   K01500; COG: COG0590 Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11389"
FT                   /db_xref="GOA:A8AD26"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD26"
FT                   /inference="protein motif:HMMPfam:IPR002125"
FT                   /inference="protein motif:ScanRegExp:IPR002125"
FT                   /inference="similar to AA sequence:INSD:CAD02770.1"
FT                   /protein_id="ABV11389.1"
FT                   /translation="MYNAPAFITGVSPLSDVEFSHEYWMRHALTLAKRAWDEREVPVGA
FT                   VLVHNNRVIGEGWNRPIGHHDPTAHAEIMALRQGGLVLQNYRLLDTTLYVTLEPCVMCA
FT                   GAMVHSRIGRVVFGARDAKTGAAGSLMDVLHHPGMNHRVEITEGVLRDECAALLSDFFR
FT                   MRRQEIKALKKSSQESL"
FT   gene            complement(216239..217786)
FT                   /locus_tag="CKO_00225"
FT   CDS_pept        complement(216239..217786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2878 9.1e-241 yfhD; putative
FT                   periplasmic binding transport protein K01238; COG: COG4623
FT                   Predicted soluble lytic transglycosylase fused to an
FT                   ABC-type amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11390"
FT                   /db_xref="GOA:A8AD27"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD27"
FT                   /inference="protein motif:HMMPfam:IPR008258"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:ScanRegExp:IPR000189"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461502.1"
FT                   /protein_id="ABV11390.1"
FT                   /translation="MKKLKINYLFIGILTLLLAAALWPSIPWFGKADNRIAAIQSRGEL
FT                   RVSTIESPLTYARINGKKYGLDYELAQQFASYLGVKLKITVRQNISQLFDDLDNGNADL
FT                   LAAGLVYNSERVKNYQPGPTYYSVSQQLVYRVGQYRPRTLATVNESQLSIAPGHVVVND
FT                   LQALKETKFPDLSWKVDDKKGTAALLSEVISGNLDYTIADSVAISLFQRVHPELAVALD
FT                   VTDEQPVTWFSQLDDDNTLSAALLDFFNTINEDGSLARMEEKYLGHGDDFDYVDTRTFL
FT                   RAVDGVLPDLQPLFEKYAQEIDWRLLAAISYQESHWDPLATSPTGVRGLMMLTKNTAQS
FT                   LGLTDRTDAEQSISGGVRYIQDMMGKVPETVPEEERIWFALAAYNMGYAHMLDARALTV
FT                   KTRGNPDSWADVKQRLPLLSQKQYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEK
FT                   EKQAAEAIKLAQDYPAVSPAEFDTETFPFSSFLSQPSSNYLSHSPSLPFSLKKKDEN"
FT   gene            complement(217787..218017)
FT                   /locus_tag="CKO_00227"
FT   CDS_pept        complement(217787..218017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00227"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11392"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD28"
FT                   /inference="similar to AA sequence:INSD:AAL21460.1"
FT                   /protein_id="ABV11392.1"
FT                   /translation="MCARGETGDIIKNLTPRRNRLRRNKIAAFSYHTVRPIILISCQLA
FT                   HCCAKCRTFMMILTHQNDISRLRLRTIQRIN"
FT   gene            217922..221941
FT                   /locus_tag="CKO_00226"
FT   CDS_pept        217922..221941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2877 0. purL;
FT                   phosphoribosylformyl-glycineamide synthetase K01952; COG:
FT                   COG0046 Phosphoribosylformylglycinamidine (FGAM) synthase,
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11391"
FT                   /db_xref="GOA:A8AD29"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD29"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMTigr:IPR010073"
FT                   /protein_id="ABV11391.1"
FT                   /translation="MIRKGGDFISTQTVSSGRQILYNVARFPPCAHLKRLRRFEDERLM
FT                   MEILRGSPALSAFRINKLLARFQAANLQVHNIYAEYVHFADLSAPLNEDEHAQLARLLK
FT                   YGPSLSSHTPEGKLLLVTPRPGTISPWSSKATDIAHNCGLQQVSRLERGVAYYVEAATL
FT                   TAEQWQTIAAELHDRMMETVFSSLSDAEKLFVHHQPAPVASVDLLGEGRQALTDANLRL
FT                   GLALADDEIDYLQDAFTKLGRNPNDIELYMFAQANSEHCRHKIFNADWVIDGKPQPKSL
FT                   FKMIKNTFETTPDHVLSAYKDNAAVMEGSDVGRYFADHESGRYDFHQEPAHILMKVETH
FT                   NHPTAISPWPGAATGSGGEIRDEGATGRGAKPKAGLVGFSVSNLRIPGFEQPWEEDFGK
FT                   PERIVTALDIMTEGPLGGAAFNNEFGRPALNGYFRTYEEKVNSHNGEELRGYHKPIMLA
FT                   GGIGNIRADHVQKGEIVVGAKLIVLGGPAMNIGLGGGAASSMASGQSDADLDFASVQRD
FT                   NPEMERRCQEVIDRCWQLGDANPILFIHDVGAGGLSNAMPELVSDGGRGGKFELRDILS
FT                   DEPGMSPLEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAVIGEATEEQHLSLNDS
FT                   HFDNQPIDLPLDVLLGKTPKMTRDVQTLTAKGDALDRADITIADAVKRVLHLPTVAEKT
FT                   FLVTIGDRTVTGMVARDQMVGPWQVPVANCAVTTASLDSYYGEAMSIGERAPVALLDFA
FT                   ASARLAVGEALTNIAATQIGDIKRIKLSANWMAAAGHPGEDAGLYDAVKAVGEELCPQL
FT                   GLTIPVGKDSMSMKTRWQEGNEQREMTSPLSLVISAFARVEDVRHTVTPQLSTEDNALL
FT                   LIDLGQGHNALGATALAQVYRQLGDKPADVRDVAQLKGFYDAIQALVAQRKLLAYHDRS
FT                   DGGLLVTLAEMAFTGHCGIQVDIATSGDDRLAALFNEELGAVIQVRAADREAVEALLAK
FT                   HGLSDCVHYLGQAVSGDRFVIESNGQVVFSESRTTLRTWWAETTWQMQRLRDNPECADQ
FT                   EHDAKTNDADPGLNVKLSFDINEDIAAPYIATGARPKVAVLREQGVNSHVEMAAAFHRA
FT                   GFDAIDVHMSDLLAGRIGLGNFQALVACGGFSYGDVLGAGEGWAKSILFNNRVRDEFET
FT                   FFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFVRNHSDRFEARFSLVEVTQSPSLL
FT                   LQGMVGSQMPVAVSHGEGRVEVRDDAHLAGLESKGLVALRYVDNFGKVTENYPANPNGS
FT                   PNGITAVTTENGRATIMMPHPERVFRTVSNSWHPENWGEDSPWMRIFRNARKQLG"
FT   gene            complement(220916..221581)
FT                   /locus_tag="CKO_00228"
FT   CDS_pept        complement(220916..221581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00228"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11393"
FT                   /db_xref="GOA:A8AD30"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD30"
FT                   /inference="similar to AA sequence:INSD:EAZ68419.1"
FT                   /protein_id="ABV11393.1"
FT                   /translation="MGHFHQAEARFKTVRMVTHKTRPQLAPWNQFTQVRHHLATVTYAK
FT                   RQRLRAVEERFELVAYAIVEQNRFRPAFTRAQHVTVRETATGNQRLEITQPNTASQQIA
FT                   HMHINRVKARTMERRRHLNVGVHALFAQYGNLRTRAGSNIRRGDIFIDIERQFHVQTRV
FT                   GIVGFCVMFLIGTFRVVAQALHLPGRFRPPGTKRGAAFAEDNLPIGFNHKTVAGNGLT"
FT   gene            complement(221938..222129)
FT                   /locus_tag="CKO_00229"
FT   CDS_pept        complement(221938..222129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11394"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD31"
FT                   /protein_id="ABV11394.1"
FT                   /translation="MSPFGDTNNLLMSAFPDTFMVDGRAKKSSLTEASLPDGGFALSGL
FT                   RVCPGPIALCLSGHLRAD"
FT   gene            complement(222308..222456)
FT                   /locus_tag="CKO_00230"
FT   misc_RNA        complement(222308..222456)
FT                   /locus_tag="CKO_00230"
FT                   /product="tke1 RNA"
FT                   /note="Rfam score 170.29"
FT                   /inference="nucleotide motif:Rfam:RF00128"
FT   gene            222499..223980
FT                   /locus_tag="CKO_00231"
FT   CDS_pept        222499..223980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2558 8.9e-227 putative sensor-like
FT                   histidine kinase YfhK K07711; COG: COG0642 Signal
FT                   transduction histidine kinase; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11395"
FT                   /db_xref="GOA:A8AD32"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD32"
FT                   /inference="protein motif:FPrintScan:IPR004358"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="similar to AA sequence:INSD:ABG70547.1"
FT                   /protein_id="ABV11395.1"
FT                   /translation="MFPSVSILVSLSDESNALKRWSVFPRSLRQLVMLAFLLILLPLLV
FT                   LAWQAWQSLNALSAQAAQTNRTTLIDARRSEAMTNVALEMERSYRQYCVLDDRTLAKVY
FT                   QSQRKRYSEMLDAHAGVLPDAKLYQALRDDLNGLAQLQCKNSGPDATAAARLEAFANAN
FT                   TEMVQATRTVVFSRGQQLQQEIAERGQFFGWQALVLFLVSLAMVLLFTRMIIGPVKGIE
FT                   RMINRLGEGRSLGNTVSFTGPRELRSVGQRIIWLSERLSWLESQRHQFLRHLSHELKTP
FT                   LASMREGTELLADQVVGPLTPEQKEVVGILDDSSRNLQKLIEQLLDYNRKLADSAIEME
FT                   TVELEPLVDMVVSAHSLPARAKMMHTEVRLAIDSCLAEPMLLMSVLDNLYSNAVHYGAE
FT                   SGNICIRSNVYGSKAHIDVINTGTPIPEAERAMIFEPFFQGSHQRKGAVKGSGLGLSIA
FT                   RDCIRRMQGELYLVDENAQEVCFRIELLLSASKNH"
FT   gene            224085..224747
FT                   /locus_tag="CKO_00232"
FT   CDS_pept        224085..224747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00232"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06210 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11396"
FT                   /db_xref="InterPro:IPR025262"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD33"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804169.1"
FT                   /protein_id="ABV11396.1"
FT                   /translation="MGCAPHAAKHVVNDASQEKIPPYQLADYLSTDCSDIWLLKGPSTD
FT                   NNPLYWQRAIDCADRLLPVQSRNEARALEDGSWQNTFKRGILLADAKITPLERRDMVTR
FT                   LDALSAQIPAQVRPLYQLWRDGQALQLQLAEERQRYSKLQQASDSELDTLRQQHQHLQA
FT                   QLDLTTRKLENLTDIERQLSTRKPAGNYNPDATHGNDKPAAPDDGASSTLPQDEVTP"
FT   gene            224744..226081
FT                   /locus_tag="CKO_00233"
FT   CDS_pept        224744..226081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2502 1.5e-82 atoC; acetoacetate
FT                   metabolism regulatory protein AtoC K07714; COG: COG2204
FT                   Response regulator containing CheY-like receiver, AAA-type
FT                   ATPase, and DNA-binding domains; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11397"
FT                   /db_xref="GOA:A8AD34"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD34"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461497.1"
FT                   /protein_id="ABV11397.1"
FT                   /translation="MISRKPAHLLLVDDDPGLLKLLGMRLTSEGYSVVTAESGQEGLRV
FT                   LNREKVDLVISDLRMDEMDGMQLFTEIQKVQPGMPVIILTAHGSIPDAVAATQKGVFSF
FT                   LTKPVDKDALYQAIDDALEQSAPAMDDSWRESIVTRSPLMIRLLEQARMVAQSDVSVLI
FT                   NGQSGTGKEIFAQAIHNASPRSSKPFIAINCGALPEQLLESELFGHARGAFTGAVSNRE
FT                   GLFQAAEGGTLFLDEIGDMPAPLQVKLLRVLQERKVRPLGSNRDIDIDVRIISATHRDL
FT                   PKAMARGEFREDLYYRLNVVSLKIPTLAERTEDIPLLANHLLRQSAERHKPFVRAFSTD
FT                   AMKRLMTASWPGNVRQLVNVIEQCVALTSSPVISDALVEQALEGENTALPTFVEARNQF
FT                   ELNYLRKLLQITKGNVTHAARMAGRNRTEFYKLLSRHELDANDFKE"
FT   gene            226158..226496
FT                   /locus_tag="CKO_00234"
FT   CDS_pept        226158..226496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00234"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0347 Nitrogen regulatory protein PII; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11398"
FT                   /db_xref="GOA:A8AD35"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD35"
FT                   /inference="protein motif:BlastProDom:IPR002187"
FT                   /inference="protein motif:FPrintScan:IPR002187"
FT                   /inference="protein motif:Gene3D:IPR002187"
FT                   /inference="protein motif:HMMPfam:IPR002187"
FT                   /inference="protein motif:ScanRegExp:IPR002187"
FT                   /inference="protein motif:ScanRegExp:IPR002332"
FT                   /inference="similar to AA sequence:INSD:ABP61702.1"
FT                   /protein_id="ABV11398.1"
FT                   /translation="MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKIEIVVTDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRT
FT                   GEEDDAAI"
FT   gene            complement(226593..227783)
FT                   /locus_tag="CKO_00235"
FT   CDS_pept        complement(226593..227783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0300 2.4e-201 hmpA; flavohemoprotein
FT                   K05916; COG: COG1018 Flavodoxin reductases
FT                   (ferredoxin-NADPH reductases) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11399"
FT                   /db_xref="GOA:A8AD36"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD36"
FT                   /inference="protein motif:Gene3D:IPR012292"
FT                   /inference="protein motif:HMMPfam:IPR000971"
FT                   /inference="protein motif:HMMPfam:IPR001433"
FT                   /inference="protein motif:HMMPfam:IPR008333"
FT                   /inference="protein motif:superfamily:IPR009050"
FT                   /inference="similar to AA sequence:INSD:AAO68025.1"
FT                   /protein_id="ABV11399.1"
FT                   /translation="MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNM
FT                   SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGGHLLA
FT                   TLDEMFSPGQEVLDAWGKAYGVLANVFINREAQIYSENASKNGGWEGTRPFRIVAKTPR
FT                   SALITSFEFEPVDGGPVAEYHPGQYLGVWLKPEGFPHQEIRQYSLTRKPDGKGYRIAVK
FT                   REDGGQVSSWLHNHASVGDIVHLAAPAGDFFMDVATDTPVSLISAGVGQTPMLAMLDTL
FT                   TKANHTAQVNWFHAAENGDVHAFADEVSELGKTLPRFTAHTWYREPTEADRANGAFDST
FT                   GLMDLNKLESAISDPAMQFYLCGPVGFMQFAAKQLTGLGVKSENIHYECFGPHKVL"
FT   gene            complement(227831..228007)
FT                   /locus_tag="CKO_00236"
FT   CDS_pept        complement(227831..228007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11400"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD37"
FT                   /inference="similar to AA sequence:INSD:ABG70542.1"
FT                   /protein_id="ABV11400.1"
FT                   /translation="MTKDFTQTITFILYKALSNEDLTNFNGFLFRFVMQIFHVVTLKTQ
FT                   SYKEPFTIQGYFL"
FT   gene            228103..229362
FT                   /locus_tag="CKO_00237"
FT   CDS_pept        228103..229362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2555 4.2e-220 glyA; serine
FT                   hydroxymethyltransferase K00600; COG: COG0112
FT                   Glycine/serine hydroxymethyltransferase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11401"
FT                   /db_xref="GOA:A8AD38"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD38"
FT                   /inference="protein motif:HMMPanther:IPR001085"
FT                   /inference="protein motif:HMMPfam:IPR001085"
FT                   /inference="protein motif:HMMPIR:IPR001085"
FT                   /inference="protein motif:ScanRegExp:IPR001085"
FT                   /inference="similar to AA sequence:INSD:AAX66455.1"
FT                   /protein_id="ABV11401.1"
FT                   /translation="MRMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRV
FT                   MQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQAN
FT                   FAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYEEMAKL
FT                   AQTHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAADVYPNPVPHA
FT                   HVVTTTTHKTLAGPRGGLILAKGGDEELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEA
FT                   MEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALG
FT                   RANITVNKNSVPNDPKSPFVTSGIRIGSPAITRRGFKEAEAKELAGWMCDVLDNINDEA
FT                   VIERIKGKVLDICARFPVYA"
FT   gene            complement(229547..230740)
FT                   /locus_tag="CKO_00238"
FT   CDS_pept        complement(229547..230740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_0270 4.0e-25 glcK; glucokinase K00845;
FT                   COG: COG1940 Transcriptional regulator/sugar kinase; Psort
FT                   location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11402"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD39"
FT                   /inference="protein motif:HMMPfam:IPR000600"
FT                   /inference="similar to AA sequence:INSD:ABR78284.1"
FT                   /protein_id="ABV11402.1"
FT                   /translation="MQRTGFNNARVRQANKQIFLSHLWREKQLSKSRLAQLSGLSIPAV
FT                   SNILEVLIDEGRICHSRETLSQRGLSSGSYHLPEQGDWTLCMNVTPTSITSQLADARLV
FT                   AVGDWRHAEINAGSPKALLTALAAHWREYRQRYPDVTINLALGVHGQVDPITGASKTMP
FT                   QAPWKTPVEIKYLLEEMLGVQVRLDNDCVMLALAEKWQNPAANRDFCVINVDYGIGSSF
FT                   VINDNIWRGSLYGSGQIGHTIVNPDGVACDCGRYGCLETVASLSALKKQARRWMKTQPT
FT                   ADCDPETITIDQLITAWQQGDVRIQAWVEHAASAIGLSLYNFLNILNINQIWIYGRSCA
FT                   FGESWLNTLVQQTGFNPFDHGDNPQARSTRIGFGTLSRSQQLMGIGYLYVESQLNAL"
FT   gene            230855..234121
FT                   /locus_tag="CKO_00239"
FT   CDS_pept        230855..234121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2868 0. yphG; hypothetical protein
FT                   YphG K00754; COG: NOG06209 non supervised orthologous
FT                   group; Psort location: OuterMembrane, score:9.49"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11403"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR033396"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD40"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR001440"
FT                   /protein_id="ABV11403.1"
FT                   /translation="MYGSVKVWQETLSLPTWTTGEEDPNPMFLEKRVYQGSSGAVYPYG
FT                   VIDTLTGEREMREYQAVWMENDFIRIMLLPELGGRIHRAYDKVQQRDFVYYNEVVKPAL
FT                   VGLLGPWISGGIEFNWPQHHRPTTFMPVDFTCQQGEHGEQTVWMGEVEPMRGLQVMTGF
FT                   TLYPDRALIEITGKVFNGNATPRHFLWWANPAVKGGDDHQSVFPPDVTAVYDHGKRDVS
FT                   AFPIATGTYYKVDYSAGVDISRYKNVPVPTSYMAEKSDYDFVGAWHHGERGGLLHVADH
FT                   HISPGKKQWTWGYGDFGVAWDRNLTDDNGPYIELMTGVFTDNQPDFTWLAPYEEKVFVQ
FT                   NFLPYSELGMVQNASTQLALRLEREGNQLSSGVYAVAPLHDVQVTLCAQGQPFFEKTLT
FT                   LEPGQSWRADLSDAGHARVKMTVARRDGVTLLAYEEHIAEDLPLPKAACAPELPEALSC
FT                   TDELYFIGQHLEQYNHASRYAEEYYQRALDVDPHDYRNNVALGTLALNRADWAQAERCA
FT                   QSALQRAHKLNKNPRDGEASMLLAAALERQGKDDLAREHYYKASWSGNCRDAAFWSLAR
FT                   IAMKRNDYADALEKVNLSLRFNGSNNLAMGLKALVLAGLGRTTEALAYISQQLIEYPLS
FT                   YTLHYACWAIRQDEATQEALIAITGRRGTNACELAGWLVSCGQKEAARAVLTLLDSQET
FT                   LPMLWRASLSDDPQPFIAQARDCLHNRVRFPNTLDEVQMLQTLSDCAFARYLLGCFWYS
FT                   KRCYEEAVNCWQFTLEQEPNFAPVHRLLGIYAWNKQHDAQKALKYLSQAVALEPKNARF
FT                   LFELDYLNKLMAAPAGARLQQLEASKEIVFHRDDLTVELLSVWNSLGRYEAAAGVLRER
FT                   VFHPWEGGEGKATGQYLLNQIHQALEAIRRGEPQNATVLLQQALHYPHNLGEGRLPGQT
FT                   DNDIWYLLGYCARQQGHHDEAQRYFTRATRGGSSLDAGRYYNDQPVDYLFWQGMALKAS
FT                   GDCTEANLLFQSFLQWVETQRDKVPDVDFFAVSLPDLVVLDTPAQEKHQQHCLFITALG
FT                   HLGLGDIPACQQALNALLQRNPTHDKAQLLRHALNVPLFQ"
FT   gene            234193..235632
FT                   /locus_tag="CKO_00240"
FT   CDS_pept        234193..235632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:orf19.644 1.2e-46 HXT4; high-affinity
FT                   glucose transporter or sensor K01804; COG: COG0477
FT                   Permeases of the major facilitator superfamily; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11404"
FT                   /db_xref="GOA:A8AD41"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD41"
FT                   /inference="protein motif:FPrintScan:IPR003663"
FT                   /inference="protein motif:HMMPfam:IPR005828"
FT                   /inference="protein motif:HMMTigr:IPR003663"
FT                   /inference="protein motif:ScanRegExp:IPR005829"
FT                   /inference="similar to AA sequence:INSD:ABR78282.1"
FT                   /protein_id="ABV11404.1"
FT                   /translation="MNNTQTHLRIGYVWTICLVAACGGLLFGYDWVVIGGAKPFYEAYF
FT                   SITDPAQSGWAMSSALVGCIFGALMSGWCADKFGRKMPLILAAILFSASSWGTAVASNF
FT                   DMFVIYRIVGGVGIGLASALSPLYIAEVSPAEKRGRFVAVNQLTIVIGVLAAQLINLMI
FT                   AEPVATDATRQAIVESWNGQMGWRWMFGAELVPALAFLVLMFFVPESPRWLVKAGKPER
FT                   ARAMLQRIGSAEYAGQTLREIEHTLLKDNHKVAWSTLLQPQIKPIVIIGMVLAVFQQWC
FT                   GINVIFNYAQEIFASAGFDINGTLKSIVATGIINLVFTLAALPLVDKIGRRKLMLFGAS
FT                   GLTVIYVLIAAAYGMGIMGWPVLVLVLAAIAIYALTLAPVTWVLLSEIFPNRVRGLAMS
FT                   LGTLALWIACFLLTYTFPLLNAGLGAAGSFLLYGVICAMGYFYVLRNVPETKGVTLEAL
FT                   EEQLATRHVKSSPSAQQRSAR"
FT   gene            235632..236474
FT                   /locus_tag="CKO_00241"
FT   CDS_pept        235632..236474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b3879 0.0025 yihR; predicted
FT                   aldose-1-epimerase K01785; COG: COG2017 Galactose
FT                   mutarotase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11405"
FT                   /db_xref="GOA:A8AD42"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD42"
FT                   /inference="protein motif:HMMPfam:IPR008183"
FT                   /inference="protein motif:superfamily:IPR011013"
FT                   /inference="similar to AA sequence:INSD:ABR78281.1"
FT                   /protein_id="ABV11405.1"
FT                   /translation="MDDTLTLQNTHLRMRVDPQGGRLLSLFSLAHQQAVLREGCGVKPG
FT                   ECGLFPMLPVANRIAENRFLFRGEVVNLPRHEEDAVFFLHGDGWLRRWDTIAVHEDACH
FT                   LRSGRQMACGYDYVADLHYQLDAAVLHASLTITHRGERPMLYGCGFHPYFAFDRHSTVQ
FT                   FAASGYWPEGKQHLPQEWQSDIPRQADFSGAQYGEDAWLNVGYSGWSGRAIVQRDVMKV
FT                   TLLSQTPWLMLFRMQGESFLCLEPQSHPVNAHNMPGQPGLQALAQGDQCHFAMQIAVV"
FT   gene            236441..236671
FT                   /locus_tag="CKO_00242"
FT   CDS_pept        236441..236671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11406"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD43"
FT                   /protein_id="ABV11406.1"
FT                   /translation="MPFRDANRCCLGQKRCYSPVNALLRQPAFIARLSPPYGRESWFCT
FT                   PRAGWRSVILPTSLATVFFCHSGASGLKAWD"
FT   gene            236563..237702
FT                   /locus_tag="CKO_00243"
FT   CDS_pept        236563..237702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00243"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0477 Permeases of the major facilitator
FT                   superfamily; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11407"
FT                   /db_xref="GOA:A8AD44"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD44"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:INSD:AAX66454.1"
FT                   /protein_id="ABV11407.1"
FT                   /translation="MVLHSTRWLALGYFTYFFSYGIFLPFWSVWLKGLGLTPETIGLLL
FT                   GAGLVARFLGSLLIAPRVSDPSRLISALRLLALLTLVFALAFWAGTHVAWLMVVMIGFN
FT                   LFFSPLVPLTDALANTWQKQLTMDYGRVRLWGSIAFVIGSALTGKLVSLFDYQAILGLL
FT                   TLGVASMLLGMLLRPSVLPQGESRHQESAGWPAWRTLVVQSWRFLACVCLLQGAHAAYY
FT                   GFSAIYWQGAGYSASAVGYLWSLGVVAEVVIFALSNKLFRRFSARDLLLLSAVCGVIRW
FT                   GLMGWSTALPWLIAIQILHCGTFTVCHLAAMRYIAARQGSEVIRLQAVYSAVAMGGSIA
FT                   IMTVFAGFLYQHLGNGLFWVMALVALPAIFLRPNVAASS"
FT   gene            complement(237612..237758)
FT                   /locus_tag="CKO_00244"
FT   CDS_pept        complement(237612..237758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11408"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD45"
FT                   /protein_id="ABV11408.1"
FT                   /translation="MQTCRLPHTNSSRSAKYWNHDDAATLGRKKIAGNATNAITQNKPF
FT                   PKC"
FT   gene            complement(237697..238974)
FT                   /locus_tag="CKO_00245"
FT   CDS_pept        complement(237697..238974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spz:M5005_Spy_1664 0.0062 PTS system, mannitol
FT                   (cryptic)-specific IIA component K00890; COG: COG3711
FT                   Transcriptional antiterminator; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11409"
FT                   /db_xref="GOA:A8AD46"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD46"
FT                   /inference="protein motif:HMMPfam:IPR011608"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461488.1"
FT                   /protein_id="ABV11409.1"
FT                   /translation="MMPTLTSPSVLSAPQRRCRVLLTLFQPGQIATTETFSALNGVDDE
FT                   IAREDITETGLEIQRYHRLAITTGQNGRYRIEGAALNQRLCLLHWLRRGLRICPTFITQ
FT                   QFTPALKTELKRRGIARTLYDDTNLHALINLCSRRLQKPFECRDVQFLRLFLQYCLLQH
FT                   HAGIAPAFNPLQKQWAQSCAEYPLALEIGRHWQRRVMQNAPPDETLFMALLFSMIRIPD
FT                   PIHDNHQQDRRLRLAVARLVLRFREMGQVRFSDEQGLNDQLYVHLAQALSRSLFAIGID
FT                   NTLPEEFSRLYPRLVRTTRDALAGFESEYGVRFSDEETGLVAVIFGAWLMQENDLHEKQ
FT                   IVLLTGNNGELEAHIEQQLRELTLLPLNIKHVPTQTFQKDGSPRGVALIVTPYATPLPL
FT                   FSPPLIHADLSLTAHQQQQIRKILES"
FT   gene            239099..239737
FT                   /locus_tag="CKO_00246"
FT   CDS_pept        239099..239737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00246"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3683 ABC-type uncharacterized transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11410"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD47"
FT                   /inference="protein motif:HMMPfam:IPR010412"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149645.1"
FT                   /protein_id="ABV11410.1"
FT                   /translation="MQLVKRSALTLFLAVLSFTAQAHPHSFIRLQTQLVSENDRFVALK
FT                   MRWTMDEITSADLLYDAGDAKPGSEIWKKLAAEVMANVLGQHYFTEVWHNGQKVKFKNR
FT                   PTEYGMEREAHQAVLTFVLPLAEPQPLSGQTYTFSTFDPTYYVDMSYANDRDASLPQAL
FT                   STQCSISVHTPTPSEETLSFAQSLDKEDAPPEDMDLGKQFAQKVTVQCQ"
FT   gene            239728..240708
FT                   /locus_tag="CKO_00247"
FT   CDS_pept        239728..240708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00247"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2215 ABC-type uncharacterized transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11411"
FT                   /db_xref="GOA:A8AD48"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD48"
FT                   /inference="protein motif:HMMPfam:IPR011541"
FT                   /inference="similar to AA sequence:INSD:ABP61695.1"
FT                   /protein_id="ABV11411.1"
FT                   /translation="MSVISQQRPRSRRWLPLWPLAVFLLLAIAGGLWLWQAWPQVMVKS
FT                   IVWQREVNQQMSALLKAVAANPTQAGGSLLLFSFLYGVLHALGPGHGKVVITTWLATHP
FT                   SKLKSSIGLTLASSLLQGLVAIALVVVVLTVLQLPARQLHLSSFWLEKGSYALVGVLGI
FT                   LLCWRALKTLRALLRKPKFISFTPHHVHHEHCGCGHQHLPNPEQLRNGDDWRARLMIIL
FT                   SMGMRPCSGAIMVLLFSKVIGVFSWGMASALAMAAGTSLTITSLALLVHSFRALAVKLS
FT                   GNKTPVLWRQVGWTTLALAGGVILVVAAVVMWMSAVPVGRGLRPF"
FT   gene            complement(240813..241607)
FT                   /locus_tag="CKO_00248"
FT   CDS_pept        complement(240813..241607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2546 4.2e-133 suhB; putative
FT                   myo-inositol-1(or 4)-monophosphatase K01092; COG: COG0483
FT                   Archaeal fructose-1,6-bisphosphatase and related enzymes of
FT                   inositol monophosphatase family; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11412"
FT                   /db_xref="GOA:A8AD49"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD49"
FT                   /inference="protein motif:BlastProDom:IPR000760"
FT                   /inference="protein motif:FPrintScan:IPR000760"
FT                   /inference="protein motif:HMMPfam:IPR000760"
FT                   /inference="protein motif:ScanRegExp:IPR000760"
FT                   /inference="similar to AA sequence:SwissProt:P58537"
FT                   /protein_id="ABV11412.1"
FT                   /translation="MLTIAVRAARKAGNVIAKHYETPDSVETSQKGSNDFVTNVDKAAE
FT                   AIIIETIRKSYPQHTIITEESGEHEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRI
FT                   KGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYAT
FT                   TYINIVSKLFTECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAGGELLVREAGG
FT                   IVSDFTGGHNYMTTGNIVAGNPRVVKAMLASMRDELSDALKR"
FT   gene            241735..242466
FT                   /locus_tag="CKO_00249"
FT   CDS_pept        241735..242466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2545 6.2e-123 putative rRNA methylase
FT                   K02533; COG: COG0565 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11413"
FT                   /db_xref="GOA:A8AD50"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD50"
FT                   /inference="protein motif:BlastProDom:IPR001537"
FT                   /inference="protein motif:HMMPfam:IPR001537"
FT                   /inference="protein motif:HMMTigr:IPR004384"
FT                   /inference="similar to AA sequence:REFSEQ:NP_457076.1"
FT                   /protein_id="ABV11413.1"
FT                   /translation="MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQ
FT                   AIALAAGASDVIGNAQIVDTLDDALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEA
FT                   VNTPVALVFGRERVGLTNDELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLAT
FT                   QENDETAEHEETPYPLVDDLERFYGHLEQTLLSTGFIREGHPGQVMNKLRRLFTRARPE
FT                   SQELNILRGILASIEQQNKGK"
FT   gene            242698..243189
FT                   /locus_tag="CKO_00250"
FT   CDS_pept        242698..243189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ama:AM656 1.4e-14 aminotransferase, class V
FT                   K04487; COG: COG1959 Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11414"
FT                   /db_xref="GOA:A8AD51"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD51"
FT                   /inference="protein motif:BlastProDom:IPR000944"
FT                   /inference="protein motif:HMMPfam:IPR000944"
FT                   /inference="protein motif:HMMTigr:IPR000944"
FT                   /inference="protein motif:HMMTigr:IPR010242"
FT                   /inference="protein motif:ScanRegExp:IPR000944"
FT                   /inference="similar to AA sequence:INSD:ABB67099.1"
FT                   /protein_id="ABV11414.1"
FT                   /translation="MRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQL
FT                   FSRLRKNGLVSSVRGPGGGYLLGKDAGSIAVGEVISAVDESVDATRCQGKGGCQGGDKC
FT                   LTHALWRDLSDRLTGFLNNITLGELVNNQEVLDVSDRQHTHDAPRSTRTQDAIDVKLRA
FT                   "
FT   gene            243413..244648
FT                   /locus_tag="CKO_00251"
FT   CDS_pept        243413..244648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbo:SBO_2554 8.6e-213 yfhO; putative
FT                   aminotransferase K04487; COG: COG1104 Cysteine sulfinate
FT                   desulfinase/cysteine desulfurase and related enzymes; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11415"
FT                   /db_xref="GOA:A8AD52"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD52"
FT                   /inference="protein motif:HMMPfam:IPR000192"
FT                   /inference="protein motif:HMMTigr:IPR010240"
FT                   /inference="protein motif:ScanRegExp:IPR000192"
FT                   /inference="similar to AA sequence:INSD:ABJ01957.1"
FT                   /protein_id="ABV11415.1"
FT                   /translation="MYGVYRAMKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPAS
FT                   RSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHI
FT                   ITSKTEHKAVLDTCRQLEREGFEVTYLAPQSNGIIDLKELEAAMRDDTILVSIMHVNNE
FT                   IGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGA
FT                   LYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRTLR
FT                   NRLWNGINDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASL
FT                   EPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMFKQ
FT                   GVDLNSIEWAHH"
FT   gene            244676..245062
FT                   /locus_tag="CKO_00252"
FT   CDS_pept        244676..245062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_1354 5.9e-16 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   K00566; COG: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11416"
FT                   /db_xref="GOA:A8AD53"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD53"
FT                   /inference="protein motif:HMMPfam:IPR002871"
FT                   /inference="protein motif:HMMTigr:IPR011339"
FT                   /inference="similar to AA sequence:INSD:ABR78271.1"
FT                   /protein_id="ABV11416.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSFDNSDENVGSGMVGAPACGDVMKLQI
FT                   KVNNEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIADELELPPVKI
FT                   HCSILAEDAIKAAIADYKSKREAK"
FT   gene            245191..245403
FT                   /locus_tag="CKO_00253"
FT   CDS_pept        245191..245403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00253"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0316 Uncharacterized conserved protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11417"
FT                   /db_xref="GOA:A8AD54"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD54"
FT                   /inference="protein motif:BlastProDom:IPR000361"
FT                   /inference="protein motif:HMMPanther:IPR000361"
FT                   /inference="protein motif:HMMPfam:IPR000361"
FT                   /inference="protein motif:HMMTigr:IPR000361"
FT                   /inference="protein motif:ScanRegExp:IPR000361"
FT                   /inference="similar to AA sequence:INSD:ABR78270.1"
FT                   /protein_id="ABV11417.1"
FT                   /translation="MAYVLEFVDEPAAEDTVFEDKGVKVVIDGKSLQFLDGTQLDFVKE
FT                   GLNEGFKFTNPNVKDECGCGESFNV"
FT   gene            245499..246014
FT                   /locus_tag="CKO_00254"
FT   CDS_pept        245499..246014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00254"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1076 DnaJ-domain-containing proteins 1;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11418"
FT                   /db_xref="GOA:A8AD55"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD55"
FT                   /inference="protein motif:HMMPfam:IPR001623"
FT                   /inference="protein motif:HMMPfam:IPR012895"
FT                   /inference="protein motif:HMMSmart:IPR001623"
FT                   /inference="protein motif:HMMTigr:IPR004640"
FT                   /inference="protein motif:superfamily:IPR001623"
FT                   /inference="protein motif:superfamily:IPR009073"
FT                   /inference="similar to AA sequence:INSD:BAA16421.1"
FT                   /protein_id="ABV11418.1"
FT                   /translation="MDYFTLFGLPAHYQLDTQALSLRFQDLQRQYHPDKFASGTQAEQL
FT                   AAVQHSATINQAWQTLRHPLTRAEYLLSLHGFDLASEQHTVRDTAFLMEQLELREELDE
FT                   IEQAKDEARLESFIKRVKTMFDARHQLMVEQLDNETWDVAADTVRKLRFLDKLRSSAEQ
FT                   LEEKLLDF"
FT   gene            246030..247880
FT                   /locus_tag="CKO_00255"
FT   CDS_pept        246030..247880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2848 0. hscA; chaperone protein
FT                   HscA K04044; COG: COG0443 Molecular chaperone; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11419"
FT                   /db_xref="GOA:A8AD56"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD56"
FT                   /inference="protein motif:BlastProDom:IPR013126"
FT                   /inference="protein motif:FPrintScan:IPR001023"
FT                   /inference="protein motif:HMMPanther:IPR001023"
FT                   /inference="protein motif:HMMPfam:IPR013126"
FT                   /inference="protein motif:HMMTigr:IPR010236"
FT                   /inference="protein motif:ScanRegExp:IPR013126"
FT                   /protein_id="ABV11419.1"
FT                   /translation="MALLQISEPGLSAAPHQRRLAAGIDLGTTNSLVATVRSGQAETLA
FT                   DHDGRHLLPSVVHYQQQGHTVGYAARANAAQDTANTISSVKRMMGRSLADIQTRYPHLP
FT                   YQFQASENGLPMIETAAGLLNPVRISADILKALAARATEALSGELDGVVITVPAYFDDA
FT                   QRQGTKDAARLAGLHVLRLLNEPTAAAIAYGLDSGKEGVIAVYDLGGGTFDISILRLSR
FT                   GVFEVLATGGDSALGGDDFDHLLADYIREQAGIADRSDNRVQRELLDAAIAAKIALSDA
FT                   DSVSVNVAGWQGDITREQFNDLIAALVKRTLMACRRALKDAGVEAQEVLEVVMVGGSTR
FT                   VPLVRERVGEFFGRPPLTAIDPDKVVAIGAAIQADILVGNKPDSEMLLLDVIPLSLGLE
FT                   TMGGLVEKVIPRNTTIPVARAQDFTTFKDGQTAMSIHVMQGERELVQDCRSLARFALRG
FT                   LPAMPAGGAHIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPSYGLTDSEIATMIQDSM
FT                   SFAEQDVKARMLAEQKVEAARVLESLTGALAADAALLSAAERQVIDDAAAHLSEVAQSD
FT                   DGDAIEQAIKNVDKQTQEFAARRMDKSVRRALQGHSVDEV"
FT   gene            247882..248217
FT                   /locus_tag="CKO_00256"
FT   CDS_pept        247882..248217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2847 7.5e-56 fdx; ferredoxin,
FT                   2Fe-2S K04755; COG: COG0633 Ferredoxin; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11420"
FT                   /db_xref="GOA:A8AD57"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD57"
FT                   /inference="protein motif:Gene3D:IPR012675"
FT                   /inference="protein motif:HMMPfam:IPR001041"
FT                   /inference="protein motif:HMMTigr:IPR011536"
FT                   /inference="protein motif:ScanRegExp:IPR001055"
FT                   /inference="protein motif:superfamily:IPR001041"
FT                   /inference="similar to AA sequence:INSD:AAO68042.1"
FT                   /protein_id="ABV11420.1"
FT                   /translation="MPKIVILPHQDLCPDGAVLEAETGETILDVALRNGIEIEHACEKS
FT                   CACTTCHCIVREGFDSLPESTEDEDDMLDKAWGLEPESRLGCQARVTDEDLVVEIPRYT
FT                   INHAREH"
FT   gene            248229..248429
FT                   /locus_tag="CKO_00257"
FT   CDS_pept        248229..248429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00257"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2975 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11421"
FT                   /db_xref="GOA:A8AD58"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD58"
FT                   /inference="protein motif:HMMPfam:IPR007479"
FT                   /inference="similar to AA sequence:INSD:EAY46189.1"
FT                   /protein_id="ABV11421.1"
FT                   /translation="MGLKWTDSREIGEALYDAFPDLDPKTVRFTDLHQWICDLEDFDDD
FT                   PQASNEKILEAILLVWLDEAE"
FT   gene            complement(248327..248524)
FT                   /locus_tag="CKO_00259"
FT   CDS_pept        complement(248327..248524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11423"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD59"
FT                   /protein_id="ABV11423.1"
FT                   /translation="MGGERNFHRFSHCSFPSSRIQENGPPVGSPFIYSASSSQTSRIAS
FT                   RIFSFDACGSSSKSSRSQIH"
FT   gene            248489..249772
FT                   /locus_tag="CKO_00258"
FT   CDS_pept        248489..249772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2536 3.1e-217 pepB; peptidase B K07751;
FT                   COG: COG0260 Leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11422"
FT                   /db_xref="GOA:A8AD60"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR008330"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD60"
FT                   /inference="protein motif:HMMPfam:IPR000819"
FT                   /inference="protein motif:HMMPIR:IPR008330"
FT                   /inference="protein motif:ScanRegExp:IPR000819"
FT                   /inference="similar to AA sequence:INSD:AAL21430.1"
FT                   /protein_id="ABV11422.1"
FT                   /translation="MTEAMKITLSTQPADARWGDKATYSINNDGITLHLNGKDDSGLIQ
FT                   RAARKIDGLGIKHVQLTGAGWDVERSWAFWQGYKGPKGSRKVEWPDLDDEKRKELDNRL
FT                   TIIDWVRDTINAPAEELGPEQLAQRAVDLLCSVACDHVSYRITKGEDLREQNYMGLHTV
FT                   GRGSDRAPVLLALDYNPTGDKDAPVYACLVGKGITFDSGGYSIKQSAFMDSMKSDMGGA
FT                   ATVTGALAFAITRGLNKRVKLYLCCADNLISGNAFKLGDIIHYRNGKNVEVMNTDAEGR
FT                   LVLADGLIDASAQKPELIIDAATLTGAAKTALGNDYHALFSFDDALAGRLLASAAEENE
FT                   PFWRLPLAEFHRNQLPSNFAELNNTGSAAYPAGASTAAGFLSHFVENYQQGWLHIDCSA
FT                   TYRKAPVEQWSAGATGLGVRTIANLLTA"
FT   gene            249867..250643
FT                   /locus_tag="CKO_00260"
FT   CDS_pept        249867..250643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00260"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06208 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11424"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD61"
FT                   /inference="protein motif:HMMPfam:IPR009839"
FT                   /inference="similar to AA sequence:REFSEQ:YP_853664.1"
FT                   /protein_id="ABV11424.1"
FT                   /translation="MSETKNELETLLEKAATEPAHRPAFFRTLLESTVWVPGTAAEGEA
FT                   IVDDSALDLQHWEKEDGTTVIPFFTSLEALQQAVEDEQAFVVMPVRTLFEMTLGETLFL
FT                   NAKLPTGKEFMPREISHLIGEEGNPLSTQEVLEGGESLILSEVAEPPAQMIDSLTTLFK
FT                   TIKLVKRAFLCTIKESNDAQPNLLIGIEADGDIEEIIHAAGSVATDTLPGDEPIDICQV
FT                   KKGEQGISHFITEHIAPFYERRWGGFLRDFKQNRII"
FT   gene            complement(250734..251588)
FT                   /locus_tag="CKO_00261"
FT   CDS_pept        complement(250734..251588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_2603 2.3e-132 sseA; putative
FT                   thiosulfate sulfurtransferase K01011; COG: COG2897
FT                   Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11425"
FT                   /db_xref="GOA:A8AD62"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD62"
FT                   /inference="protein motif:HMMPfam:IPR001763"
FT                   /inference="protein motif:HMMSmart:IPR001763"
FT                   /inference="protein motif:ScanRegExp:IPR001307"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00700540.1"
FT                   /protein_id="ABV11425.1"
FT                   /translation="METPMSTSWFVAADWLAEHIDDPQIQIIDARMAPPGQEDRDVAGE
FT                   YRSGHIPGALFFDIEALSDHTSPLPHMMPRPEAFAVAMRELGVHQDRHLVVYDEGNLFS
FT                   APRAWWMLRTFGVENVSILAGGLAGWQRDELPLQEGEVELPEGEFDVKFTAEKVVRLTD
FT                   VLLASHERTAQIVDARPAPRFNAEADEPRPGLKRGHIPGALNVPWTELVREGELKTTDE
FT                   LDVIFFSHGVSFDRPIIASCGSGVTAAVVVLALATLDVPNVALYDGAWSEWGARNDLPV
FT                   EPA"
FT   gene            251787..256721
FT                   /locus_tag="CKO_00262"
FT   CDS_pept        251787..256721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00262"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2373 Large extracellular alpha-helical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11426"
FT                   /db_xref="GOA:A8AD63"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR040639"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD63"
FT                   /inference="protein motif:HMMPfam:IPR002890"
FT                   /inference="protein motif:HMMPfam:IPR011625"
FT                   /inference="protein motif:superfamily:IPR008930"
FT                   /inference="protein motif:superfamily:IPR008958"
FT                   /inference="protein motif:superfamily:IPR011047"
FT                   /protein_id="ABV11426.1"
FT                   /translation="MKHIRVAACMLMLALAGCDNNDNAPTAVKNDETPAAQSAPTKDPA
FT                   QLQKLAQQSEGKELTLLDASEVQLDGAATLVLTFSIPLDPEQDFARTVHVVDKKSGKVD
FT                   GAWELSPNLKELRLRHLEPNRDLVVSVERDLTALNKTAFGRAYEKTITTRDVQPSVGFA
FT                   SRGSLLPGKVVEGLPVMALNVNEVDVNFFRVKPESLAAFVSQWEYRNALSNWESDNLLK
FT                   MADLVYTGRFDLNPARNTREKRLLPLSDIKPLQQAGVYIAVMNQAGHYNYSNPATLFTL
FT                   SDIGVSAHRYHNRLDIFTQSLENGAAQQGVEVALLDEKGQTLAQAASDAQGHVQLENSQ
FT                   QAALLLARKDGQTTLLDLKLPALDLAEFAIAGAPGYSKQFFMFGPRDLYRPGETVILNG
FT                   LLRDSDGKTLPDQPVKLEVVKPDGQVLRTVVSQPENGLYRFTYPLDSGAPTGMWHIRAN
FT                   AGDNQPRMWDFHVEDFMPERMALNLSAQKTPLAPSEEVTFSVVGYYLYGAPANGNTLQG
FT                   QLFLRPQREAVQALPGFQFGDIAEENLSRSLDEVQLTLDENGRGDVSANSQWQEAHSPL
FT                   QVILQASLLESGGRPVTRRAEQAIWPTDTLPGIRPQFASKAVYDYRTDATVNQPIVDEG
FT                   GNAAFDIVYADAQGNKKAASGLQVRLIRERRDYYWNWSESEGWQSQFDQKDLVEGEQTL
FT                   DLSADETGKVSFPVDWGSYRLEVKAPNDAISSVRFWAGYSWQDNSDGSGAARPDRVTLK
FT                   LDKPTYRPGDTIKLHVAAPVAGKGYAMVESSDGPLWWQEIDVPAEGLDLSIPVDKAWNR
FT                   HDLYLSALVVRPGDKSRSATPKRAVGLLHLPLGDENRRLDLTLESPAKMRPNQPLTVNV
FT                   KASAKHGETPKQINVLLSAVDSGVLNITDYVTPDPWQAFFGQKRYGADIYDIYGQVIEG
FT                   QGRLATLRFGGDGDELKRGGKPPVNHVNIVAQQALPVTLNEQGEGSVTLPIGDFNGELR
FT                   VMAQAWTAEDFGSSESKVIVAAPVIAELNQPRFMAGGDTSRLTLDVTNLTDKPQTLTIE
FT                   LAASGLLELVSQQPAPVNLAPGVRTTLFIPVRAKEGFGEGELQATLTGLNLPGETLPAQ
FT                   HKQWKIAVRPAWPAQTVNSGTVLQAGETWHAPAQNLENFSPVTLQGQLLLSGKPPLNLA
FT                   RYIRELKAYPYGCLEQTASGLFPSLYTNAAQLKALGIAGDTDEKRRAAVDTGISRMLQM
FT                   QRDNGGFALWDNNGPEEYWLTAYAMDFLVRAGEQGYSVPADAINRGNERLLRYLQDPGM
FT                   MSVRYSDDTQASKFAVQAYAGLVLARQQKAPLGALREIWERRSQAASGLPLLQLGIALK
FT                   NMGDAGRSEQALTLALNTPRRDAQQWMADYGSPLRDNALMLSLLEENKLQPEAQNTLLT
FT                   TLSEQAFGQRWLSTQESNALFLAARTLQDLPGTWQAQTSLADQPLTGDKAQTRNLDADR
FT                   LSALQVTNSGDQPLWLRLDSSGYPQTAPVPASNVLHIERQILGTDGQSKSLSSLRSGEL
FT                   VLVWLEVKASQNVPDALVVDLLPAGLELENQNLANSSASLQDSGSEVQNLLNQMQQADI
FT                   QHMEFRDDRFVAAVAVNQGQPVTLVYLARAVTPGTYQVPVPQVESMYVPQWRATGSTEG
FT                   LLIVTP"
FT   gene            complement(256631..256768)
FT                   /locus_tag="CKO_00264"
FT   CDS_pept        complement(256631..256768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11428"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD64"
FT                   /protein_id="ABV11428.1"
FT                   /translation="MASQRQPPRRLRRTIIYGVTIKSPSVDPVARHCGTYIDSTCGTGT
FT                   "
FT   gene            256722..259034
FT                   /locus_tag="CKO_00263"
FT   CDS_pept        256722..259034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c3042 0. pbpC; penicillin-binding protein
FT                   1C K05367; COG: COG4953 Membrane
FT                   carboxypeptidase/penicillin-binding protein PbpC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11427"
FT                   /db_xref="GOA:A8AD65"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD65"
FT                   /inference="protein motif:BlastProDom:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001264"
FT                   /inference="protein motif:HMMPfam:IPR001460"
FT                   /inference="protein motif:HMMPfam:IPR009647"
FT                   /inference="protein motif:HMMTigr:IPR011815"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /protein_id="ABV11427.1"
FT                   /translation="MIVLRSLRGGWRWLAIAPFLMILAVWAADKIWPLPLHEVNPARVV
FT                   VAHDGTPLWRFADAEGIWRYPVTIEDVSPRYLDALINYEDRWFWQHPGVNPFSVLRAAW
FT                   QDLSSGRVISGGSTLTMQVARLLDPHPRTFGGKFRQLWRALQLEWHLSKRDILTLYLNR
FT                   APFGGTLQGIGAASWAYLGKPPTQLSYSEAALLAVLPQAPSRLRPDRWPDRAQAARNKV
FT                   LERMAAQGVWSARHVQEAREEPVWLAPRQMPQLAPLFSRMMLGKSNSNKIVTTLDAGLQ
FT                   RQLEELAQNWKGRLPARSSLAMIVVDHTDMSVRGWVGSVDMNDDSRFGHVDMVTAIRSP
FT                   GSVLKPFVYGLALDDGLIHPASLLQDVPRRTGDYRPGNFDSGFHGPVSMSEALVRSLNL
FT                   PAVQVLEAYGPKRFAAKLRNVGLPLYLPAGAAPNLSLILGGAGARLDEMVVAYSAFARH
FT                   GKAATLRLQPGDSLQERPLMSPGAAWIIRRVMADEAQPLPDSALPRVVPLAWKTGTSYG
FT                   YRDAWAIGISSRYVTGIWTGRPDGTPVAGQFGFASAVPLLNQVNNMLMARAATQPEDPR
FT                   PASVSRGVICWPGGQALSAGDSNCRRRLATWLLENSQPPTLLLPEQEGISGIRFPVWLD
FT                   NDGKRVAADCAQAREQTLIVWPLPLEPWLPAAERRAARLPTASTACPPLGQDAPLPLQL
FT                   TGVRDGAIVKRLPGASGVDLSIQSSGGAGARWWFLNGEPLGERERNITLHLAEKGEYQL
FT                   LVMDAAGQISALRFTLQ"
FT   gene            complement(259120..259533)
FT                   /locus_tag="CKO_00266"
FT   CDS_pept        complement(259120..259533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00266"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11430"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD66"
FT                   /inference="similar to AA sequence:INSD:EAY46215.1"
FT                   /protein_id="ABV11430.1"
FT                   /translation="MGAVFGEAVRVVGTQGARQRVSRVGCAQQVAVTLHGIFAFQYGNH
FT                   DRARGHELDQTVEERFTIVLGIETARLLNGQVQHFRTDNFEPCCFKARKDVANNVFCHR
FT                   IWFDDGKSTFNRHDYLCNVFCCCIYACTTWRGL"
FT   gene            259183..259614
FT                   /locus_tag="CKO_00265"
FT   CDS_pept        259183..259614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2771 6.7e-71 ndk; nucleoside
FT                   diphosphate kinase (ndk) K00940; COG: COG0105 Nucleoside
FT                   diphosphate kinase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11429"
FT                   /db_xref="GOA:A8AD67"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD67"
FT                   /inference="protein motif:BlastProDom:IPR001564"
FT                   /inference="protein motif:Gene3D:IPR001564"
FT                   /inference="protein motif:HMMPfam:IPR001564"
FT                   /inference="protein motif:HMMPIR:IPR012005"
FT                   /inference="protein motif:HMMSmart:IPR001564"
FT                   /inference="protein motif:ScanRegExp:IPR001564"
FT                   /inference="protein motif:superfamily:IPR001564"
FT                   /inference="similar to AA sequence:INSD:AAV76358.1"
FT                   /protein_id="ABV11429.1"
FT                   /translation="MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVE
FT                   QARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLR
FT                   ADYADSFTENGTHGSDSLESAQREIAYFFGEGEVCPRTR"
FT   gene            259687..259824
FT                   /locus_tag="CKO_00267"
FT   CDS_pept        259687..259824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11431"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD68"
FT                   /protein_id="ABV11431.1"
FT                   /translation="MALTLIRPTTYQVYDAALPLHIIFANVPRRRGILAIEFVQCSAPG
FT                   "
FT   gene            259900..261066
FT                   /locus_tag="CKO_00268"
FT   CDS_pept        259900..261066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t1964 0.0012 pflA; pyruvate formate-lyase
FT                   1 activating enzyme K04069; COG: COG0820 Predicted
FT                   Fe-S-cluster redox enzyme; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11432"
FT                   /db_xref="GOA:A8AD69"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD69"
FT                   /inference="protein motif:HMMPfam:IPR007197"
FT                   /inference="protein motif:HMMTigr:IPR004383"
FT                   /inference="protein motif:superfamily:IPR009063"
FT                   /inference="similar to AA sequence:INSD:AAL21419.1"
FT                   /protein_id="ABV11432.1"
FT                   /translation="MSEQIVTSEIITPVVPDKNGKINLLDLNRQQMREFFKELGEKPFR
FT                   ADQVMKWMYHYCSDNFDEMTDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVG
FT                   DQRVETVYIPEDDRATLCVSSQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIV
FT                   GAAKVTGQRPITNVVMMGMGEPLLNLTNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPA
FT                   LDKLGDMIDVALAISLHAPNDEIRDEIVPINRKYNIETFLDAVRRYLQKSNANQGRVTI
FT                   EYVMLDHINDGTEHAHQLAELLKDTPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMS
FT                   YGFTTIVRKTRGDDIDAACGQLAGDVIDRTKRTLRKRMQGEAIDIKAV"
FT   gene            261357..262370
FT                   /locus_tag="CKO_00269"
FT   CDS_pept        261357..262370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1517 4.1e-05 glucosyltransferase-S
FT                   K00689; COG: COG1426 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11433"
FT                   /db_xref="GOA:A8AD70"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023690"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD70"
FT                   /inference="protein motif:HMMPfam:IPR001387"
FT                   /inference="protein motif:HMMSmart:IPR001387"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217508.1"
FT                   /protein_id="ABV11433.1"
FT                   /translation="MNTEATHDQNEAQSTGVRLRNAREQLGLSQQAVAERLCLKVSTVR
FT                   DIEEDKAPADLASTFLRGYIRSYARLVHIPEEELLPGLEKQAPVRPSKVAPMQSFSLGK
FT                   RRKKRDGWLMTFTWLVLFVVVGLTGAWWWQNHKAQQEELTTMVDQSSAELNAGGDSAQS
FT                   VPLDTSEAASQDSTPAPTAPVDSTATNAVPQTPDASATTTAPAADAQQNAVVAPSQANV
FT                   DTATTAPAATGDTASLPTDQAGVATSAVDQNALVMNFTADCWLEVTDATGKKLFSGMQR
FT                   KDGNLNLTGQAPYKLKIGAPAAVQIQYQGKPVDLSRFIRTNQVARLTLNAEQSPAQ"
FT   gene            262397..263515
FT                   /locus_tag="CKO_00270"
FT   CDS_pept        262397..263515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW2499 2.6e-188 ispG;
FT                   1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase
FT                   K03526; COG: COG0821 Enzyme involved in the deoxyxylulose
FT                   pathway of isoprenoid biosynthesis; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11434"
FT                   /db_xref="GOA:A8AD71"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD71"
FT                   /inference="protein motif:HMMPfam:IPR004588"
FT                   /inference="protein motif:HMMTigr:IPR004588"
FT                   /inference="similar to AA sequence:INSD:AAC75568.1"
FT                   /protein_id="ABV11434.1"
FT                   /translation="MHNQAPIQRRKSKRIYVGNVPIGDGAPIAVQSMTNTRTTDVEATV
FT                   NQIKALERVGADIVRVSVPTMDAAEAFKLIKQQVNVPLVADIHFDYRIALKVAEYGVDC
FT                   LRINPGNIGNEERIRTVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPQALLESAMR
FT                   HVDHLDRLNFDQFKVSVKASDVFLAVESYRLLAKQIEQPLHLGITEAGGARSGAVKSAI
FT                   GLGLLLSEGIGDTLRVSLAADPVEEIKVGFDILKSLRIRARGINFIACPTCSRQEFDVI
FT                   GTVNALEQRLEDIITPMDVSIIGCVVNGPGEALVSTLGVTGGNKKSGLYEDGVRKDRLD
FT                   NDDMITQLEARIRAKASIMDEARRIDVQQVEK"
FT   gene            263515..263605
FT                   /locus_tag="CKO_00271"
FT   misc_RNA        263515..263605
FT                   /locus_tag="CKO_00271"
FT                   /product="SroE RNA"
FT                   /note="Rfam score 99.78"
FT                   /inference="nucleotide motif:Rfam:RF00371"
FT   gene            263655..264899
FT                   /locus_tag="CKO_00272"
FT   CDS_pept        263655..264899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2522 3.6e-214 hisS; histidine tRNA
FT                   synthetase K01892; COG: COG0124 Histidyl-tRNA synthetase;
FT                   Psort location: Cytoplasmic, score:9.99"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11435"
FT                   /db_xref="GOA:A8AD72"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD72"
FT                   /inference="protein motif:Gene3D:IPR004154"
FT                   /inference="protein motif:HMMPfam:IPR002314"
FT                   /inference="protein motif:HMMPfam:IPR004154"
FT                   /inference="protein motif:HMMPIR:IPR004516"
FT                   /inference="protein motif:HMMTigr:IPR004516"
FT                   /inference="protein motif:superfamily:IPR004154"
FT                   /inference="similar to AA sequence:SwissProt:O52765"
FT                   /protein_id="ABV11435.1"
FT                   /translation="MNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRA
FT                   IGEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRH
FT                   ERPQKGRYRQFHQLGVEAFGLQGPDIDAELILLTARWWRALGIAEHVNLELNSIGSLDA
FT                   RANYRDALVAYLEQHKEKLDEDCKRRMYTNPLRVLDSKNPDVQALLNDAPALGDYLDDD
FT                   SREHFAGLCKLLEAAGIAYTVNQRLVRGLDYYNRTVFEWVTNSLGSQGTVCAGGRYDGL
FT                   VEQLGGRATPAVGFAMGLERLVLLVQAVNLEFNADPVVDIYLVASGADTQSAAMTLAER
FT                   LRDENPGVKLMTNHGGGNFKKQFARADKWGARVALVLGESEVADGTVVVKDLRSGEQTA
FT                   VAQDSVTAHLRTLLG"
FT   gene            264913..265533
FT                   /locus_tag="CKO_00273"
FT   CDS_pept        264913..265533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00273"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2976 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11436"
FT                   /db_xref="GOA:A8AD73"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD73"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311402.1"
FT                   /protein_id="ABV11436.1"
FT                   /translation="MEIYENENDQVDAIKRFFAENGKALAVGVILGVGALLGWRYWTSH
FT                   QTESARSASLAYQNAVTAVSAGKPDSISAAEKFATENKNTYGALASMELAQQFVDQNEL
FT                   EKAAAQLQQGLAATSDENLKAVINLRLARVQVQLKQADTALKTLDTVKGEGWAAIVADL
FT                   RGEALLSKGDKQGARSAWEAGVKSDASPALSEMMQMKINNLSI"
FT   gene            265544..266722
FT                   /locus_tag="CKO_00274"
FT   CDS_pept        265544..266722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2833 1.6e-195 yfgL; hypothetical
FT                   protein YfgL K00870; COG: COG1520 FOG: WD40-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11437"
FT                   /db_xref="GOA:A8AD74"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD74"
FT                   /inference="protein motif:HMMPfam:IPR002372"
FT                   /inference="protein motif:HMMSmart:IPR002372"
FT                   /inference="protein motif:superfamily:IPR011047"
FT                   /inference="similar to AA sequence:REFSEQ:YP_541824.1"
FT                   /protein_id="ABV11437.1"
FT                   /translation="MQLRKLLLPGLLSVTLLSGCSLFSGEEDVVKMSPLPTVENQFTPS
FT                   TAWSTSVGSGIGEFYSNLHPAYADNVVYAADRKGTVKAVNADDGKEVWSVNLAEKDGWF
FT                   SRAPALLSGGVTVSGGHVYVGSEKAQVYALNAADGTTAWQTKVAGEALSRPVVSDGLVL
FT                   IHTSNGQLQALNEADGAIKWTVNLDMPSLSLRGESAPATAYGAAIVGGDNGRVSAVLMQ
FT                   QGQMIWQQRISQATGSTEIDRLSDVDTTPVIVNGVVYALAYNGNLTALDLRSGQIMWKR
FT                   ELGSVNDFIVDGDRIYLVDQNDRILALTTDGGVTLWTQSDLLHRLLTSPALYNGNLVVG
FT                   DSEGYMHWINVEDGRFVAQQKVDSSGFLTEPVSADGKLLIQAKDGTLYSITR"
FT   gene            266841..268313
FT                   /locus_tag="CKO_00275"
FT   CDS_pept        266841..268313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cjk:jk0878 4.6e-73 cmk; putative GTPases
FT                   K03977; COG: COG1160 Predicted GTPases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11438"
FT                   /db_xref="GOA:A8AD75"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD75"
FT                   /inference="protein motif:HMMPfam:IPR002917"
FT                   /inference="protein motif:HMMTigr:IPR005225"
FT                   /inference="protein motif:HMMTigr:IPR005289"
FT                   /inference="similar to AA sequence:INSD:AAV76365.1"
FT                   /protein_id="ABV11438.1"
FT                   /translation="MVPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGRA
FT                   EIEGREFICIDTGGIDGTEDGVETRMAEQSLLAIEEADVVLFMVDARAGLMPADEAIAK
FT                   HLRSREKPTFLVANKTDGLDPDQAVVDFYALGLGEIHPIAASHGRGVLSLLEHVLLPWM
FT                   DDVAPQEEVDEDAEYWAKLAAEENGEEEPEDDFNPQDLPIKLAIVGRPNVGKSTLTNRI
FT                   LGEDRVVVYDMPGTTRDSIYIPMERDEREYVLIDTAGVRKRGKVTDAVEKFSVIKTLQA
FT                   IEDANVVMLVIDAREGISDQDLSLLGFILNSGRSLVIVVNKWDGLTQEVKEQVKETLDF
FT                   RLGFIDFARVHFISALHGSGVGNLFESVREAYDSSTRRVSTAMLTRIMAMAVEDHQPPL
FT                   VRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRYLMNYFRKSLDVMGTPIRIQFK
FT                   EGENPYANKRNTLTPTQMRKRKRLIKHIKKSK"
FT   gene            268614..270167
FT                   /locus_tag="CKO_00276"
FT   CDS_pept        268614..270167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00276"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3104 Dipeptide/tripeptide permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11439"
FT                   /db_xref="GOA:A8AD76"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD76"
FT                   /inference="protein motif:HMMPanther:IPR000109"
FT                   /inference="protein motif:HMMPanther:IPR005279"
FT                   /inference="protein motif:HMMPfam:IPR000109"
FT                   /inference="protein motif:HMMTigr:IPR005279"
FT                   /inference="protein motif:ScanRegExp:IPR000109"
FT                   /inference="similar to AA sequence:INSD:ABP59508.1"
FT                   /protein_id="ABV11439.1"
FT                   /translation="MQSSVNQKESRTFFGHPYPLGSLFFTEMWERFSFYGIRPLLILFM
FT                   AATVYDGGMGLARENASAIVGIFAGTMYLAALPGGWLADNWLGQQKAVWYGSILIALGH
FT                   LSIALSAVMGDNLFFIGLMFIVLGSGLFKTCISVMVGTLYKKGDARRDGGFSLFYMGIN
FT                   MGSFIAPLISGWLIKSHGWHWGFGIGGIGMLVALIIFRVFAVPAMKRYDSEVGLDSTWN
FT                   SPVVKRNGVGAWLLALAVGVVVIVALIAQGVIVINPVAVASMLVYVIAASVALYFIYLF
FT                   VFAGLNRKERARLLVCFILLVSAAFFWSAFEQKPTSFNLFANDYTNRMIGDFEIPAVWF
FT                   QSINALFIILLAPVFSWAWPKLASMNIRPSSITKFVIGILCAAAGFGLMMLAAQNVLNN
FT                   GGAGVSPFWLVGSILMLTLGELCLSPIGLATMTLLAPERMRGQMMGLWFCASALGNLAA
FT                   GLIGGHVKADQLDMLPDLFARCSVALLICAAVLIVLIVPVRRMLENTQTKNEQKPVTNA
FT                   "
FT   gene            270265..270513
FT                   /locus_tag="CKO_00277"
FT   CDS_pept        270265..270513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aha:AHA_1764 2.7e-12 ubiquitin ligase sinat5
FT                   K01932; COG: NOG17950 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11440"
FT                   /db_xref="InterPro:IPR010807"
FT                   /db_xref="InterPro:IPR029037"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD77"
FT                   /inference="protein motif:HMMPfam:IPR010807"
FT                   /inference="similar to AA sequence:INSD:ABP61665.1"
FT                   /protein_id="ABV11440.1"
FT                   /translation="MLSPQDIKGVTVSITCPDCHTELEPQNGAAHCDSCNKDIELEARC
FT                   PECHKPLQVLKACGAVDYFCQNDHGLISKKRVEFVPL"
FT   gene            complement(270510..271883)
FT                   /locus_tag="CKO_00278"
FT   CDS_pept        complement(270510..271883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_2705 1.0e-216 xseA; exonuclease VII,
FT                   large subunit K03601; COG: COG1570 Exonuclease VII, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11441"
FT                   /db_xref="GOA:A8AD78"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD78"
FT                   /inference="protein motif:HMMPfam:IPR003753"
FT                   /inference="protein motif:HMMPfam:IPR004365"
FT                   /inference="protein motif:HMMTigr:IPR003753"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177715.1"
FT                   /protein_id="ABV11441.1"
FT                   /translation="MLSSQTSTIFTVSRLNQTVRLLLEQEMGQVWISGEISNFTQPASG
FT                   HWYFTLKDDTAQVRCAMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIIESMQP
FT                   AGEGLLQQKYELLKAKLQAEGLFDQQYKQPLPSPAHCVGVITSKTGAALHDILHVLKRR
FT                   DPSLPVIIYPTAVQGDDAPGQIVRAIERANARNECDVLIVGRGGGSLEDLWSFNDERVA
FT                   RAIFASRIPVVSAVGHETDVTIADFVADLRAPTPSAAAEIVSRNQQELLRQIQSAQQRL
FT                   GMAMDYYLANRNRRFTQLFHRLQQQHPQLRLARQQTMLERLRQRMNFALDNQLKRAASR
FT                   QQRVLQRLNQQNPQPRIYRAQTRIQQLEYRLAENVRARLSATRERFGNAVTHLEAVSPL
FT                   STLARGYSVTTATDGKVLKQTRQVKAGDVLTTRLSDGWVESEVKGVTTAKKTRRKKTD"
FT   gene            272045..273511
FT                   /locus_tag="CKO_00279"
FT   CDS_pept        272045..273511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c3027 1.3e-248 guaB;
FT                   inositol-5-monophosphate dehydrogenase K00088; COG: COG0517
FT                   FOG: CBS domain; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11442"
FT                   /db_xref="GOA:A8AD79"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD79"
FT                   /inference="protein motif:HMMPanther:IPR001093"
FT                   /inference="protein motif:HMMPfam:IPR000644"
FT                   /inference="protein motif:HMMPfam:IPR001093"
FT                   /inference="protein motif:HMMSmart:IPR000644"
FT                   /inference="protein motif:HMMTigr:IPR005990"
FT                   /inference="protein motif:ScanRegExp:IPR001093"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00724104.1"
FT                   /protein_id="ABV11442.1"
FT                   /translation="MLRIAKEALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPML
FT                   SAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTT
FT                   TLREVKELTERNGFAGYPVVTEDNELVGIITGRDVRFVTDLSQPVSVYMTPKERLVTVR
FT                   EGEAREVVFAKMHEKRVEKALVVDDSFHLIGMITVKDFQKAERKPNACKDEQGRLRVGA
FT                   AVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATG
FT                   AGARALADAGVSAVKVGIGPGSICTTRIVTGVGVPQITAVSDAVEALEGLGIPVIADGG
FT                   IRFSGDIAKAIAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSS
FT                   DRYFQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDALRTKAE
FT                   FVRISGAGIQESHVHDVTITKESPNYRLGS"
FT   gene            273580..275157
FT                   /locus_tag="CKO_00280"
FT   CDS_pept        273580..275157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2508 3.1e-279 guaA; GMP synthetase
FT                   K01951; COG: COG0518 GMP synthase - Glutamine
FT                   amidotransferase domain; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11443"
FT                   /db_xref="GOA:A8AD80"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD80"
FT                   /inference="protein motif:FPrintScan:IPR001317"
FT                   /inference="protein motif:FPrintScan:IPR006220"
FT                   /inference="protein motif:FPrintScan:IPR011702"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="protein motif:HMMPfam:IPR001674"
FT                   /inference="protein motif:HMMPfam:IPR004506"
FT                   /inference="protein motif:HMMTigr:IPR001674"
FT                   /inference="protein motif:HMMTigr:IPR004739"
FT                   /inference="protein motif:ScanRegExp:IPR012998"
FT                   /inference="similar to AA sequence:INSD:ABP61662.1"
FT                   /protein_id="ABV11443.1"
FT                   /translation="MTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQ
FT                   IREFNPSGIILSGGPESTTEENSPRAPEYVFEAGVPVFGVCYGMQTMAMQLGGHVEASN
FT                   EREFGYAQVEVRTNSALIRGIEDSLTADGKPLLDVWMSHGDKVTAIPSDFVTVASTETC
FT                   PFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVNRIR
FT                   EQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVMDMFGDHF
FT                   GLNIVHVPAEERFLTALKGENDPEAKRKIIGRVFVEVFDEEAFRLEDVKWLAQGTIYPD
FT                   VIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLY
FT                   RHPFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVG
FT                   VMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGK
FT                   PPATIEWE"
FT   gene            275429..275662
FT                   /locus_tag="CKO_00281"
FT   CDS_pept        275429..275662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00281"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG23217 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11444"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD81"
FT                   /inference="protein motif:HMMPfam:IPR003756"
FT                   /inference="similar to AA sequence:REFSEQ:YP_050337.1"
FT                   /protein_id="ABV11444.1"
FT                   /translation="MKVETISYVKKNAATLDLSEPILVTQNGVPAYVIESYDQQQEREN
FT                   AIALLKLLTLSEKDKAEGRVFSKDQLLDGLAD"
FT   gene            275693..276025
FT                   /locus_tag="CKO_00282"
FT   CDS_pept        275693..276025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00282"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG36091 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11445"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD82"
FT                   /inference="similar to AA sequence:INSD:AAS58746.1"
FT                   /protein_id="ABV11445.1"
FT                   /translation="MEQLVTFEYTLTVKHCIDTIAGFLRHVDVEPRPVIADILTQFEST
FT                   VGQFPLGCQICPELLKIGCAKYREFNHAEGYRVLYSVDGALVTAHAILSHRQDIQQLLF
FT                   RRLIAA"
FT   gene            complement(276161..276352)
FT                   /locus_tag="CKO_00283"
FT   CDS_pept        complement(276161..276352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00283"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13900 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11446"
FT                   /db_xref="InterPro:IPR022576"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD83"
FT                   /inference="similar to AA sequence:INSD:EAY46208.1"
FT                   /protein_id="ABV11446.1"
FT                   /translation="MSQATSMRKRHRFNSRMTRIVLFISFLFFFGRFVYSSIGAWHHHQ
FT                   DKKEAQQSTLSVETPAQR"
FT   gene            276370..276543
FT                   /locus_tag="CKO_00284"
FT   CDS_pept        276370..276543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11447"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD84"
FT                   /protein_id="ABV11447.1"
FT                   /translation="MPSIVGDGYIKAHCKGMVNCRLCKNTSVDLSLIVMEDNFSIYINN
FT                   KLMITKQKKRNY"
FT   gene            276705..278954
FT                   /locus_tag="CKO_00285"
FT   CDS_pept        276705..278954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3829 2.4e-26 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s) K01745;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11448"
FT                   /db_xref="GOA:A8AD85"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD85"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABV11448.1"
FT                   /translation="MKLNQTYIKIRDKWWVLPLILPSLLLPILSIANTYAHTNTGSGNV
FT                   TLFYLPLAFTISLMSFFDWAALPGIAVAIFWNRYPIVGLYETLSIIGHFIIPVVLCWGG
FT                   YRVFTPRRNQVSHGDAHLMFQRMFWQVFCPATLFLVLFQFAAFLGMYASKSSMMGVMPF
FT                   NINTLINYQALLVGNLIGVPLCYFIIRTVRNPLYLRGYYAQLKQQFDKKVTKKEVVIWL
FT                   LVLTLLMTMLCMPLNENSSIFSTNYTLSLLLPVMLWGAMRYGYRFISLIWSAVLITAIH
FT                   YYQSYMPYYSGYDTQLTITSSSYLVFSFIVSYMAVLATRQRIVSGRARRLAYLDPVVHL
FT                   PNLRALNRVLKNSPWSALCFLRVPGLELLGKNYGVMLRIQYKQKLSHWINTLLAPGECV
FT                   YQLSGHDLILRLNMESHQQRIEALDNHIKQFRFMWDDMPLQPQVGVSYCYVRSPVSHIY
FT                   LLLGELSTIADLSLMTNKPENMQRRGAMHLQRDLKDKVAMMNRLQYALEHDHFCLMAQP
FT                   ISGIRGDVYHEILLRLKDDNGGMINPDGFLPVAHEFGLSSSIDLWVIENTLRFMAENRD
FT                   KLPAHRFAINLSPTSVCRAQFPIDVSNLLSQYEVEAWQLIFEVTESNAFTNAEQGQATL
FT                   SQLQQLGCQIAIDDFGTGYASYARLKNVSANILKIDGSFIRNIVSNSLDYQIVASICHL
FT                   ARMKNMQVVAEYVESEEIRSAVSALGIDYLQGYLLGEPRPLAATLEEVQAPLSGA"
FT   gene            complement(278962..280503)
FT                   /locus_tag="CKO_00286"
FT   CDS_pept        complement(278962..280503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2743 3.3e-259 ppx; exopolyphosphatase
FT                   K01514; COG: COG0248 Exopolyphosphatase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11449"
FT                   /db_xref="GOA:A8AD86"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD86"
FT                   /inference="protein motif:HMMPfam:IPR003695"
FT                   /inference="similar to AA sequence:SwissProt:P0A269"
FT                   /protein_id="ABV11449.1"
FT                   /translation="MPIHDKTPRPQEFAAVDLGSNSFHMVIARVVDGAMQIIGRLKQRV
FT                   HLADGLGEDNMLSEEAIERGLSCLSLFAERLQGFSPSSVCIVGTHTLRQALNATDFLKR
FT                   AEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPKLVE
FT                   SRRMGCVSFAQIYFPGGAISPENFQRARMAAAQKLETLTWQFRIQGWNVALGASGTIKA
FT                   AHEVLLEMGEKDGFITPERLDKLMAEVLRHRSFEALSLPGLSEERKAVFVPGLAILCGV
FT                   FDALAIRELRLSDGALREGVLYEMEGRFRHQDVRSRTAKSLANQYNIDSDQARRVLETT
FT                   MQMYEQWQTQQPKLAHPQLEALLKWAAMLHEVGLNINHSGLHRHSAYILQNSDLPGFNQ
FT                   EQQLMMATLVRYHRKAVKLDDLPRFTLFKKKQFLPLIQLLRLGVLLNNQRQATTTPPTL
FT                   RLKTDDNHWTLRFPHDWFSQNALVLLDLEKEQQYWEAVTGWRLKIEEESSPTIAA"
FT   gene            complement(280508..282574)
FT                   /locus_tag="CKO_00287"
FT   CDS_pept        complement(280508..282574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2501 0. ppk; polyphosphate kinase,
FT                   component of RNA degradosome K00937; COG: COG0855
FT                   Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11450"
FT                   /db_xref="GOA:A8AD87"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD87"
FT                   /inference="protein motif:HMMPfam:IPR003414"
FT                   /protein_id="ABV11450.1"
FT                   /translation="MGQEKLYIEKELSWLAFNERVLQEAADKSNPLIERMRFLGIYSNN
FT                   LDEFYKVRFAELKRRIIISEEQGSNSHSRHLLGKIQSRVLKADQEFDSLYNELLLEMAR
FT                   NQIFLINERQLSANQQSWLRHYFKHYLRQHITPILINRETDLVQFLKDDYTYLAVEIIR
FT                   GDAIRYALLEIPSDKVPRFVNLPPEAPRRRKPMILLDNILRYCLDDIFKGFFDYDALNA
FT                   YSMKMTRDAEYDLVHEMESSLMELMSSSLKQRLTAEPVRFVYQRDMPNALVEVLREKLT
FT                   ISRYDSIVPGGRYHNFKDFISFPNVGKANLVNKPLPRLRHLWFDKEKFRNGFDAIRERD
FT                   VLLYYPYHTFEHVLELLRQASFDPSVLAIKINIYRVAKDSRIIDSMIHAAHNGKKVTVV
FT                   VELQARFDEEANIHWAKRLTEAGVHVIFSAPGLKIHAKLFLISRKEGDEVVRYAHIGTG
FT                   NFNEKTARLYTDYSLLTADARITNEVRRVFNFIENPYRPVTFDYLLVSPQNSRRLLYEM
FT                   IDKEIANAQQGLPSGITLKLNNLVDKGLVDRLYAASSSGVPVNLLVRGMCSLIPNLEGI
FT                   SDNIRVISIVDRYLEHDRVYIFTNGGDKQVYLSSADWMTRNIDYRIEVAAPLLDPCLKQ
FT                   RVLDIIDILFSDTVKARYIDKELSNRYVPRGNRRKVQSQLAIYDYIKSLEQPD"
FT   gene            complement(282574..282741)
FT                   /locus_tag="CKO_00288"
FT   CDS_pept        complement(282574..282741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11451"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD88"
FT                   /protein_id="ABV11451.1"
FT                   /translation="MARQRFIRPTPQEFPSSLCLSDGLLSYFSGTVGHLSAMLAIIIRQ
FT                   CPVNKTECEL"
FT   gene            complement(282795..283433)
FT                   /locus_tag="CKO_00289"
FT   CDS_pept        complement(282795..283433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2500 1.3e-99 purN;
FT                   phosphoribosylglycinamide formyltransferase K00601; COG:
FT                   COG0299 Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11452"
FT                   /db_xref="GOA:A8AD89"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD89"
FT                   /inference="protein motif:Gene3D:IPR002376"
FT                   /inference="protein motif:HMMPfam:IPR002376"
FT                   /inference="protein motif:HMMPIR:IPR004607"
FT                   /inference="protein motif:HMMTigr:IPR004607"
FT                   /inference="protein motif:ScanRegExp:IPR001555"
FT                   /inference="protein motif:superfamily:IPR002376"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177704.1"
FT                   /protein_id="ABV11452.1"
FT                   /translation="MMNLVVLISGNGSNLQAIIDACKEKRIKGTLRAVFSNKADAFGLE
FT                   RAREAGIPAHALTADQFASREAFDRELMREIDAYAPDLVVLAGYMRILSPAFVAHYEGR
FT                   LLNIHPSLLPKYPGLHTHRQALENGDEEHGTSVHFVTDELDGGPVILQAKIPVFEGDSE
FT                   DEITARVQTQEHAIYPLVISWFVDGRLEMRDNAAWLDGNRLPPQGYAAE"
FT   gene            complement(283430..284245)
FT                   /locus_tag="CKO_00291"
FT   CDS_pept        complement(283430..284245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sbo:SBO_2520 8.2e-137 purM;
FT                   phosphoribosylaminoimidazole synthetase K01933; COG:
FT                   COG0150 Phosphoribosylaminoimidazole (AIR) synthetase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11454"
FT                   /db_xref="GOA:A8AD90"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD90"
FT                   /inference="protein motif:HMMPfam:IPR000728"
FT                   /inference="protein motif:HMMPfam:IPR010918"
FT                   /inference="protein motif:HMMTigr:IPR004733"
FT                   /inference="similar to AA sequence:INSD:AAG10596.1"
FT                   /protein_id="ABV11454.1"
FT                   /translation="MDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTA
FT                   ASVINGIAEGCLQSGCALVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVADG
FT                   DVLIALGSSGPHSNGYSLVRKIVEVSGCDPENTELEGKPLADHLLAPTRIYVKSILELI
FT                   EKVDVHAIAHLTGGGFWENIPRVLPDNTQAVIDESSWQWPAVFNWLQTAGNVSQHEMYR
FT                   TFNCGVGMVIALPEAEVDNALALLKAKGENAWKIGIIKASDSEQRVVIQ"
FT   gene            284228..284773
FT                   /locus_tag="CKO_00290"
FT   CDS_pept        284228..284773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00290"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11453"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD91"
FT                   /protein_id="ABV11453.1"
FT                   /translation="MAFQIHRQTQFCPYAVSAGNQYRLTIFLRQCAQRAEATQTTHDFR
FT                   AASFLHYAFDSINQSITSVNINTGIFIAKRGFVGHCLGPHALLAVKIKFGAILTGKANV
FT                   CEPALHPFLSAEFFSVLPLCTHLFELLHENETGFIAVLETCASYAQYRTETGFCFASGC
FT                   QRSGVNIAITMRETYVWI"
FT   gene            284760..286190
FT                   /locus_tag="CKO_00292"
FT   CDS_pept        284760..286190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_1595 1.2e-220
FT                   6-phospho-beta-glucosidase K01223; COG: COG2723
FT                   Beta-glucosidase/6-phospho-beta-glucosidase/beta-
FT                   galactosidase; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11455"
FT                   /db_xref="GOA:A8AD92"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD92"
FT                   /inference="protein motif:Gene3D:IPR013781"
FT                   /inference="protein motif:HMMPanther:IPR001360"
FT                   /inference="protein motif:HMMPfam:IPR001360"
FT                   /inference="protein motif:ScanRegExp:IPR001360"
FT                   /inference="similar to AA sequence:INSD:ABR78232.1"
FT                   /protein_id="ABV11455.1"
FT                   /translation="MSGFKANFMWGGAVAAHQLEGGWQEGGKGISVADVMTAGAHGVPR
FT                   EITDGVIAGKNYPNHEAIDFYHRYKDDIKLFAEMGFKCFRTSIAWTRIFPQGDELQPNE
FT                   AGLQFYDALFDECLKYGIEPVITLSHFEMPYHLVTEYGGWRNRKLIDFFVRFAKVVFTR
FT                   YQHKVKYWMTFNEINNQANYHEDFAPFTNSGLKYLPGEDREPVMYQAAHYELVASALAV
FT                   KAAREINPALQVGCMIAMCPIYPLTCAPDDMMMAMNAMHRRYWFTDVHVRGKYPQHILN
FT                   YFARRGFALDITDEDRAALLQGCVDYIGFSYYMSFATKATADNPQLDYDETKSLVSNPY
FT                   VQKSDWGWQIDPVGLRYSLNWFWDHYQLPLFIVENGFGAIDIQQADGSVDDRYRIDYLA
FT                   AHIREMKKAVVEDGVDLMGYTPWGCIDLVSAGTGEMKKRYGFIYVDKNNDGSGTLARHP
FT                   KKSFAWYQNVIKNNGENI"
FT   gene            286374..287000
FT                   /locus_tag="CKO_00293"
FT   CDS_pept        286374..287000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2495 2.6e-101 upp; uracil
FT                   phosphoribosyltransferase K00761; COG: COG0035 Uracil
FT                   phosphoribosyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11456"
FT                   /db_xref="GOA:A8AD93"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD93"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005765"
FT                   /inference="similar to AA sequence:INSD:ABR78231.1"
FT                   /protein_id="ABV11456.1"
FT                   /translation="MKIVEVKHPLVKHKLGLMRENDISTKRFRELASEVGSLLTYEATA
FT                   DLETETVTIDGWNGPVEIEQIKGKKITVVPILRAGLGMMEGVLEHVPSARISVVGIYRN
FT                   EETLEPVPYFQKLVSNIDERMALVVDPMLATGGSMIATIDLLKNAGCHSIKVLVLVAAP
FT                   EGIAALEKAHPDVELYTASIDKGLNEHGYIIPGLGDAGDKIFGTK"
FT   gene            287088..288377
FT                   /locus_tag="CKO_00294"
FT   CDS_pept        287088..288377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK0244 2.2e-07 guanine-hypoxanthine
FT                   permease; xanthine/uracil permease family protein K06901;
FT                   COG: COG2233 Xanthine/uracil permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11457"
FT                   /db_xref="GOA:A8AD94"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD94"
FT                   /inference="protein motif:HMMPfam:IPR006043"
FT                   /inference="protein motif:HMMTigr:IPR006042"
FT                   /inference="protein motif:ScanRegExp:IPR006042"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABV11457.1"
FT                   /translation="MTRRAIGVSERPPLLQTIPLSLQHLFAMFGATVLVPVLFHINPAT
FT                   VLLFNGIGTLLYLFICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLV
FT                   SFIVKKAGTGWLDVMFPPAAMGAIVAVIGLELAGVAAGMAGLLPAEGQSPDTKTITISL
FT                   VTLAVTVFGSVLFRGFLAIIPILIGVLAGYALSFAMGVVDTAPIAEAHWFALPTFYTPR
FT                   FEWFAILTILPAALVVIAEHVGHLVVTANIVKKDLVRDPGLHRSMFANGLSTMISGFFG
FT                   STPNTTYGENIGVMAITRVYSTWVIGGAAIFAILLSCVGKLAAAIQIIPLPVMGGVSLL
FT                   LYGVIGASGIRVLIESKVDYNKAQNLILTSVILIIGVSGAKVHIGAAELKGMALATIVG
FT                   IGLSLIFKLISVLRPEEVVLDAKDADTPQQ"
FT   gene            288450..289175
FT                   /locus_tag="CKO_00295"
FT   CDS_pept        288450..289175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0009 1.3e-14 chromosomal
FT                   replication initiator protein DnaA K00972; COG: COG0593
FT                   ATPase involved in DNA replication initiation; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11458"
FT                   /db_xref="GOA:A8AD95"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR022864"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8AD95"
FT                   /inference="protein motif:FPrintScan:IPR001957"
FT                   /inference="protein motif:HMMPfam:IPR013317"
FT                   /inference="similar to AA sequence:INSD:AAL21390.1"
FT                   /protein_id="ABV11458.1"
FT                   /translation="MESWIEVSLNTPAQLSLPLYLPDDETFASFWPGDNASLLAALQNV
FT                   LRQEHSGYIYLWSREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHL
FT                   SLVCIDNIECVAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLKLGLPDLASRLD
FT                   WGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFITLDQLDHA
FT                   SITAQRKLTIPFVKEILTL"
FT   gene            complement(289211..290533)
FT                   /locus_tag="CKO_00296"
FT   CDS_pept        complement(289211..290533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00296"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_0989 6.7e-71 peptidase M17, leucyl
FT                   aminopeptidase-like K01255; COG: COG0260 Leucyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11459"
FT                   /db_xref="GOA:A8AD96"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD96"
FT                   /inference="protein motif:HMMPfam:IPR000819"
FT                   /inference="protein motif:HMMPIR:IPR011356"
FT                   /inference="protein motif:ScanRegExp:IPR000819"
FT                   /inference="similar to AA sequence:INSD:ABP61647.1"
FT                   /protein_id="ABV11459.1"
FT                   /translation="MHVLAQDKVADTRFGCAPFTRITLLPDALWQDSLTEGLLNAIRPL
FT                   LASPVSENVLIDVTEINDTVLALLLRFLFNQAYTLNDLQLKKTDATATRIRHITAFCQP
FT                   EQYEKREKMFRQQQAIANGMVAARRLADTPSDCCTPQFVVNEAQTLCASFPALHCEVLD
FT                   EQQIVEQGLGLLHAVGKGATCPPRLLAIHYNGISDGPVRCYIGKGITFDTGGLWLKEGA
FT                   GMYTMKYDMCGAANVLGLLLTVAELKLPVRIMGVLALAENAIGPNAMQPGSVARACNGM
FT                   TVEINNTDAEGRLVLADAIAWTSQRQPQARYIIDMATLTGAVVKALGYELSGLMTQDDA
FT                   LRQALTEAGRQSGDEVWSLPLDARLKKQTESAIADLCNTPTNNAAISASAAWLLHHFCP
FT                   SDIPWAHLDISGTALWRENGRSVASGRPIPLLVEHLLEDIA"
FT   gene            complement(290638..291597)
FT                   /locus_tag="CKO_00297"
FT   CDS_pept        complement(290638..291597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00297"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsa:LSA1693 1.0e-81 asnA2; L-asparaginase
FT                   K01424; COG: COG1446 Asparaginase; Psort location:
FT                   Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11460"
FT                   /db_xref="GOA:A8AD97"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD97"
FT                   /inference="protein motif:HMMPanther:IPR000246"
FT                   /inference="protein motif:HMMPfam:IPR000246"
FT                   /inference="protein motif:ScanRegExp:IPR001872"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:INSD:ABP61646.1"
FT                   /protein_id="ABV11460.1"
FT                   /translation="MWGIIATWRMALEGVAESASALAAGNPVAMAVVDAVATVEDFPFY
FT                   KSVGYGGLPTENGEVELDAAYMDGDTLAFGAVGNLVDIANPVRVAHALSRQRYNCLLVG
FT                   QGAREWALSQGFADKTMLTDRAIQHYQKRCRETLDKGLSPYNGHDTVGIIGLDKLGSMS
FT                   VATSTSGLFMKKRGRIGDSPVIGSGFYCDSEVGAATATGVGEDLMKGCASYEIVRRMAQ
FT                   GMTPQQAADSVVFELEDKLMSRFGRTGDLSVVCMNRKGEFGAATNIKTFSFVVATARQP
FT                   LTVFRAERQHEKTHYHPVDEEWMQDYAARIRAPVEEEK"
FT   gene            complement(291601..292173)
FT                   /locus_tag="CKO_00298"
FT   CDS_pept        complement(291601..292173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bli:BL03842 1.3e-44 licC; phosphotransferase
FT                   system (PTS) lichenan-specific enzyme IIC component K02761;
FT                   COG: COG1455 Phosphotransferase system cellobiose-specific
FT                   component IIC; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11461"
FT                   /db_xref="GOA:A8AD98"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD98"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177696.1"
FT                   /protein_id="ABV11461.1"
FT                   /translation="MVNGIIRPLWMENQTDNIAAIQAGTTPPHIITEQFFDMIWMGGAG
FT                   ATLSLVLAMLFFARSKNMREVARLGAGASVFNINEPILFGLPVIMNPIMLIPFNLVPLV
FT                   LVTIQYTAMKLGAVAVTTGVFIPWTLPPVISGFIVTGHISGSVMQLINLLIGAMLYLPF
FT                   MRIVDKQYRAAERAAVTQPDAPLAKQE"
FT   gene            complement(292198..292920)
FT                   /locus_tag="CKO_00299"
FT   CDS_pept        complement(292198..292920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_5325 6.6e-48 celB; PTS system,
FT                   cellobiose-specific IIC component K02761; COG: COG1455
FT                   Phosphotransferase system cellobiose-specific component
FT                   IIC; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11462"
FT                   /db_xref="GOA:A8AD99"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="UniProtKB/TrEMBL:A8AD99"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177696.1"
FT                   /protein_id="ABV11462.1"
FT                   /translation="MNNVLGFLEAKLMPLAAKTAQQRHLGAIRGAYVSFMPFIIVGSIL
FT                   LVISSFPNQNYQQFMSQAFGESWGAIIEIPFNAVFSTMSLFISFLVAFRLAEHYGEDRI
FT                   SCGILALVCFLILTPFIKVAESGGITVIPVEWIGTKGLFVAMIGSLLWTELFCWLKRKN
FT                   LVIKMPEGVPPAVQESFAALIPALLVMILVLSIRILFENTHYQTIHQFIYEVVATPIRH
FT                   YGTSYFGALMTVFSITIL"
FT   gene            293080..293925
FT                   /locus_tag="CKO_00300"
FT   CDS_pept        293080..293925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_1293 6.1e-13 integrase, catalytic
FT                   region K00986; COG: COG2801 Transposase and inactivated
FT                   derivatives; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11463"
FT                   /db_xref="GOA:A8ADA0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA0"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:INSD:ABP61644.1"
FT                   /protein_id="ABV11463.1"
FT                   /translation="MEIKLHANATTTPRIRRYLQQSEKSDRELAAELGISVTTVRRWRH
FT                   RDRVSDGQTTPKTIYKAMRQEQVILVNALRDATGAPLDDLLLLVNEVLGIVVSRATLNR
FT                   YLKPATPQRQRASLQGKKALKSGMLPNHLALYHLPLSLHMDDGGEHHLFWAREPMSGWC
FT                   FARLYAGISPQRVVVWLDELLETCPADIQSIETNISDRICPQLKTHLATRGMSCQITGT
FT                   IPGWVPVTIPLNEIVPRLNSESASELLIRLCECYNRGKTQKKLGDCTPQDFLEALRRMD
FT                   "
FT   gene            complement(293922..294281)
FT                   /locus_tag="CKO_00301"
FT   CDS_pept        complement(293922..294281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAa1133 2.2e-33 arsenate reductase; COG:
FT                   COG1393 Arsenate reductase and related proteins,
FT                   glutaredoxin family; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11464"
FT                   /db_xref="GOA:A8ADA1"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA1"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR006660"
FT                   /inference="protein motif:HMMTigr:IPR006659"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAV76385.1"
FT                   /protein_id="ABV11464.1"
FT                   /translation="MSDAVKIYHNPRCSKSRDTLSLLKSNGVEPEVVLYLETPADAATL
FT                   RELLRMLGMSSARELMRQKEDLYKSLNLADSHLSEEALIQAMVENPKLMERPIVVANGQ
FT                   ARIGRPPEQVLEIVS"
FT   gene            complement(294354..295988)
FT                   /locus_tag="CKO_00302"
FT   CDS_pept        complement(294354..295988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2810 1.3e-241 yfgC; hypothetical
FT                   protein YfgC precursor; COG: COG4783 Putative Zn-dependent
FT                   protease, contains TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11465"
FT                   /db_xref="GOA:A8ADA2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR030873"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA2"
FT                   /inference="protein motif:Gene3D:IPR011990"
FT                   /inference="protein motif:HMMPfam:IPR001915"
FT                   /inference="similar to AA sequence:INSD:AAZ89204.1"
FT                   /protein_id="ABV11465.1"
FT                   /translation="MSQKRLRFLLLIQETEKSFERGIHHRVSQLHSLCWRGGTIRRGIG
FT                   QMAILKKTGQRSMFRLLKKNLVATLIAALTIGQVAPAFADSADTLPDMGTSAGSTLSIG
FT                   QEMQMGDYYVRQLRGSAPLINDPLLSQYINALGMRLVSHADSVKTPFHFFLINNDEINA
FT                   FAFFGGNVVLHSALFRYSDNESQLASVMAHEISHVTQRHLARAMEDQKRSAPLTWVGAL
FT                   GSILLAMASPQAGMAALTGTLAGTRQGMISFTQQNEQEADRIGIQVLQRSGFDPQAMPT
FT                   FLEKLLDQARYSTRPPEILLTHPLPESRLADARNRANQMRPVVVESSEDFYLAKARTLG
FT                   MYNSGRNQLTSDLLDAWEKGNVRQQRAAQYGRALQAMEASKYDEARKALQPLLTAEPNN
FT                   AWYLDLATDIDLGQKKTSEAINRLKNARDLRANPVLQLNLANAYLQGGQAREATTILNR
FT                   YTFNNKDDGNGWDLLAQAEAALNNRDQELAARAEGYALAGRLDQAISMLSSASSQVKLG
FT                   SQQQARYDARIDQLRQLQERFKPYTKM"
FT   gene            296043..297104
FT                   /locus_tag="CKO_00303"
FT   CDS_pept        296043..297104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2668 4.2e-28
FT                   phosphoribosylaminoimidazole-succinocarboxamide (SAICAR)
FT                   synthetase K01923; COG: COG0628 Predicted permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11466"
FT                   /db_xref="GOA:A8ADA3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA3"
FT                   /inference="protein motif:HMMPfam:IPR002549"
FT                   /inference="similar to AA sequence:INSD:AAL21387.1"
FT                   /protein_id="ABV11466.1"
FT                   /translation="MLEMLMQWYRRRFSDPEAIALLVILVAGFGILFFFSGLLAPLLVA
FT                   IVLAYLLEWPTVRLEAIGCSRRWATSIVLIVFVGILLLMAFVVMPVAWQQGIYLIRDMP
FT                   GMLNKLSDYAATLPRRYPALMDAGIIDAMAENMRTRMLTLGDSVVKYSLASLVGLLTLA
FT                   VYLVLVPLMVFFLIKDKEQMLNAVRRVLPRNRGLAGQVWMEMNQQITNYIRGKVLEMVV
FT                   VGVATWLGFLLFGLNYSLLLAVLVGFSVLIPYIGAFVVTIPVIGVALFQFGLGTEFWSC
FT                   FAVYLIIQALDGNLLVPVLFSEAVNLHPLVIILSVVIFGGLWGFWGVFFAIPLATLIKA
FT                   VVHAWPDGQVSDG"
FT   gene            297190..297939
FT                   /locus_tag="CKO_00304"
FT   CDS_pept        297190..297939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00304"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3314 Uncharacterized protein conserved in
FT                   bacteria; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11467"
FT                   /db_xref="GOA:A8ADA4"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA4"
FT                   /inference="protein motif:HMMPfam:IPR011642"
FT                   /inference="similar to AA sequence:INSD:ABG72602.1"
FT                   /protein_id="ABV11467.1"
FT                   /translation="MCCPALLFCFQLTGIDGFLISQGQDQPEKKMGHQMHTQQKVGWGG
FT                   YLAFFITIILFSGMFAKSTEWWRVFDFTVLNGAFGLVNAAGDTAVSFRGTGGTGARDGF
FT                   LFALELAPSVILSLGIISVTEGLGGLRAAQQLMTPILRPILGIPGICSLALIANLQNTD
FT                   AAAGMTKELAEEGVITEQERAIFACWQTSGSAILTNYFSSGAALFATITVPVITPLAVI
FT                   LVFKFIGANLLRVWIAQLEHRRMKQEA"
FT   gene            297941..298402
FT                   /locus_tag="CKO_00305"
FT   CDS_pept        297941..298402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00305"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0700 Uncharacterized membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11468"
FT                   /db_xref="GOA:A8ADA5"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA5"
FT                   /inference="protein motif:HMMPfam:IPR011642"
FT                   /inference="protein motif:HMMPIR:IPR011377"
FT                   /inference="similar to AA sequence:INSD:EAY45876.1"
FT                   /protein_id="ABV11468.1"
FT                   /translation="MSTQIRKNVMDLFIDGARRGFTIATTSLLPNVVMAFVIIQALKVT
FT                   GLLDIVGRVCEPVMALWGLPGESATVLLAAVMSMGGGVGVCASLVVTGALSGHDATVLL
FT                   PAIYLMGNPVQNVGRCLGTAGVHPRYYPHIIAVCVINALVSIWVMQAIV"
FT   gene            298414..299577
FT                   /locus_tag="CKO_00306"
FT   CDS_pept        298414..299577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00306"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c5408 6.6e-135 iadA; isoaspartyl
FT                   dipeptidase K01305; COG: NOG06797 non supervised
FT                   orthologous group; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11469"
FT                   /db_xref="GOA:A8ADA6"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA6"
FT                   /inference="protein motif:HMMPfam:IPR013108"
FT                   /inference="protein motif:HMMTigr:IPR010229"
FT                   /inference="protein motif:superfamily:IPR011059"
FT                   /inference="similar to AA sequence:INSD:AAN83830.1"
FT                   /protein_id="ABV11469.1"
FT                   /translation="MDCSILNLTLFQRGHVYAPDDLGQQDILVANGKIVAIAPTIAAKD
FT                   FPGCQQVDLHGDIVCPGFIDQHVHLIGGGGEAGPHTRTPEVRLSRLVEAGITSVVGLLG
FT                   TDGITRHPESLLAKTRALEYEGISAWMLTGAYSLPSPTITGSVDRDVALIDKVIGVKCA
FT                   VSDHRSSAPNSAALATMAAQSRVGGLLGQKPGISVFHMGDSPHMLEPLYDILTNADVPI
FT                   TKLLPTHVNRAEPLFQAALEYALDGGYIDITSSIDEPIDPATAIVTALRHKVPLSRITL
FT                   SSDGNGSQPEFDEHGNLTGIGVAGFESLIGTLRQLVTQHKLPLEQALRPLTRTVAEFLG
FT                   FEHKGRLAAGCDADILVLNQALEVSYLWAKGKAVVKDGKACVKGTFE"
FT   gene            complement(299693..300163)
FT                   /locus_tag="CKO_00307"
FT   CDS_pept        complement(299693..300163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW2465 1.5e-82 bcp; thiol peroxidase,
FT                   thioredoxin-dependent K03564; COG: COG1225 Peroxiredoxin;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11470"
FT                   /db_xref="GOA:A8ADA7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA7"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR013740"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:EAY47138.1"
FT                   /protein_id="ABV11470.1"
FT                   /translation="MNPLKAGDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPG
FT                   CTVQACGLRDNMDDLKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFG
FT                   VWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDDFKTSNHHDVVLNWLKENA"
FT   gene            complement(300163..300609)
FT                   /locus_tag="CKO_00308"
FT   CDS_pept        complement(300163..300609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2806 3.8e-68 gcvR; glycine cleavage
FT                   system transcriptional repressor K03567; COG: COG2716
FT                   Glycine cleavage system regulatory protein; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11471"
FT                   /db_xref="GOA:A8ADA8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA8"
FT                   /inference="protein motif:HMMPfam:IPR002912"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737953.1"
FT                   /protein_id="ABV11471.1"
FT                   /translation="MLGDEFTFIMLLSGSWNAITLIESTLPLKGAELDLLIVMKRTTAR
FT                   PRPAMPATVWVQVEVEDSPHLIERFTALFDSHQMNIAELVSRTQPAENEKAAQLFVQIT
FT                   AHSPASHDAVNIEHAFKALCTELNAQGSINVVNYSQHDEQDGVK"
FT   gene            300881..301759
FT                   /locus_tag="CKO_00309"
FT   CDS_pept        300881..301759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00309"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2484 1.2e-144 dapA; dihydrodipicolinate
FT                   synthase K01714; COG: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11472"
FT                   /db_xref="GOA:A8ADA9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADA9"
FT                   /inference="protein motif:BlastProDom:IPR002220"
FT                   /inference="protein motif:FPrintScan:IPR002220"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPfam:IPR002220"
FT                   /inference="protein motif:HMMPIR:IPR002220"
FT                   /inference="protein motif:HMMTigr:IPR005263"
FT                   /inference="protein motif:ScanRegExp:IPR002220"
FT                   /inference="similar to AA sequence:INSD:AAX66390.1"
FT                   /protein_id="ABV11472.1"
FT                   /translation="MFTGSIVALVTPMDEKGNVCRSSLKKLIDYHVASGTSAIVSVGTT
FT                   GESATLSHDEHGDVVMMTLELADGRIPVIAGTGANATAEAISLTQRFNDSGVVGCLTVT
FT                   PYYNRPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVGRLAKVKNIVAIKEA
FT                   TGNLSRVHQIKELVSDDFILLSGDDATGLDFIQLGGHGVISVTANVAARDMAEMCKLAA
FT                   EGRFADARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDTGREI
FT                   VKAALKHAGLL"
FT   gene            301776..302810
FT                   /locus_tag="CKO_00310"
FT   CDS_pept        301776..302810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00310"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3317 Uncharacterized lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11473"
FT                   /db_xref="GOA:A8ADB0"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR014524"
FT                   /db_xref="InterPro:IPR042268"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADB0"
FT                   /inference="protein motif:HMMPfam:IPR010653"
FT                   /inference="protein motif:ScanRegExp:IPR001360"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461423.1"
FT                   /protein_id="ABV11473.1"
FT                   /translation="MAYSVQKSRLARVAGVSLIMLLAACSSDSRYKRQVSGDESYLEAA
FT                   PLAELHAPAGMILPVTTGDYNIPVTNGSGAVGKALDIRPPAQPLALVTGARTQFTGDTA
FT                   TLLVENGRNTNLWPQVVSVIQSKNYTIEKRDDASQTLTTDWVEWNRLDEDQQYRGRYQI
FT                   SVKPQGYQQAVTVKLVNLEQAGKPAADAASLQRYSAEMMNVISAGLDKTATDAANAAQN
FT                   RSAATMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGSLAVTYK
FT                   PLSDSGWQDLGATDPGLSSGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQA
FT                   AFSK"
FT   gene            303000..303713
FT                   /locus_tag="CKO_00311"
FT   CDS_pept        303000..303713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW2461 7.2e-122 purC;
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthetase
FT                   K01923; COG: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11474"
FT                   /db_xref="GOA:A8ADB1"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADB1"
FT                   /inference="protein motif:BlastProDom:IPR001636"
FT                   /inference="protein motif:Gene3D:IPR013816"
FT                   /inference="protein motif:HMMPanther:IPR001636"
FT                   /inference="protein motif:HMMPfam:IPR001636"
FT                   /inference="protein motif:HMMTigr:IPR001636"
FT                   /inference="protein motif:ScanRegExp:IPR001636"
FT                   /inference="similar to AA sequence:REFSEQ:NP_289029.1"
FT                   /protein_id="ABV11474.1"
FT                   /translation="MQKQAELYRGKAKTVYSTENPDLLVLEFRNDTSAGDGARIEQFDR
FT                   KGMVNNKFNHFIMTKLAEAGIPTQMEQLLSDTECLVKKLDMVPVECVVRNRAAGSLVKR
FT                   LGIEEGIELNPPLFDLFLKNDAMHDPMVNDSYCETFGWVSKENLARMKELTYKANDVLK
FT                   KLFDDAGLILVDFKLEFGLYKGEVVLGDEFSPDGSRLWDKETLDKMDKDRFRQSLGGLI
FT                   EAYETVARRLGVQLD"
FT   gene            303913..304707
FT                   /locus_tag="CKO_00312"
FT   CDS_pept        303913..304707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2802 3.5e-136 ypfJ; hypothetical
FT                   protein; COG: COG2321 Predicted metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11475"
FT                   /db_xref="GOA:A8ADB2"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADB2"
FT                   /inference="protein motif:HMMPfam:IPR007343"
FT                   /inference="protein motif:ScanRegExp:IPR006025"
FT                   /inference="similar to AA sequence:REFSEQ:YP_408870.1"
FT                   /protein_id="ABV11475.1"
FT                   /translation="MGGPGFRLPSGKGGIILLIVVLVAGYYGVDLTGLMTGQPISQQET
FT                   TRSISPNDDEAAKFTSVILATTEDTWGQQFEKMGRTYQQPKLVMYRGATRTGCGAGQSV
FT                   MGPFYCPADGTVYIDLSFYDDMKNKLGADGDFAQGYVIAHEVGHHVQKLLGIEPKVRQL
FT                   QQTASQAEVNRLSVRMELQADCFAGVWGHNMQQQGVLESGDLEEALNAAQAIGDDRLQQ
FT                   QSQGRVVPDSFTHGTSEQRYTWFKRGFDSGDPAQCNTFGKGF"
FT   gene            304723..306738
FT                   /locus_tag="CKO_00313"
FT   CDS_pept        304723..306738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00313"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1444 Predicted P-loop ATPase fused to an
FT                   acetyltransferase; Psort location: CytoplasmicMembrane,
FT                   score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11476"
FT                   /db_xref="GOA:A8ADB3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033442"
FT                   /db_xref="InterPro:IPR038321"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADB3"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="protein motif:HMMPfam:IPR007807"
FT                   /inference="protein motif:ScanRegExp:IPR000585"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149708.1"
FT                   /protein_id="ABV11476.1"
FT                   /translation="MSDNDALRALTAQMAQEGIRRLLVLSGDVSWCRERALALREALAG
FT                   DWLWVATDAPAAPHCTPQALQTLLGREFRHAVFDAQLGFDASAFAALSGTLRAGSWLVL
FT                   LTPPYSAWESRPDADSLRWSDCPQPVATPHFIQHLKRVMARDEQTLHWQQSQPFSWPRF
FT                   PARPHWQPATGEPQPEQAAILRHLLRMPPGVAAVTAARGRGKSALAGQLISRMSGTAIV
FT                   TAPSKAATDVLAQFAGEKFRFLAPDALLAGTETADWLIVDEAAAIPAPLLHRLASRFSR
FT                   ILLTTTVQGYEGTGRGFLLKFCARFPHLRRFELRQPVRWAQGCPLEQWVGEALIFDDET
FT                   FAHAPQGAIRFSAFTQALWHTGPAQPLAVYQLLSGAHYRTSPLDLRRMMDAPGQHFLGA
FT                   FTAERVAGAAWLVEEGRLSAALSQAVWAGYRRPRGNLVAQSLAAHGGDPLAATLTGRRV
FT                   SRIAVHPARQREGIGQQLIAEAYGGASRCDYLSVSFGYTAELWRFWQRCGFVLVRMGNH
FT                   KEASSGCYTAMALLPISEAGARLAHREHQRLRRDAEILARWNGEAIPVIPLKASTLNDD
FT                   DWDELAGFAFAHRPLLTSLGSLSRLLERCELALPALRGRLEEKCSDANLCIRLGLPGRK
FT                   ALLVAQRREVAHALTALDDERAQRLRERVLQWQFFH"
FT   gene            306812..307510
FT                   /locus_tag="CKO_00314"
FT   CDS_pept        306812..307510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2800 1.3e-108 ypfH; hypothetical
FT                   protein YpfH; COG: COG0400 Predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11477"
FT                   /db_xref="GOA:A8ADB4"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADB4"
FT                   /inference="protein motif:HMMPfam:IPR003140"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737947.1"
FT                   /protein_id="ABV11477.1"
FT                   /translation="MKHDHFVVQSPDKPAKQLLLLFHGVGDNPVSMGEIGSWFAPLFPE
FT                   ALVVSIGGAEPCGPAPGRQWFSVQDVTEENRQARVDAIMPVFIETVRYWQKQSGVGPEA
FT                   TALIGFSQGAIMSLESIKAEPGLASRVIAFNGRYASLPEIATTATTVHLIHGGEDRVIE
FT                   LSHAVAAQEALVRAGGDVTLDIVEDLGHAIDDRSMQFALDHLRYTVPKHYFDEALSGGK
FT                   PNDDDIIEMI"
FT   gene            complement(307615..307815)
FT                   /locus_tag="CKO_00315"
FT   CDS_pept        complement(307615..307815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00315"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13899 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11478"
FT                   /db_xref="GOA:A8ADB5"
FT                   /db_xref="InterPro:IPR020910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADB5"
FT                   /inference="similar to AA sequence:INSD:AAN81450.1"
FT                   /protein_id="ABV11478.1"
FT                   /translation="MDWLAKYWWILVLVFLVGVLINVIKDLKRVDHKKFLANKPELPPH
FT                   RDFNDKWDDDDDWPKKDQPKK"
FT   gene            complement(307843..308970)
FT                   /locus_tag="CKO_00316"
FT   CDS_pept        complement(307843..308970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00316"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0386 3.3e-197 dapE;
FT                   succinyl-diaminopimelate desuccinylase K01439; COG: COG0624
FT                   Acetylornithine deacetylase/Succinyl-diaminopimelate
FT                   desuccinylase and related deacylases; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11479"
FT                   /db_xref="GOA:A8ADB6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADB6"
FT                   /inference="protein motif:HMMPfam:IPR002933"
FT                   /inference="protein motif:HMMPfam:IPR011650"
FT                   /inference="protein motif:HMMTigr:IPR005941"
FT                   /inference="protein motif:ScanRegExp:IPR001261"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461418.1"
FT                   /protein_id="ABV11479.1"
FT                   /translation="MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRAIGFTVEHMDF
FT                   GDTQNFWAWRGQGETLAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSL
FT                   AAMVVAAERFVAQHPDHQGRLAFLITSDEEASAKNGTVKVVETLMARNERLDYCLVGEP
FT                   SSTEIVGDVVKNGRRGSLTCNLTIHGVQGHVAYPHLADNPVHRAAPMLNELVAIEWDQG
FT                   NEFFPATSMQIANIQAGTGSNNVIPGELFIQFNFRFSTELTDETLKERVHALLDKHQLR
FT                   YTVDWWLSGQPFLTARGKLVDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVEL
FT                   GPVNATIHKINECVNAADLQLLARMYQRIMEQLVA"
FT   gene            complement(308974..309330)
FT                   /locus_tag="CKO_00317"
FT   CDS_pept        complement(308974..309330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2797 5.6e-51 yffB; conserved
FT                   thioredoxin-like protein; COG: COG1393 Arsenate reductase
FT                   and related proteins, glutaredoxin family"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11480"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADB7"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR006660"
FT                   /inference="protein motif:HMMTigr:IPR006504"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:CAD02682.1"
FT                   /protein_id="ABV11480.1"
FT                   /translation="MITVYGIKNCDTIKKARRWLEAHGIDYRFHDYRADGIDAALLNTF
FT                   IAESGWQPLLNTRGTTWRKLDEATRNGITDAASAAALMTEMPAIIKRPLLCATGKPMLL
FT                   GFSESSYQQFFDEV"
FT   gene            complement(309648..309851)
FT                   /locus_tag="CKO_00318"
FT   CDS_pept        complement(309648..309851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11481"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADB8"
FT                   /protein_id="ABV11481.1"
FT                   /translation="MSRLFLILFRIRISSRNLFAKHNFDKIFPVPQFTFNHNNLSYYYG
FT                   YSTKTLSSREDNLTDCSDYILR"
FT   gene            complement(309874..312987)
FT                   /locus_tag="CKO_00319"
FT   CDS_pept        complement(309874..312987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2351 2.5e-112 yegO; hypothetical
FT                   protein YegO K07789; COG: COG0841 Cation/multidrug efflux
FT                   pump; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11482"
FT                   /db_xref="GOA:A8ADB9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADB9"
FT                   /inference="protein motif:HMMPfam:IPR001036"
FT                   /inference="protein motif:HMMTigr:IPR004764"
FT                   /protein_id="ABV11482.1"
FT                   /translation="MANFFIDRPIFAWVLAILLCLTGTLAILSLPVEQYPDLAPPNVRI
FT                   TANYPGASAQTLENTVTQVIEQNMTGLDNLMYMSSQSSGTGQATVTLSFVAGTDPDEAV
FT                   QQVQNQLQSAMRKLPQAVQNQGVTVRKTGDTNILTIAFVSTDGSMDKQDIADYVASNIQ
FT                   DPLSRVNGVGDIDAYGSQYSMRIWLDPAKLNSYQMTAKDVTDAIESQNAQIAVGQLGGT
FT                   PSVDRQALNATINAQSLLQTPEQFRDITLRVNQDGSEVKLGDVATVEMGAEKYDYLSRF
FT                   NGNPASGLGVKLASGANEMETAKLVLNRLDELAEYFPHGLEYKVAYETTSFVKASIIDV
FT                   VKTLLEAIALVFLVMYLFLQNFRATLIPTIAVPVVLMGTFSVLYAFDYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERIMSEEGLSPREATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGTTGAIYRQFSITIVAAMVLSVLVAMILTPALCATLLKPLHKGEHHGQKGFFGWFNR
FT                   TFNRNAERYEKGVAKILHRSLRWILIYVLLLGAMVVLFLRLPTSFLPQEDRGMFITSVQ
FT                   LPSGSTQQQTLKVVQEVEKYYFTQEKDNVMSVFSTVGSGPGGNGQNVARMFVRLKDWDE
FT                   RNATTGTSFAIIERATKAFNKIKEARVYASSPPAISGLGSSAGFDMELQDHAGAGHDAL
FT                   MAARDRLIELAAQDSALTRVRHNGLDDSPQLQIDIDQRKAQALGVSIDDINDTLQTAWG
FT                   SSYVNDFMDRGRVKKVYVQAAAKYRMLPDDINLWYVRNKDGGMVPFSAFATSRWETGSP
FT                   RLERYNGYSAVEIVGEAAPGVSTGTAMDVMESLVRQLPTGFGLEWTAMSYQERLSGAQA
FT                   PALYAISLLVVFLCLAALYESWSVPFSVMLVVPLGVIGALLATWMRGLENDVYFQVGLL
FT                   TVIGLSAKNAILIVEFANEMNEKGHDLLDATLHACRQRLRPILMTSLAFIFGVLPMAIS
FT                   NGAGSGSQHAVGTGVMGGMISATILAIYFVPLFFVLVRRRFPLKPKPE"
FT   gene            complement(312987..313118)
FT                   /locus_tag="CKO_00320"
FT   CDS_pept        complement(312987..313118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11483"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC0"
FT                   /protein_id="ABV11483.1"
FT                   /translation="MYAVNVHDNLHYLLFFSTFDTYLAATVKQVIPNNYTQKHEVLL"
FT   gene            complement(313173..314873)
FT                   /locus_tag="CKO_00321"
FT   CDS_pept        complement(313173..314873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0379 4.2e-268 narQ; nitrate/nitrite
FT                   sensor protein K07674; COG: COG3850 Signal transduction
FT                   histidine kinase, nitrate/nitrite-specific; Psort location:
FT                   CytoplasmicMembrane, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11484"
FT                   /db_xref="GOA:A8ADC1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC1"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR011712"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003660"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:INSD:AAO68097.1"
FT                   /protein_id="ABV11484.1"
FT                   /translation="MVVKRPVSASLARAFFYIVLLSILSTGIALLTLASSLRDAEAINV
FT                   AGSLRMQSYRLGYDLQSGSSQLNAHRQLFQQALNSPALSNLNAWYVPQTVKSRYGQLHA
FT                   NWLEMNTRLVDADIKWYRANINNYVDQIDLFVLALQHYAERKVMLVVGISLAGGIGIFT
FT                   LVFFTLRRIRQQVVQPLNQLVAASQHIEHGQFDIPPLNTHLPNELGLLAKTFSQMSSEL
FT                   HKLYRSLEASVEEKTHDLHEANRRLEVLYQCSQALNTSQIDVHCFRHILQIVREHDAAY
FT                   YLELTVGDNWRISEGAESADLPMQILPVTMQETVYGELHWQSPNVSASTPLLHSVSTML
FT                   GRGLYFNQAQKHFQQLLLMEERATIARELHDSLAQVLSYLRIQLTLLKRSIPEDNLPAQ
FT                   SIMADFSRALNDAYRQLRELLTTFRLTLQQADLPSALHEMLDTLQSQTSAKLTLDCRLP
FT                   TLALDAQMQVHLLQIVREAVLNAIKHASATEIAVSCVTAPDGNHTVYIRDNGVGIGEPN
FT                   EPTGHYGLNIMRERAERLSGTLNFSQPSGGGTLVSISFRSSEDEEGQLA"
FT   gene            complement(314780..315016)
FT                   /locus_tag="CKO_00322"
FT   CDS_pept        complement(314780..315016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11485"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC2"
FT                   /protein_id="ABV11485.1"
FT                   /translation="MFICPGRTTIYPEPVADQFISSLVKLRFSYTCQYLFVHCEHIFRG
FT                   LRAWSSNALSRPAWPGPFFTLCCCRFSQPVSPC"
FT   gene            complement(314898..315047)
FT                   /locus_tag="CKO_00323"
FT   CDS_pept        complement(314898..315047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11486"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC3"
FT                   /protein_id="ABV11486.1"
FT                   /translation="MLLTDAEGVGNVHLPRTHNYLSRTCGRSIYFIAGEIAFQLHLPIF
FT                   IRSL"
FT   gene            complement(315038..315601)
FT                   /locus_tag="CKO_00324"
FT   CDS_pept        complement(315038..315601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11487"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC4"
FT                   /protein_id="ABV11487.1"
FT                   /translation="MPGLIFLTRGAQTPRFRQPGQRRLRYQLQRICRAVFNTGRAVFAI
FT                   QTQITFVRRGFDLILTCWRKDYLHCAEGTGNHAGFTADTFLLVDLNAVFDMTDCAIWAT
FT                   PGARRILAVVAGYRAALMLMFDHRNSGLKMPLVQYVLLIIVGHYASDLTGMASQALLAI
FT                   GHNKTIHGVLLFWWQKPYSLYECY"
FT   gene            315650..317065
FT                   /locus_tag="CKO_00325"
FT   CDS_pept        315650..317065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2794 1.1e-226 aegA, yffG; putative
FT                   oxidoreductase Fe-S subunit K00264; COG: COG0493
FT                   NADPH-dependent glutamate synthase beta chain and related
FT                   oxidoreductases; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11488"
FT                   /db_xref="GOA:A8ADC5"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC5"
FT                   /inference="protein motif:BlastProDom:IPR001327"
FT                   /inference="protein motif:HMMPfam:IPR001327"
FT                   /inference="protein motif:HMMPfam:IPR013027"
FT                   /inference="protein motif:HMMTigr:IPR006006"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:INSD:AAL21373.1"
FT                   /protein_id="ABV11488.1"
FT                   /translation="MRATPPRGEPDKLAIDARKTSFDEIYLPFRTAQAEREAARCLKCG
FT                   EHSICEWTCPLHNHIPQWIELVKAGNIDDAVALSHQTNCLPEITGRVCPQDRLCEGACT
FT                   VRDEYGAVTIGNIERYISDRALDKGWRPDLSGVQQQDKRVAIIGAGPAGLACADVLARH
FT                   GVSTTVFDRHPEIGGLLTFGIPSFKLDKSLLARRREIFSAMGIHFELNCEVGKDVRLAS
FT                   LLDEYDAVFVGVGTYRSMKADLPNEDAPGVYDALPFLIANTKQVMGLDELPDEPFIDTA
FT                   GLNVVVLGGGDTAMDCVRTALRHGASQVTCAYRRDEANMPGSKKEVKNAREEGANFEFN
FT                   VQPVELVLNADGCVSGVRFLRTQLGEPDAQGRRRPMPIAGSEFVMPADAVIMAFGFHPH
FT                   GMPWLEAHGVKVDDWGRIAANVESAFRYQTSNPKIFAGGDAVRGADLVVTAMAEGRHAA
FT                   QGIIQWLGIMQTG"
FT   gene            317157..317732
FT                   /locus_tag="CKO_00326"
FT   CDS_pept        317157..317732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2793 8.3e-89 yffH; hypothetical
FT                   protein YffH K01515; COG: COG0494 NTP pyrophosphohydrolases
FT                   including oxidative damage repair enzymes; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11489"
FT                   /db_xref="GOA:A8ADC6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADC6"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:HMMTigr:IPR004385"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:INSD:BAB36752.1"
FT                   /protein_id="ABV11489.1"
FT                   /translation="MSQKITLIKDKVLSDNYFILRNITYDLTRKNGDVIRHKREVYDRG
FT                   NGATILLYNREKQTVVLIRQFRVATWVNGNESGQLIETCAGLLDNDEPEACIRKEAIEE
FT                   TGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDSQRANAGGGVEDEDIEVLELPLTQA
FT                   LAMIKTGEIRDGKTVLLLNYLHSSSLIY"
FT   gene            317859..318902
FT                   /locus_tag="CKO_00327"
FT   CDS_pept        317859..318902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00327"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG10065 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11490"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC7"
FT                   /inference="protein motif:HMMPfam:IPR009560"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00700477.1"
FT                   /protein_id="ABV11490.1"
FT                   /translation="MRNRVIFVFLLGLLPTSLTWAAPAQQTFSDWQVTCNNQNFCVARN
FT                   TGEHRGLVMTLSRSAGAHTDAVLRIDLGGLTSPGAKEAEIAPRLLLDGKPLPLNAGQWR
FT                   ITPWHLMTDDTATIAAFLQTIQEAQAITLKKGKQTISLVGLKAALLFIDAQQKRVGSET
FT                   AWIDKGNDPPLSVPPAPALKGVAIVNPTPTPLSYDERNDLLDYGNWRMNGIHCSLDPMR
FT                   REVRVAALTDDKALLMTGCEAGAYNTVDLAWIVSRKKPFASRAVRLRLPFNSGAESNDM
FT                   ELMNAVFDEKSRELITLAKGRGLADCGIQTRWRFDGQRFRLVRYAEEPSCDNWHGPDAW
FT                   PTLWITR"
FT   gene            318912..319073
FT                   /locus_tag="CKO_00328"
FT   CDS_pept        318912..319073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00328"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11491"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC8"
FT                   /protein_id="ABV11491.1"
FT                   /translation="MALTLTGPTVHFVGRIRRIASPSGFRPTHPFLRFKHLMRFFDDIL
FT                   DRKAEIRE"
FT   gene            complement(319005..320999)
FT                   /locus_tag="CKO_00329"
FT   CDS_pept        complement(319005..320999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2474 0. tktB; transketolase K00615;
FT                   COG: COG0021 Transketolase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11492"
FT                   /db_xref="GOA:A8ADC9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADC9"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPanther:IPR005478"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR005478"
FT                   /inference="protein motif:HMMTigr:IPR005478"
FT                   /inference="protein motif:ScanRegExp:IPR005474"
FT                   /inference="protein motif:ScanRegExp:IPR005475"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /protein_id="ABV11492.1"
FT                   /translation="MSRKDLANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFLR
FT                   HNPTDPTWYDRDRFILSNGHASMLLYSLLHLTGYDLPIEELKNFRQLHSKTPGHPEIGY
FT                   TPGVETTTGPLGQGLANAVGLAIAERTLAAQFNQPDHDIVDHYTYVFMGDGCLMEGISH
FT                   EVCSLAGTLGLGKLIGFYDHNGISIDGETEGWFTDDTAKRFEAYHWHVVHEIDGHDPEA
FT                   VKKAILEAQSVKDKPSLIICRTVIGFGSPNKAGKEESHGAALGEEEVALTRQKLGWHHP
FT                   AFEIPKEIYRAWDAREKGEKAQQAWQEKFAAYQKAYPDLARAFTRRMRGELPESWETTT
FT                   RKYIAELQANPAKIATRKASQNTLNAYGPILPELLGGSADLAPSNLTIWKGSTSLKEDP
FT                   AGNYIHYGVREFGMTAIANGIAHHGGFVPYTATFLMFVEYARNAARMAALMKARQIMVY
FT                   THDSIGLGEDGPTHQAVEQLASLRLTPNFSTWRPCDQVEAAVGWKLAVERHTGPTALIL
FT                   SRQNLAQVERTPEQVKEIARGGYVLKDSGGKPDVILIATGSEMEITLLAAEKLTGEGHN
FT                   VRVVSLPSTDIFDAQDEAYRESVLPSNVAARVAIEAGIADYWYKYVGLKGAIVGMTGYG
FT                   ESAPAEKLFPYFGFTVENIVEKAHKVLKA"
FT   gene            complement(321020..321970)
FT                   /locus_tag="CKO_00330"
FT   CDS_pept        complement(321020..321970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2710 1.6e-154 talA; transaldolase A
FT                   K00616; COG: COG0176 Transaldolase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11493"
FT                   /db_xref="GOA:A8ADD0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD0"
FT                   /inference="protein motif:Gene3D:IPR013785"
FT                   /inference="protein motif:HMMPanther:IPR001585"
FT                   /inference="protein motif:HMMPfam:IPR001585"
FT                   /inference="protein motif:HMMTigr:IPR004730"
FT                   /inference="protein motif:ScanRegExp:IPR001585"
FT                   /inference="similar to AA sequence:INSD:CAD07703.1"
FT                   /protein_id="ABV11493.1"
FT                   /translation="MNQLDGIKQFTTVVADSGDIESIRHYQPQDATTNPSLLLKAAGLA
FT                   QYSHLIDDAIAWGKKRGKTQEQQVAEASDKLAVNFGAEILKIVPGRVSTEVDARLSFDK
FT                   EKSMQKARHLVDLYQQQGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFAQA
FT                   RACAEAGVFLVSPFVGRIYDWYQAHSPMDPYVVEEDPGVKSVRNIYDYFKRHRYETIVM
FT                   GASFRRTEQILALTGCDRLTISPNLLKALQEKEETVIRKLVPSSQTFHRPTPMTEAEFR
FT                   WEHNQDAMAVEKLSEGIRLFAVDQRKLEDLLAAKL"
FT   gene            complement(322016..322216)
FT                   /locus_tag="CKO_00331"
FT   CDS_pept        complement(322016..322216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00331"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11494"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD1"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217455.1"
FT                   /protein_id="ABV11494.1"
FT                   /translation="MARVTSGAPHIITSLRGINFEGSHTLTTQRKNLLSIYSIHVTRLN
FT                   PHYHACLLCFFVVYCMNFSEV"
FT   gene            322249..324528
FT                   /locus_tag="CKO_00332"
FT   CDS_pept        322249..324528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2709 0. maeB; NADP-dependent malate
FT                   dehydrogenase (decarboxylating) K00029; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11495"
FT                   /db_xref="GOA:A8ADD2"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD2"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR012301"
FT                   /inference="protein motif:HMMPfam:IPR012302"
FT                   /inference="protein motif:HMMPIR:IPR012188"
FT                   /inference="protein motif:ScanRegExp:IPR001891"
FT                   /protein_id="ABV11495.1"
FT                   /translation="MDDQLKQSALDFHEFPVPGKIQVSPTKPLATQRDLALAYSPGVAA
FT                   PCLEIEKDPLAAYKYTARGNLVAVVSNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGI
FT                   DVFDIEVDEHNPDKFIDVVAALEPTFGGINLEDIKAPECFYIEQKLRERMNIPVFHDDQ
FT                   HGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGMQKHNIVVCDSK
FT                   GVIYKDREPNMVETKAAYAVVDDGKRTLDDVIDGADIFLGCSGPKVLTQEMVKKMARAP
FT                   MILALANPEPEILPPLAKEVRSDAIICTGRSDYPNQVNNVLCFPFIFRGALDVGATAIN
FT                   EEMKLAAVHAIAELAHAEQSEVVASAYGDQDLSFGPEYIIPKPFDPRLIVKIAPAVAKA
FT                   AMDSGVATRPIADFDAYIDKLTEFVYKTNLFMKPIFSLARKAPKRVVLAEGEEARVLHA
FT                   TQELITLGLAKPILIGRPSVIEMRIQKLGLQIKSGVDFEIVNNESDPRFKEYWGEYYKI
FT                   MKRRGVTQEQAQRAVISNTTVIGAIMVLRGEADAMICGTIGEYHEHFSVVQELFGYREG
FT                   VHAAGAMNALLLPSGNTFIADTYVNDDPTPEQLAEITLMAAETVRRFGIEPKVALLSHS
FT                   NFGSSKSVAACKMRQTLELVRERAPELMIDGEMHGDAALVESIRNDRMPDSPLKGAANI
FT                   LIMPNVEAARISYNLLRVSSSEGVTVGPVLMGVAKPVHVLTPIASVRRIVNMVALAVVE
FT                   AQTQPL"
FT   gene            324688..325023
FT                   /locus_tag="CKO_00333"
FT   CDS_pept        324688..325023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lwe:lwe0363 0.0046 PTS system;
FT                   fructose-specific IIB component K00890; COG: COG4810
FT                   Ethanolamine utilization protein; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11496"
FT                   /db_xref="GOA:A8ADD3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD3"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009307"
FT                   /inference="similar to AA sequence:INSD:AAV76409.1"
FT                   /protein_id="ABV11496.1"
FT                   /translation="MDKERIIQEFVPGKQVTLAHLIAHPGEELAKKIGVPEAGAIGIMT
FT                   LTPGETAMIAGDLAMKAADVHIGFLDRFSGALVIYGSVGAVEEALLQTVSGLGRLLNFT
FT                   LCELTKS"
FT   gene            325037..325516
FT                   /locus_tag="CKO_00334"
FT   CDS_pept        325037..325516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2785 5.8e-72 eutP; ethanolamine
FT                   utilization protein EutP K04029; COG: COG4917 Ethanolamine
FT                   utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11497"
FT                   /db_xref="GOA:A8ADD4"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD4"
FT                   /inference="protein motif:HMMPIR:IPR012381"
FT                   /inference="protein motif:HMMTigr:IPR012381"
FT                   /inference="similar to AA sequence:INSD:AAL21363.1"
FT                   /protein_id="ABV11497.1"
FT                   /translation="MKRIAFVGTVGAGKTTLFNALQGNYSLARKTQAVEFNDNGDIDTP
FT                   GEYFSHPRWYHALITTLQDVDTLIYVHAANDRESRLPAGLLDIGASKRHIAVISKTDMP
FT                   DADVAAARQLLSGLGFQEPIFELNSHDPQSVQHLVDYLAALTEQEEGAGEETHHS"
FT   gene            325494..326183
FT                   /locus_tag="CKO_00335"
FT   CDS_pept        325494..326183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00335"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4766 Ethanolamine utilization protein; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11498"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD5"
FT                   /inference="protein motif:HMMPfam:IPR010424"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /inference="similar to AA sequence:INSD:ABR78204.1"
FT                   /protein_id="ABV11498.1"
FT                   /translation="MKKLITANDIRAAHARGEQEMSVVLRASIITPEAREVAELLDFTI
FT                   VECDESAPAVAPVEDAKTESQRIRETIIAQLPEGQFTESLVAQLMDKVMKEKQSLEQAD
FT                   MQPGFKSVTGKGGVKVIDGSSVKFGRFDGAQPHCVGLTDLVTDKDGSSMAAGFMQWDNA
FT                   FFPWTLNYDEIDMVLEGELHVRHEGETMIAKAGDVMFIPKGSSIEFGTPSTVRFLYVAW
FT                   PANWQSC"
FT   gene            326193..326996
FT                   /locus_tag="CKO_00336"
FT   CDS_pept        326193..326996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2467 2.8e-127 eutT; putative cobalamin
FT                   adenosyltransferase, ethanolamine utilization K04032; COG:
FT                   COG4812 Ethanolamine utilization cobalamin
FT                   adenosyltransferase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11499"
FT                   /db_xref="GOA:A8ADD6"
FT                   /db_xref="InterPro:IPR009194"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD6"
FT                   /inference="protein motif:HMMPfam:IPR002779"
FT                   /inference="protein motif:HMMPIR:IPR009194"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461402.1"
FT                   /protein_id="ABV11499.1"
FT                   /translation="MKDFITEAWLRANHTLSEGAEIHLPADARLTPSARELLESRHLRI
FT                   KFLDEQGRLFVDDDEQQLQPVHGLTSSDTHPKACCELCRQPVAKKPDTLTHLTADKMVA
FT                   KSDPRLGFRAALDSTIALVVWLQIELPEQWQPWLADIRSRLGNIMRADAMDEPLAAQAI
FT                   VGLNEDELHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETEVVAAQVFITRN
FT                   FDVLRPDLLQALNRLSSTVYVMMILCVTKHPLTVSQIQQRLGGEQ"
FT   gene            326993..328009
FT                   /locus_tag="CKO_00337"
FT   CDS_pept        326993..328009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2782 1.5e-153 eutD, ypfA, eutI;
FT                   ethanolamine utilization protein EutD acetyl/butyryl
FT                   phosphate transferase K04020; COG: COG0280
FT                   Phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11500"
FT                   /db_xref="GOA:A8ADD7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD7"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPIR:IPR012147"
FT                   /inference="protein motif:HMMTigr:IPR004614"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217449.1"
FT                   /protein_id="ABV11500.1"
FT                   /translation="MIIERCREQALRAPARVVFPDALDVRVLKAAHYLQRHGLARPVLV
FT                   TSPFALRQFALTHRIAMDGIQVIDPQSNLSMREVFAGRWLARAGEKTPPDALEKLNDPL
FT                   MFAAAMVSAGHADVCIAGNLSSTANVLRAGLRLIGLQPGCKTLSSIFLMLPQYTGQALG
FT                   FADCSVVPQPTAAQLADIAIASAQTWRTITGEEPRVAMLSFSSHGSARHPNVANVQQAT
FT                   EIVRERAPDLIVDGELQFDAAFVPDVAAQKAPASPLQGKANVMVFPSLEAGNIGYKIAQ
FT                   RLGGYRAVGPLIQGLAAPLHDLSRGCSVQEIIELALVAAVPRQTDVSREHDSQTLVV"
FT   gene            328049..328339
FT                   /locus_tag="CKO_00338"
FT   CDS_pept        328049..328339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00338"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11501"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD8"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:INSD:ABR78201.1"
FT                   /protein_id="ABV11501.1"
FT                   /translation="MEALGMIETRGLVALIEASDAMVKAARVKLVGVKQIGGGLVTAMV
FT                   RGDVAACKAATDAGAAAAQRIGELVSVHVIPRPHGDLEEVFPISFKGDSNI"
FT   gene            328472..328771
FT                   /locus_tag="CKO_00339"
FT   CDS_pept        328472..328771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00339"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4576 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11502"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADD9"
FT                   /inference="protein motif:BlastProDom:IPR004992"
FT                   /inference="protein motif:HMMPfam:IPR004992"
FT                   /inference="similar to AA sequence:INSD:AAL21358.1"
FT                   /protein_id="ABV11502.1"
FT                   /translation="MEAGMKLAVVTGQIVCTVRHEGLAHDKLLMVKMIDAEGNPDGQCA
FT                   VAIDSIGAGTGEWVLLVSGSSARQAHRSESSPVDLCVIGIVDEVVAGGKVVFHK"
FT   gene            328783..330186
FT                   /locus_tag="CKO_00340"
FT   CDS_pept        328783..330186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0914 9.8e-102 aldehyde dehydrogenase
FT                   K04021; COG: COG1012 NAD-dependent aldehyde dehydrogenases;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11503"
FT                   /db_xref="GOA:A8ADE0"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE0"
FT                   /inference="protein motif:HMMPfam:IPR002086"
FT                   /inference="protein motif:HMMPIR:IPR012408"
FT                   /inference="similar to AA sequence:INSD:AAL21357.1"
FT                   /protein_id="ABV11503.1"
FT                   /translation="MNQQDIEQVVKAVLLKMKDSSQPAAAVHEMGVFASLDDAVAAAKV
FT                   AQQGLKSVAMRQLAIHAIREAGEKHARELAELAVSETGMGRVEDKLAKNVAQARGTPGV
FT                   ECLSPQVLTGDNGLTLIENAPWGVVASVTPSTNPAATVINNAISLIAAGNSVVFAPHPA
FT                   AKKVSQRAITLLNQAVVAAGGPANLLVTVANPDIETAQRLFKYPGIGLLVVTGGEAVVE
FT                   AARKHTNKRLIAAGAGNPPVVVDETADLARAAQSIVKGASFDNNIICADEKVLIVVDSV
FT                   ADELMRLMEGQHAVKLTAAQAEQLQPVLLKNIDERGKGTVSRDWVGRDAAKIAAAIGLT
FT                   VPEQTRLLFVETPATHPFAVTELMMPVLPVVRVANVEEAIELAVTLEGGCHHTAAMHSR
FT                   NIDNMNRMANAIDTSIFVKNGPCIAGLGLGGEGWTTMTITTPTGEGVTSARTFVRLRRC
FT                   VLVDAFRIV"
FT   gene            330223..331062
FT                   /locus_tag="CKO_00341"
FT   CDS_pept        330223..331062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00341"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4820 Ethanolamine utilization protein,
FT                   possible chaperonin; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11504"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE1"
FT                   /inference="protein motif:HMMTigr:IPR013366"
FT                   /inference="similar to AA sequence:INSD:CAD07693.1"
FT                   /protein_id="ABV11504.1"
FT                   /translation="MAHDEQRWLTPRLQKAAELCNQHPVASDSPLWLGIDLGTCDVVSM
FT                   VVDRDAQPVAVCLDWADVVRDGIVWDFFGAVTIVRRHLDTLERQLGCQFTHAATSFPPG
FT                   TDPRISINVLESAGLEVSHVLDEPTAVADLLRLDNAGVVDIGGGTTGIAIVKQGKVTYS
FT                   ADEATGGHHISLTLAGNRRIELEDAEQFKRSNAREIWPVVKPVYEKMAEIVARHIEGQG
FT                   IADLWLAGGSCMQPGVDELFRKRFPELRVHLPEHSLFMTPLAIANSGKEKAEGIYAK"
FT   gene            331052..332239
FT                   /locus_tag="CKO_00342"
FT   CDS_pept        331052..332239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2777 1.7e-182 eutG, yffV;
FT                   ethanolamine utilization protein EutG iron-containing
FT                   alcohol dehydrogenase K04022; COG: COG1454 Alcohol
FT                   dehydrogenase, class IV; Psort location: Cytoplasmic,
FT                   score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11505"
FT                   /db_xref="GOA:A8ADE2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE2"
FT                   /inference="protein motif:HMMPfam:IPR001670"
FT                   /inference="protein motif:ScanRegExp:IPR001670"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217444.1"
FT                   /protein_id="ABV11505.1"
FT                   /translation="MQSELQTALFQAFDTLNLQRIKTFSVPPVTLCGLGALSACGQEAQ
FT                   TRGLTHLFVMVDSFLHQAGMTAGLERSLAMKGVAMSIWPCPVGEPSITDVCAAVAQLRE
FT                   SKCDGVVAFGGGSVLDAAKAVALLFTNPGQTLADMTAQSVLRPRLPLIAVPTTAGTGSE
FT                   TTNVTVIIDAVSGRKQVLAHASLMPDVAILDAALTEGVPSHVTAMTGIDALTHAVEAYS
FT                   ALNATPFTDSLAIGAIAMIGKSLPKAVGNGHDMAARENMLLASCMAGMAFSSAGLGLCH
FT                   AMAHQPGATLHIPHGQANSMLLPTVMGFNRMVCRERFSHIGRALLNKKADDRDAIGAVS
FT                   ELIIETGLTKRLADVGATSAHYSAWAQGALEDICIRSNPRTATQEQIIDLYAAAQ"
FT   gene            332363..333589
FT                   /locus_tag="CKO_00343"
FT   CDS_pept        332363..333589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1788 0.00081 fruA; PTS system,
FT                   fructose-specificIIBC component K02769:K02770; COG: COG3192
FT                   Ethanolamine utilization protein; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11506"
FT                   /db_xref="GOA:A8ADE3"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE3"
FT                   /inference="protein motif:HMMPfam:IPR007441"
FT                   /inference="similar to AA sequence:INSD:ABR78196.1"
FT                   /protein_id="ABV11506.1"
FT                   /translation="MGINEIIMYIMMFFMLIAAVDRILSQFGGSARFLGKFGKSIEGSG
FT                   GQFEEGFMAMGALGLAMVGMTALAPVLAKLLGPVIIPLYEMLGANPSMFAGTLLACDMG
FT                   GFFLAKELAGGDVAAWLYSGLILGAMMGPTIVFSIPVALGIIEPSDRRYLALGVLAGIV
FT                   TIPIGCIAGGLVAMYSGVEINGQPVEFTFALILMNMIPVIIVAVLVALGLKFIPEKMIS
FT                   GFQIFAKFLVALITIGLAAAVIKFLLGWELIPGLDPIFMSPGDQPGEVMRAIEVIGSIS
FT                   CVLLGAYPMVLLLTRWFEKPLMRVGGLLKINNMAAGGMVATLANNIPMFGMMKQMDTRG
FT                   KVINCAFAVSAAFALGDHLGFAAANMNAMIFPMIVGKLIGGVTAIGVAMMLVPKDEDVP
FT                   VETEVEAQS"
FT   gene            333586..334989
FT                   /locus_tag="CKO_00344"
FT   CDS_pept        333586..334989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00344"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4819 Ethanolamine utilization protein,
FT                   possible chaperonin protecting lyase from inhibition; Psort
FT                   location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11507"
FT                   /db_xref="GOA:A8ADE4"
FT                   /db_xref="InterPro:IPR009377"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE4"
FT                   /inference="protein motif:HMMPfam:IPR009377"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01700640.1"
FT                   /protein_id="ABV11507.1"
FT                   /translation="MNTRQLLSVGIDIGTTTTQVIFSRLELVNRAAVSQVPRYEFIKRE
FT                   ISWQSPVFFTPVDKQGGLKEAELKALILAQYQAAGIAPETVDSGAIIITGESAKTRNAR
FT                   PAVMALSQSLGDFVVASAGPHLESVIAGHGAGAQTLSEQRLCRVLNIDIGGGTSNYVLF
FT                   DAGKVSGSACLNVGGRLLETDGQGRVVHAHKPGQMIVEAVFGAGTDARSLNATQLAQVV
FT                   RRMADLIVEIIDGEPSPLAQALMQTGLLPAGVKPEVITLSGGVGECYRNQPADPFCFSD
FT                   VGPLLATALHEHPRLREMNVQFPTQTVRATVIGAGAHTLSLSGSTIWLEGVALPLRNLP
FT                   VAIPQDENELVAAWEQALTQLDLDPGTDAYVLALPARLPVRYAALLTVIDALLAFTARF
FT                   PNPHPLLVVAEQDFGKALGMLLRPQLQQHPLAVIDEVSVRAGDYIDIGTPLFGGSVVPV
FT                   TVKSLAFPS"
FT   gene            335001..336362
FT                   /locus_tag="CKO_00345"
FT   CDS_pept        335001..336362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0410 3.9e-240 eutB; ethanolamine
FT                   ammonia-lyase heavy chain K03735; COG: COG4303 Ethanolamine
FT                   ammonia-lyase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11508"
FT                   /db_xref="GOA:A8ADE5"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE5"
FT                   /inference="protein motif:HMMPfam:IPR010628"
FT                   /inference="similar to AA sequence:INSD:AAL21352.1"
FT                   /protein_id="ABV11508.1"
FT                   /translation="MKLKTTLFGNVYQFKDVKEVLAKANELRSGDVLAGVAAESSQERV
FT                   AAKQVLSEMSVADIRNNPVISYEEDCVTRLIQDDVNETAYNRIKNWSISELREYVLSDE
FT                   TSVDDIAFTRKGLTSEVVAAVAKICSNADLIYGGKKMPVIKKANTTIGIPGTFSCRLQP
FT                   NDTRDDVQSIAAQIYEGLSFGAGDAVIGVNPVTDDVENLSRVLDTVYGVIDKFNIPTQG
FT                   CVLAHVTTQIEAIRRGAPGGLIFQSICGSEKGLKEFGVELAMLDEARAVGAEFNRIAGE
FT                   NCLYFETGQGSALSAGANFGADQVTMEARNYGLARHYDPFLVNTVVGFIGPEYLYNDRQ
FT                   IIRAGLEDHFMGKLSGISMGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDD
FT                   IMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIMENGRLTKRAGDPSLFF"
FT   gene            336383..337288
FT                   /locus_tag="CKO_00346"
FT   CDS_pept        336383..337288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2457 1.0e-138 eutC; ethanolamine
FT                   ammonia-lyase, light chain K03736; COG: COG4302
FT                   Ethanolamine ammonia-lyase, small subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11509"
FT                   /db_xref="GOA:A8ADE6"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE6"
FT                   /inference="protein motif:HMMPfam:IPR009246"
FT                   /inference="similar to AA sequence:INSD:AAC78124.1"
FT                   /protein_id="ABV11509.1"
FT                   /translation="MDQKQIEEIVRSVMASMGESQPQAPAESAPACSAKQCAAPSAPSA
FT                   AESCALDLGSAEAKAWVGVENPHRADVLAELRRSTAARVCTGRAGPRPRTLALLRFLAD
FT                   HSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLSQEAIDALKAQCVA
FT                   SPDVQVVISDGLSTDAITANYEEILPPLLSGLKQAGLKVGTPFFVRYGRVKIEDQIGEI
FT                   LGAKVVILLVGERPGLGQSESLSCYAVYSPRVATTVEADRTCISNIHQGGTPPVEAAAV
FT                   IVDLAKRMLEQKASGINMTR"
FT   gene            337337..337957
FT                   /locus_tag="CKO_00347"
FT   CDS_pept        337337..337957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00347"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4816 Ethanolamine utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11510"
FT                   /db_xref="GOA:A8ADE7"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE7"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:HMMPIR:IPR009193"
FT                   /inference="similar to AA sequence:INSD:ABR78192.1"
FT                   /protein_id="ABV11510.1"
FT                   /translation="MRVIASVNDGFARELKLPSHIRSLGLITADSDDVTYIAADEATKQ
FT                   AMVEVVYGRSLYAGAAHGPSPTAGEVLIMLGGPNPAEVRAGLDAMVAHIEGGAAFQWAN
FT                   DAEDIAFLAHVVSRTGSYLSSTSGIALGDPIAYLVAPPLEATFGIDAAMKSADVQLVTY
FT                   VPPPSETNYSAAFLTGSQAACKAACNAFTDAVLDIARNPVQRA"
FT   gene            337969..338466
FT                   /locus_tag="CKO_00348"
FT   CDS_pept        337969..338466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00348"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4577 Carbon dioxide concentrating
FT                   mechanism/carboxysome shell protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11511"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR032298"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE8"
FT                   /inference="protein motif:BlastProDom:IPR000249"
FT                   /inference="protein motif:HMMPfam:IPR000249"
FT                   /inference="protein motif:ScanRegExp:IPR000249"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461390.1"
FT                   /protein_id="ABV11511.1"
FT                   /translation="MINALGLLEVDGMVAAVDAADAMLKAANVRLLSHEVLDPGRLTLV
FT                   VEGDLAACRAALDAGSAAAQRTGRVISRKEIGRPEDDTQWLIGGFKRQPTKVGKTPDAP
FT                   VTSESSEALLALLASVRQGMTAGEVAAHFGWSLERARNALEQLFSDGALRKRSSRYRLK
FT                   KV"
FT   gene            338511..339563
FT                   /locus_tag="CKO_00349"
FT   CDS_pept        338511..339563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00349"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2207 AraC-type DNA-binding domain-containing
FT                   proteins; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11512"
FT                   /db_xref="GOA:A8ADE9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADE9"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737917.1"
FT                   /protein_id="ABV11512.1"
FT                   /translation="MKKTRTANLHHLYHEALPEDVKLTPLVEVDNVHQRLTTDVYEHAL
FT                   TITAWQQIYDQLHPGKFHGEFTEILLDEIQVFREYTGLALRQSCLVWPNSFWFGIPATR
FT                   GEQGFIGTQCIGSAEIATRPGGTEFELSTPDDYTILGVVISEEVLTRQANFLHHPERVL
FT                   HMLRNQSALEVKEQHKAALWGFVQQALATFSENPENLHQHAVRKVLGDNLLLAMGTMLE
FT                   EAQPIITAESVSHQSYRKLLSRAREYVLENMSEPLTVLDLCNQLHVSRRTLQNAFHAIL
FT                   GIGPNAWLKRIRLNAVRRELISPWSQSSTVKEAAMQWGFWHLGQFATDYQQLFAEKPSL
FT                   TLHQRMRQWM"
FT   gene            complement(339683..340582)
FT                   /locus_tag="CKO_00350"
FT   CDS_pept        complement(339683..340582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0415 2.5e-158 hemF; coproporphyrinogen
FT                   III oxidase K00228; COG: COG0408 Coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11513"
FT                   /db_xref="GOA:A8ADF0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADF0"
FT                   /inference="protein motif:HMMPanther:IPR001260"
FT                   /inference="protein motif:HMMPfam:IPR001260"
FT                   /inference="protein motif:HMMPIR:IPR001260"
FT                   /inference="protein motif:ScanRegExp:IPR001260"
FT                   /inference="similar to AA sequence:INSD:AAV76426.1"
FT                   /protein_id="ABV11513.1"
FT                   /translation="MKPDAQRVKQFLLSLQDDICQQLAAVDGADFVEDSWQRDAGGGGR
FT                   SRVLRNGGVFEQAGVNFSHVHGDAMPASATAHRPELAGRSFEAMGVSLVVHPLNPYIPT
FT                   SHANVRFFIAEKPGAEPVWWFGGGFDLTPYYAFEEDAIHWHRTARDLCQPYGEDVYPRY
FT                   KKWCDDYFFLKHRDEQRGIGGLFFDDLNTPDFDSCFRFMQAVGKGYTDAFLPIVERRKA
FT                   MVWGERERHFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLVRWEYDWQPE
FT                   EGSPEAALSEFIKVRDWV"
FT   gene            complement(340585..341454)
FT                   /locus_tag="CKO_00351"
FT   CDS_pept        complement(340585..341454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2768 1.4e-141 amiA; probable
FT                   N-acetylmuramoyl-L-alanine amidase AmiA precursor K01448;
FT                   COG: COG0860 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11514"
FT                   /db_xref="GOA:A8ADF1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF1"
FT                   /inference="protein motif:HMMPfam:IPR002508"
FT                   /inference="protein motif:HMMSmart:IPR002508"
FT                   /inference="similar to AA sequence:REFSEQ:YP_541759.1"
FT                   /protein_id="ABV11514.1"
FT                   /translation="MSTFKPLKTLTSRRQVLKAGLAALTLSGMSHAIAKEEALKTGNGH
FT                   SKPKAKKAGARRIVVLDPGHGGIDTGAIGRNGSKEKHVVLEIAKNVRAILRNQGIDARL
FT                   TRTGDTFIPLYDRVEIAHKHGADLFMSIHADGFTNPSAAGASVFALSNRGASSAMAKYL
FT                   SDRENRADEVAGKKATDKDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPVHRLHSRN
FT                   TEQAAFVVLKSPSIPSVLVETSFITNPEEERLLGTTAFRQKIATAIANGVISYFHWFDN
FT                   QKAHSKKR"
FT   gene            341474..341611
FT                   /locus_tag="CKO_00352"
FT   CDS_pept        341474..341611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11515"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF2"
FT                   /protein_id="ABV11515.1"
FT                   /translation="MSSRCYIVSRNPLRLFVMRIVLLFISIRDNPSLCHFFRRFASDIG
FT                   "
FT   gene            341666..342091
FT                   /locus_tag="CKO_00353"
FT   CDS_pept        341666..342091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00353"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2767 5.2e-71 ypeA; hypothetical
FT                   protein YpeA K00680; COG: COG0456 Acetyltransferases; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11516"
FT                   /db_xref="GOA:A8ADF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="InterPro:IPR023072"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF3"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:SwissProt:P63423"
FT                   /protein_id="ABV11516.1"
FT                   /translation="MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKLNHDVSLF
FT                   LVAEVNGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQ
FT                   IMVREDNDIVLGMYERLGYEHSDALSLGKRLIEDEEY"
FT   gene            342078..342527
FT                   /locus_tag="CKO_00354"
FT   CDS_pept        342078..342527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00354"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08687 non supervised orthologous group;
FT                   Psort location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11517"
FT                   /db_xref="GOA:A8ADF4"
FT                   /db_xref="InterPro:IPR021318"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF4"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217434.1"
FT                   /protein_id="ABV11517.1"
FT                   /translation="MKSTEFHPADYDGHGRLRLPFLFWCVLLLQARTWVLFVIAGSSRE
FT                   QGDTLLNLFYPDHDTFWLGLLPGVPAVLAFLLSGRRDAFPVLWRGLRGLLILAQGVLLC
FT                   WQPVLWLYGEPVNGIGLALVVADIVALIWLLSNRRLRACFAPAKE"
FT   gene            342618..343163
FT                   /locus_tag="CKO_00355"
FT   CDS_pept        342618..343163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00355"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06776 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11518"
FT                   /db_xref="InterPro:IPR010938"
FT                   /db_xref="InterPro:IPR038714"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF5"
FT                   /inference="protein motif:HMMPfam:IPR010938"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00718335.1"
FT                   /protein_id="ABV11518.1"
FT                   /translation="MPLVLSGCSTLSSVNWSAANPWNWFGSSTEVTEQGVGALTASTPL
FT                   DEKAITDALDGDYRLRSGMKTQNGNVVRFFEAMKEDKVALVINGDQGTISRIDVLDSDI
FT                   PSQAGVEIGTPFSDLYSKAFGNCQKATGDDSASVECKAQDSQHISYLFSGEWNGPEGLM
FT                   PPDDTLKNWKVSKIIWRR"
FT   gene            343258..344157
FT                   /locus_tag="CKO_00356"
FT   CDS_pept        343258..344157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0946 1.5e-43 predicted iron-dependent
FT                   peroxidase K00430; COG: COG2837 Predicted iron-dependent
FT                   peroxidase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11519"
FT                   /db_xref="GOA:A8ADF6"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF6"
FT                   /inference="protein motif:HMMPfam:IPR006314"
FT                   /inference="protein motif:HMMTigr:IPR006314"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804281.1"
FT                   /protein_id="ABV11519.1"
FT                   /translation="MSQVQSGILPEHCRAAIWIEANVKGDVDALRAASKTFADKLATFE
FT                   AKFPDAHLGAVVAFGNNTWRALSGGVGAEELKDFIPYGKGLAPATQYDVLIHILSLRHD
FT                   VNFSVAQAAMAAFGECIEVQEEIHGFRWVEERDLSGFVDGTENPAGEEVRRDVAVIKDG
FT                   VDAGGSYVFVQRWEHNLTQLNRMSVHDQEMMIGRTKEANEEIDGDDRPVTSHLTRVDLK
FT                   EDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTK
FT                   PVTGGYYFAPSLDRLMAL"
FT   gene            complement(344254..345558)
FT                   /locus_tag="CKO_00357"
FT   CDS_pept        complement(344254..345558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB0667 4.4e-51 beta-lactamase K01467; COG:
FT                   COG1680 Beta-lactamase class C and other penicillin binding
FT                   proteins; Psort location: Periplasmic, score:9.76"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11520"
FT                   /db_xref="GOA:A8ADF7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF7"
FT                   /inference="protein motif:HMMPfam:IPR001466"
FT                   /inference="protein motif:superfamily:IPR012338"
FT                   /inference="similar to AA sequence:INSD:AAZ89149.1"
FT                   /protein_id="ABV11520.1"
FT                   /translation="MKMTLLFASLLALSCTASAAPFPVLTDAAPEKAGFNIERLNALDN
FT                   WIAQQVDAGYPSVNLLIIKDSHIVYRKAWGQAKKYDGSVLMSHPIKATTDTLYDLASNT
FT                   KMYATNFALQKLMSEGKLQPDDLISKYIPDFGDRPGDAIKGKSTLRIADLLHHSGGFPA
FT                   DPQYPNQAVAGELYSQDKATTLEMIKRTPLAYPPGTKHIYSDVDYMLLGFIVESVTGQP
FT                   LDRYVEENLYRPLGLTHTVFNPLQKGFRQQQIAATELNGNTRDGVIHFPNIRTTTLWGQ
FT                   VHDEKAFYSMGGVSGHAGLFSNTGDIAVLMQTMLNGGGYGNVTLFSPETVKMFTQSSPE
FT                   DATFGLGWRVNGNASMTPTFGTLASAQAYGHTGWTGTLTVIDPANQMAIVMLSNKPHSP
FT                   VADPQKNPNMFNSGLMPIATYGWVVDQIYAALKHE"
FT   gene            complement(345563..346993)
FT                   /locus_tag="CKO_00358"
FT   CDS_pept        complement(345563..346993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z3694 2.5e-222 putative PTS enzyme II
FT                   K02809:K02810; COG: COG1263 Phosphotransferase system IIC
FT                   components, glucose/maltose/N-acetylglucosamine-specific;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11521"
FT                   /db_xref="GOA:A8ADF8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF8"
FT                   /inference="protein motif:HMMPfam:IPR001996"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:ScanRegExp:IPR001996"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00925544.1"
FT                   /protein_id="ABV11521.1"
FT                   /translation="MAKEISNDLLNTIISRVGGPGNIATCGNCMTRLRLAVHDSDRVDP
FT                   AIKTLEGVKGVVLSNNQVQVIFGPGKAQRAADAMNALLSDNSGTVTQAADIAAKTKSQL
FT                   KAKQTSGIQQFLSKFATIFTPLIPGFIAAGLLLGIATLLGTVLHVPADAQGMLPDALNF
FT                   MKVFSKGLFTFLVILIGYNAAQAFGGTGVNGAIIASLFLLGYNPAATTGYFSGIEDFFG
FT                   LPIDPRGNIIGVLIAAWASARIEGFIRRFMPDDLDMLLTSMLTLLVTAALAYLIIMPLG
FT                   GWLFEGMSWLFIHLNSNPLGCAVLAGLFLVSVVFGVHQGFIPVYLALMSSQGFNSLFPI
FT                   LSMAGAGQVGAALALYWRAEKHSVLRSQVRGAIIPGLLGVGEPLIYGVTLPRMKPFITA
FT                   CLGGAAGGLFIGLVAWSGLPMGLNSAFGPSGLVALPLMTSAQGILPAMAVYAGGMLIAY
FT                   LGGFIFTALFGCRNVNLD"
FT   gene            complement(346999..347895)
FT                   /locus_tag="CKO_00359"
FT   CDS_pept        complement(346999..347895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tvo:TVN0956 1.8e-05 phosphoheptose isomerase
FT                   K03271; COG: COG2103 Predicted sugar phosphate isomerase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11522"
FT                   /db_xref="GOA:A8ADF9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADF9"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="protein motif:HMMTigr:IPR005488"
FT                   /inference="protein motif:ScanRegExp:IPR005486"
FT                   /inference="similar to AA sequence:REFSEQ:NP_311326.1"
FT                   /protein_id="ABV11522.1"
FT                   /translation="MQLENMITEGVNRASFEIDRASTLDMCRIINDEDKTVPLAVEQVL
FT                   PEIAAAIDIIYAQVSAGGRLIYTGAGTSGRLGILDASECPPTYGVESGLVIGLIAGGER
FT                   AIQHAIEGAEDNRELGVNDLKTLALNEKDVVVGIAASGRTPYVIAGLEYARTLGCRTVG
FT                   ISCNPGSAVAKAAELAITPVVGAEVVSGSSRMKAGTAQKLILNMLSTGLMIKSGKVFGN
FT                   LMVDVVATNEKLNVRQVNIVKNATGCTGQQAEAALMACGRHCKTAIVMLLKNLNATEAS
FT                   LRLEQHGGFIRQVLEEE"
FT   gene            complement(347909..348499)
FT                   /locus_tag="CKO_00361"
FT   CDS_pept        complement(347909..348499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG cbu:CBU_1296 0.0063 NAD+ kinase K00858"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11524"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG0"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01220839.1"
FT                   /protein_id="ABV11524.1"
FT                   /translation="MKKYFVSAAALLFCSQAFAAPHLFIGDNVSVLAARSAKVSIFSKD
FT                   VALPDGAQKMVVKFDSPANPESVNNNRGRVTSNPYIISFNASGNVDLQLSAGKPLDEKE
FT                   ASQMAQKPVFTLTAAGKPVPFDIKILDRDSITVFTDLSAIVNDDSTMIPSPARSASPAA
FT                   PATSHDQLSQLQQLYLKADDTQKKAFLKWALNL"
FT   gene            347996..348541
FT                   /locus_tag="CKO_00360"
FT   CDS_pept        347996..348541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00360"
FT                   /product="hypothetical protein"
FT                   /note="Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11523"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG1"
FT                   /protein_id="ABV11523.1"
FT                   /translation="MRSGGRRRGSGARRRRYHRAVIVDDGAQVGEHGDAVTVENFDIKR
FT                   YGFPGRRQGEYRFLRHLTGFFFVQRFSRRQLQIHIAGSVKRDDIRVRRHAAPVIVHRFR
FT                   ICWTVELHYHFLSAVWQRHVFTKNTDFCRTGRQHADVIANKEMRSGKSLAAKQQCCGGH
FT                   KIFLHFYSPGKGESEFVT"
FT   gene            complement(348524..349609)
FT                   /locus_tag="CKO_00362"
FT   CDS_pept        complement(348524..349609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00362"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3203 Outer membrane protein (porin); Psort
FT                   location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11525"
FT                   /db_xref="GOA:A8ADG2"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG2"
FT                   /inference="protein motif:HMMPfam:IPR001702"
FT                   /inference="similar to AA sequence:REFSEQ:YP_854940.1"
FT                   /protein_id="ABV11525.1"
FT                   /translation="MKRTLKSLAIFTLLATSASHAAVIYQANDGSNIDLYGRLGFNISD
FT                   KKSGDTSGDFDARIGFSARQAINDKLAVIGFTQYQVNAAEYANNISAENPNDFTARYVW
FT                   AGIDFAEYGKLTGGRVSSGLIMFTDIGDVFASSDVAMARQANFVDPTAVQVFRQDGTIQ
FT                   YQNTFGNFDFSTAYILGNNTSDLDYGYNAALRYTLDMGDFGRLQPVIAGQTEKASHDDT
FT                   STLSDNNVDKYTFYGIGTRYYLGDFMFGLLYAQDKVTYLDGSADSTDKDYEATLVWNVS
FT                   PDWALRTGYRHLKNEDGDGLKLRDTTFEAQYKLTVRSSIFASYSWRNGEEGKKRTNGND
FT                   VSFGGSNPADDYFHLGLRYEF"
FT   gene            349811..350674
FT                   /locus_tag="CKO_00363"
FT   CDS_pept        349811..350674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bma:BMA2132 1.8e-23
FT                   glucokinase/transcriptional regulator, RpiR family, fusion
FT                   K00845; COG: COG1737 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11526"
FT                   /db_xref="GOA:A8ADG3"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR022821"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADG3"
FT                   /inference="protein motif:HMMPfam:IPR000281"
FT                   /inference="protein motif:HMMPfam:IPR001347"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00728763.1"
FT                   /protein_id="ABV11526.1"
FT                   /translation="MLYLAKMRNAEGELTENEQKIASFLLAHVSELKTVSSRNLAKQLE
FT                   VSQSSIVKFAQKLGAKGFTELRMALIEEYSVNREKKHDTALHLHSTITSEDSLEVIARK
FT                   LNREKMFALEETCSLMDFDRLKQVINLISKARLIQITGVGGSALVGRDLSFKLMKIGYR
FT                   VACEVDTHVQATIAQALQEGDVQIAISYSGSKKEIVLCAEAARKQGATVIAITSLTDSP
FT                   LRRLADYTLDTVSGETEWRSSSMSTRTAQNSVTDLLFVGMVQLNDVESLRMIERSSELI
FT                   NLLGRS"
FT   gene            350852..351643
FT                   /locus_tag="CKO_00364"
FT   CDS_pept        350852..351643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2445 4.5e-129 ucpA; putative
FT                   oxidoreductase; COG: COG1028 Dehydrogenases with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenases); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11527"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG4"
FT                   /inference="protein motif:HMMPanther:IPR002347"
FT                   /inference="protein motif:HMMPfam:IPR002198"
FT                   /inference="similar to AA sequence:INSD:AAO68131.1"
FT                   /protein_id="ABV11527.1"
FT                   /translation="MGKLTGKTALITGASQGIGEGIARVFARHGANLILLDISDEAEKL
FT                   ADELGGRGHRCTAIKADVRDFASVAAAVARAKKIEGKIDILVNNAGVCRLGNFLDMSEE
FT                   DRDFHIDINIKGVWNVTKAVLPEMVERKDGRIVMMSSVTGDMVADPGETAYALSKAAII
FT                   GLTKSLAVEYAQSGVRVNAICPGYVRTPMAENIARQSNPDDPESVLTEMAKAIPMRRLA
FT                   CPLEVGELAAFLASDESSYLTGTQNVIDGGSTLPESVSVGV"
FT   gene            351801..352817
FT                   /locus_tag="CKO_00365"
FT   CDS_pept        351801..352817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00365"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4150 ABC-type sulfate transport system,
FT                   periplasmic component; Psort location: Periplasmic,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11528"
FT                   /db_xref="GOA:A8ADG5"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG5"
FT                   /inference="protein motif:HMMPfam:IPR006059"
FT                   /inference="protein motif:HMMTigr:IPR005669"
FT                   /inference="protein motif:ScanRegExp:IPR000957"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:NP_837989.1"
FT                   /protein_id="ABV11528.1"
FT                   /translation="MAVNLLKKRYLALSAMLLLVTQAQATELLNSSYDVSRELFAALNP
FT                   PFEQQWAKDNGGDKLTIKQSHAGSSKQALAILQGLKADVVTYNQVTDVQILHDKGKLIP
FT                   ADWQSRLPNNSSPFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPKTSGNARYTYL
FT                   AAWGAADKADGGDKAKTEQFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVN
FT                   NIRKQYEAQGFEVVIPKTNILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIIT
FT                   DFYYRVNNPEVMDKLKDKFPQTELFRVEDQFGSWPEVMKTHFGSGGELDKLLAAGRK"
FT   gene            352817..353650
FT                   /locus_tag="CKO_00366"
FT   CDS_pept        352817..353650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll0739 1.2e-28 modBC; ABC-type molybdate
FT                   transport system permease/ATP-binding protein K02018; COG:
FT                   COG0555 ABC-type sulfate transport system, permease
FT                   component; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11529"
FT                   /db_xref="GOA:A8ADG6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG6"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011865"
FT                   /inference="similar to AA sequence:REFSEQ:YP_670337.1"
FT                   /protein_id="ABV11529.1"
FT                   /translation="MFAVSTRRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLAQMSWA
FT                   QYWEVITNPQVVAAYKVTLLSAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPF
FT                   ALPTAVAGLTLASLFSVNGFYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVL
FT                   EELGPEYEEAAETLGATRLQSFRKVVLPELSPALVAGIALSFTRSLGEFGAVIFIAGNI
FT                   AWKTEVTSLMIFVRLQEFDYPAASAIASVILAASLLLLFSINTLQSRFGRRVVGH"
FT   gene            353650..354525
FT                   /locus_tag="CKO_00367"
FT   CDS_pept        353650..354525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA0505 1.1e-26 ABC transporter, putative
FT                   molybdenum transport system K02017:K02018; COG: COG4208
FT                   ABC-type sulfate transport system, permease component;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11530"
FT                   /db_xref="GOA:A8ADG7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG7"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR005667"
FT                   /inference="protein motif:HMMTigr:IPR011866"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149747.1"
FT                   /protein_id="ABV11530.1"
FT                   /translation="MAEVTQLKRYDAPRINWGKWFLIGTGMLVSAFILLVPMIYIFVQA
FT                   FSKGLMPVLQNLADPDMLHAIWLTVLIALIAVPVNLVFGVLLAWLVTRFNFPGRQLLLT
FT                   LLDIPFAVSPVVAGLVYLLFYGSNGPLGDWLDEHNLQIMFAWPGMVLVTIFVTCPFVVR
FT                   ELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVS
FT                   VVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEK
FT                   RAQQEENHEH"
FT   gene            354515..355612
FT                   /locus_tag="CKO_00368"
FT   CDS_pept        354515..355612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00368"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_2618 7.7e-189 cysA; ATP-binding
FT                   component of sulfate permease A protein K02045; COG:
FT                   COG1118 ABC-type sulfate/molybdate transport systems,
FT                   ATPase component; Psort location: Cytoplasmic, score:9.12"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11531"
FT                   /db_xref="GOA:A8ADG8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG8"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:HMMTigr:IPR005666"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="protein motif:superfamily:IPR008995"
FT                   /inference="similar to AA sequence:REFSEQ:YP_404164.1"
FT                   /protein_id="ABV11531.1"
FT                   /translation="MSIEIANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLL
FT                   RIIAGLEHQTSGHIRFHGTDVSRLHARDRKVGFVFQHYALFRHMTVFDNIAFGLTVLPR
FT                   RERPNAAAIKAKVTKLLEMVQLAHLAERFPAQLSGGQKQRVALARALAVEPQILLLDEP
FT                   FGALDAQVRKELRRWLRQLHEELKFTSVFVTHDQEEATEVADRVVVMSQGNIEQADAPD
FT                   QVWREPATRFVLEFMGEVNRLQGTIRGGQFHVGAHRWPLGYTPAYQGAVDLFLRPWEVD
FT                   VSRRTSLDSPLPVQVLEASPKGHYTQLVVQPLGWYNEPLTVVMQGDNPPQRGERLFVGL
FT                   QNARLYNGNQRIETREEELALAESA"
FT   gene            355668..356636
FT                   /locus_tag="CKO_00369"
FT   CDS_pept        355668..356636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2439 1.8e-155 cysM; cysteine synthase B
FT                   (O-acetylserine sulfhydrolase B) K01738; COG: COG0031
FT                   Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11532"
FT                   /db_xref="GOA:A8ADG9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADG9"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005858"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217426.1"
FT                   /protein_id="ABV11532.1"
FT                   /translation="MICVGPVSEAPPGFLLDREVNTLEQTIGNTPLVKLQRMAPDNGSE
FT                   IWVKLEGNNPAGSVKDRAALSMIVQAEKRGEIKPGDVLIEATSGNTGIALAMIAALKGY
FT                   RMKLLMPDNMSQERRAAMRAYGADLILVSKEQGMEGARDLALEMAERGEGKLLDQFNNP
FT                   DNPYAHYTTTGPEIWQQTSGRITHFVSSMGTTGTITGVSRFLREQEKPVTIVGLQPEEG
FT                   SSIPGIRRWPAEYMPGIFNAQLVDQVLDIHQSEAENTMRELAVREGIFCGVSSGGAVAG
FT                   ALRVARATPGAVVVAIICDRGDRYLSTGVFGEEHFSQGAGI"
FT   gene            complement(356727..357443)
FT                   /locus_tag="CKO_00370"
FT   CDS_pept        complement(356727..357443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_2237 2.9e-31 glutamine
FT                   amidotransferase class-I K01951; COG: COG0518 GMP synthase
FT                   - Glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11533"
FT                   /db_xref="GOA:A8ADH0"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH0"
FT                   /inference="protein motif:HMMPfam:IPR000991"
FT                   /inference="similar to AA sequence:INSD:CAD07669.1"
FT                   /protein_id="ABV11533.1"
FT                   /translation="MRVHFVVHESFESAGAYLQWAEDRGYPLSWSRVYAGEPVPANADG
FT                   FDMLVVFGGPQSPRTTLEECPYFDSLAEQRLINQAISARRIVIGICLGSQLIGEALGAK
FT                   VRQSPEKEIGHYPITLTEAGKQNPLLAHFGSPLVVGHWHNDMPGLTDQSVVLATSEGCP
FT                   RQIVQYGNAVYGFQCHMEFTAEAVEGLIQHSEQELAAAKGKRFIRSNAEMREWNYQEMN
FT                   EKLWRFLDLLVEKRNA"
FT   gene            complement(357457..358749)
FT                   /locus_tag="CKO_00371"
FT   CDS_pept        complement(357457..358749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0881 1.1e-26 transcriptional
FT                   regulatory protein GntR family K00825; COG: COG1167
FT                   Transcriptional regulators containing a DNA-binding HTH
FT                   domain and an aminotransferase domain (MocR family) and
FT                   their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11534"
FT                   /db_xref="GOA:A8ADH1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH1"
FT                   /inference="protein motif:Gene3D:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR000524"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="protein motif:HMMSmart:IPR000524"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456972.1"
FT                   /protein_id="ABV11534.1"
FT                   /translation="MIDGKTASEIFDSIRQHVTTGALAPGETLPPVRELASELSVNRNT
FT                   VAAAYKRLVTSGLALSQGRNGTVIKGAPSPLALEGSSPDTPLTDLSGGNPDPQRLPDLS
FT                   SYFSTINKSPRLYGDAAVSPTLHAWAKQWMQDAIPGEGEIDITSGAIDAIERLLCAHLL
FT                   PGDSVAVEDPCFLSSISMLRYAGFSAIPVGVDSEGMQPEMLEQALKNGARAVILTPRAH
FT                   NPTGCSLSASRAAALQNIVAKYPQALVIIDDHFALLSSSPWHPVIAPETLHWSVVRSMS
FT                   KTLGPDLRLAIVASDPATSARLRLRLNSGSQWVSHLLQDLVHACLSDKNYQRTLAQTRK
FT                   FYASQQQKLACALQRTGLTHAPGDGLNAWLPLKSHSQSIAFMLAKAGWLVREGEAFGVN
FT                   APAHGLRITLSTLGDGDINKLAADIHQALKR"
FT   gene            358832..359698
FT                   /locus_tag="CKO_00372"
FT   CDS_pept        358832..359698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2435 8.1e-130 pdxK;
FT                   pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine
FT                   kinase K00868; COG: COG2240
FT                   Pyridoxal/pyridoxine/pyridoxamine kinase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11535"
FT                   /db_xref="GOA:A8ADH2"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH2"
FT                   /inference="protein motif:HMMPfam:IPR011611"
FT                   /inference="protein motif:HMMTigr:IPR004625"
FT                   /inference="similar to AA sequence:INSD:AAO68140.1"
FT                   /protein_id="ABV11535.1"
FT                   /translation="MGQDSEIQSVLFDDKHRALQTDIVAVQSQVVYGSVGNSIAVPAIK
FT                   AQGLRVTAVPTVLFSNTPHYETFYGGIIPADWFSGYLQALNERDALRELKAVTTGYMGS
FT                   AEQIVLLAKWLETVRIAHPEVCILVDPVIGDTDSGMYVKAEIPQAYRHYLLPLAQGLTP
FT                   NVFELEMLSGKPCGTLDEAVAAAKSLLSDTLKWIVITSAPGQTADTINVAVVTNGGVDV
FT                   IEHPRVETDLKGTGDLFCAELVSGIVQGKALTAATRHAAERVLEVMTWTQRCGCDELIL
FT                   PPAGEAR"
FT   gene            359695..359934
FT                   /locus_tag="CKO_00373"
FT   CDS_pept        359695..359934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00373"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG31214 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11536"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH3"
FT                   /inference="protein motif:ScanRegExp:IPR002086"
FT                   /inference="similar to AA sequence:INSD:AAV76442.1"
FT                   /protein_id="ABV11536.1"
FT                   /translation="MKSYRLVVRQQGRVVGHFETSGLDALEDICVARAMFGIAGGYQCE
FT                   LLVSDSEKRMLESGPEGMKILMREKCYRPVTSLL"
FT   gene            complement(359918..360121)
FT                   /locus_tag="CKO_00374"
FT   CDS_pept        complement(359918..360121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11537"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH4"
FT                   /protein_id="ABV11537.1"
FT                   /translation="MKPRLSASRSNSCRREKWRRLAPFFYPGYGKTAPDGAALIGPTIK
FT                   DRRPDKAFFAAIRHSYALTTAR"
FT   gene            complement(360090..360599)
FT                   /locus_tag="CKO_00375"
FT   CDS_pept        complement(360090..360599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0424 4.9e-84 crr; glucose-specific IIA
FT                   component of PTS system K02777; COG: COG2190
FT                   Phosphotransferase system IIA components; Psort location:
FT                   Cytoplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11538"
FT                   /db_xref="GOA:A8ADH5"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH5"
FT                   /inference="protein motif:BlastProDom:IPR001127"
FT                   /inference="protein motif:HMMPfam:IPR001127"
FT                   /inference="protein motif:HMMTigr:IPR001127"
FT                   /inference="protein motif:ScanRegExp:IPR001127"
FT                   /inference="protein motif:superfamily:IPR011055"
FT                   /inference="similar to AA sequence:INSD:AAV76443.1"
FT                   /protein_id="ABV11538.1"
FT                   /translation="MGLFDKLKSLVSDDKKDTGTIEIVAPLSGEIVNIEDVPDVVFAEK
FT                   IVGDGIAIKPTGNKMVAPVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGF
FT                   KRIAEEGQRVKVGDPVIEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGSVTVGETP
FT                   VIRIKK"
FT   gene            complement(360640..362367)
FT                   /locus_tag="CKO_00376"
FT   CDS_pept        complement(360640..362367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2432 2.9e-292 ptsI; General PTS family
FT                   (Enzyme I) PEP-protein phosphotransferase K08483; COG:
FT                   COG1080 Phosphoenolpyruvate-protein kinase (PTS system EI
FT                   component in bacteria); Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11539"
FT                   /db_xref="GOA:A8ADH6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH6"
FT                   /inference="protein motif:BlastProDom:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR008279"
FT                   /inference="protein motif:HMMPfam:IPR008731"
FT                   /inference="protein motif:HMMTigr:IPR006318"
FT                   /inference="protein motif:ScanRegExp:IPR000121"
FT                   /inference="protein motif:ScanRegExp:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008731"
FT                   /inference="similar to AA sequence:INSD:AAO68143.1"
FT                   /protein_id="ABV11539.1"
FT                   /translation="MISGILASPGIAFGKALLLKEDEIVIDRKKISADKVDQEVERFLS
FT                   GRAKASAQLEAIKTKAGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKNMTADAAA
FT                   HEVIEGQATALEELDDEYLKERAADVRDIGKRLLRNILGLAIIDLSSIKDEVILVAADL
FT                   TPSETAQLNLQKVLGFITDAGGRTSHTSIMARSLELPAIVGTGNVTSQVKNDDYLILDA
FT                   VNNQVYVNPTNEEIEKLRAVQEQVATEKAELAKLKDLPAITLDGHQVEVCANIGTVRDV
FT                   EGAERNGAEGVGLYRTEFLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDK
FT                   ELPYMNFPKEENPFLGWRAVRIAMDRKEILRDQVRAILRASAFGKLRIMFPMIISVEEV
FT                   RALRKEIEIYKQELRDEGKAFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNDMISHLYQPMSPSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISIPRIKKIIRNTNFEDAKVLAEQALAQPTTDELMTLVNKFIEEKTIC"
FT   gene            complement(362412..362669)
FT                   /locus_tag="CKO_00377"
FT   CDS_pept        complement(362412..362669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bci:BCI_0069 7.4e-33 ptsH; phosphocarrier
FT                   protein HPr K00890; COG: COG1925 Phosphotransferase system,
FT                   HPr-related proteins; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11540"
FT                   /db_xref="GOA:A8ADH7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH7"
FT                   /inference="protein motif:BlastProDom:IPR000032"
FT                   /inference="protein motif:Gene3D:IPR000032"
FT                   /inference="protein motif:HMMPfam:IPR000032"
FT                   /inference="protein motif:HMMTigr:IPR005698"
FT                   /inference="protein motif:ScanRegExp:IPR001020"
FT                   /inference="protein motif:ScanRegExp:IPR002114"
FT                   /inference="protein motif:superfamily:IPR000032"
FT                   /inference="similar to AA sequence:INSD:ABG70428.1"
FT                   /protein_id="ABV11540.1"
FT                   /translation="MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAK
FT                   SLFKLQTLGLTQGTVVTIAAEGEDEQKAVEHLVKLMAELE"
FT   gene            362726..362851
FT                   /locus_tag="CKO_00378"
FT   CDS_pept        362726..362851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11541"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH8"
FT                   /protein_id="ABV11541.1"
FT                   /translation="MTLACIVSVGVNGTRHTRCYAQSVAGNCWPLTFRSSLNIMP"
FT   gene            complement(363053..364024)
FT                   /locus_tag="CKO_00379"
FT   CDS_pept        complement(363053..364024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00379"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2666 1.0e-163 cysK; cysteine synthase A
FT                   K01738; COG: COG0031 Cysteine synthase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11542"
FT                   /db_xref="GOA:A8ADH9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADH9"
FT                   /inference="protein motif:HMMPfam:IPR001926"
FT                   /inference="protein motif:HMMTigr:IPR005856"
FT                   /inference="protein motif:HMMTigr:IPR005859"
FT                   /inference="protein motif:ScanRegExp:IPR001216"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABV11542.1"
FT                   /translation="MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRI
FT                   GANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYELTLTMPDTMSVERRKLL
FT                   KALGANLVLTEGAKGMKGAIQKAEEIVASDPEKYLLLQQFSNPANPEIHEKTTGPEIWE
FT                   DTDGQVDVFISGVGTGGTLTGVTRYIKGTKGKTDLITVAVEPTDSPVIAQALAGEELKP
FT                   GPHKIQGIGAGFIPGNLDLKLIDKVVSITNEEAISTARRLMEEEGILAGISSGAAVAAA
FT                   LKLQEDETFTNKNIVVILPSSGERYLSTALFADLFTEKELQQ"
FT   gene            complement(364213..364974)
FT                   /locus_tag="CKO_00380"
FT   CDS_pept        complement(364213..364974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03674 3.6e-07 hypothetical protein
FT                   K01954; COG: COG2981 Uncharacterized protein involved in
FT                   cysteine biosynthesis; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11543"
FT                   /db_xref="GOA:A8ADI0"
FT                   /db_xref="InterPro:IPR022985"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADI0"
FT                   /inference="protein motif:HMMPfam:IPR007496"
FT                   /inference="similar to AA sequence:INSD:AAC75466.1"
FT                   /protein_id="ABV11543.1"
FT                   /translation="MVSSSATAPRSGFYYFSQGWKLVTQPGIRRFVILPLLVNILLMGG
FT                   AFWWLFTQLDVWIPSLMSHVPDWLQWLSYLLWPIAVISVLLVFGYFFSTIANWIAAPFN
FT                   GLLAEQLEARLTGATPPDTGVLGIMKDVPRIMKREWQKFIWYLPRAIVLLILYFIPGVG
FT                   QTVAPVLWFLFSAWMLAIQYCDYPFDNHKVPFKEMRTALRTQKVANMQFGALTSLFTMI
FT                   PVLNLVIMPVAVCGATAMWVDCYRSKHALWK"
FT   gene            365204..366229
FT                   /locus_tag="CKO_00381"
FT   CDS_pept        365204..366229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2744 3.0e-146 zipA; cell division
FT                   protein ZipA K03528; COG: COG3115 Cell division protein;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11544"
FT                   /db_xref="GOA:A8ADI1"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADI1"
FT                   /inference="protein motif:HMMPfam:IPR007449"
FT                   /inference="protein motif:HMMSmart:IPR007449"
FT                   /inference="protein motif:HMMTigr:IPR011919"
FT                   /inference="similar to AA sequence:INSD:ABE08204.1"
FT                   /protein_id="ABV11544.1"
FT                   /translation="MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMK
FT                   SKRDDDSYDDDVEEEEGVGEVRVHRVNHAPGNAQEHDAPRQSPQHQYQPPYASAQPRQP
FT                   AQQPPEAPAQPQQRPQYGQPSQPQPAQQPAQPVQQPVQQQPVAPQVQSAPQQPVQPAPQ
FT                   QPAPQPAPQTFQPAEPVAEPAPAPEPVVEEAPVAEKPQRKEAVIIMNVAAHHGSELSGE
FT                   VLLNSIQQAGFKFGDMNIFHRHLSPDGSGPALFSLANMVNPGTFDPEMTGDFSTPGVTI
FT                   FMQVPSYGDELQNFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDRIREVKESN
FT                   A"
FT   gene            366300..368315
FT                   /locus_tag="CKO_00382"
FT   CDS_pept        366300..368315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0431 0. ligA; DNA ligase K01972; COG:
FT                   COG0272 NAD-dependent DNA ligase (contains BRCT domain type
FT                   II); Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11545"
FT                   /db_xref="GOA:A8ADI2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADI2"
FT                   /inference="protein motif:BlastProDom:IPR004150"
FT                   /inference="protein motif:Gene3D:IPR004150"
FT                   /inference="protein motif:HMMPfam:IPR000445"
FT                   /inference="protein motif:HMMPfam:IPR001357"
FT                   /inference="protein motif:HMMPfam:IPR004149"
FT                   /inference="protein motif:HMMPfam:IPR004150"
FT                   /inference="protein motif:HMMPfam:IPR013839"
FT                   /inference="protein motif:HMMSmart:IPR001357"
FT                   /inference="protein motif:HMMSmart:IPR013840"
FT                   /inference="protein motif:HMMTigr:IPR001679"
FT                   /inference="protein motif:ScanRegExp:IPR001679"
FT                   /inference="protein motif:superfamily:IPR008994"
FT                   /inference="protein motif:superfamily:IPR010994"
FT                   /protein_id="ABV11545.1"
FT                   /translation="MESIEQQLTELRTTLRHHEYLYHVMDAPEIPDAEYDRLMRELREL
FT                   EAQHPDLITPDSPSQRVGAAPLAAFSQIRHEVPMLSLDNVFDEESFLAFNKRVQDRLKS
FT                   GDKLTWCCELKLDGLAVSILYENGVLISAATRGDGTTGEDITSNVRTIRAIPLKLRGDN
FT                   IPARLEVRGEVFLPQAGFEKINEEARRTGNKVFANPRNAAAGSLRQLDPRITAKRPLTF
FT                   FCYGVGILEGGELPDTHLGRLLQFKAWGLPVSDRVTLCDSPEAVLDFYHKVEEDRPTLG
FT                   FDIDGVVIKVNSMALQEQLGFVARAPRWAVAFKFPAQEQMTFVRDVEFQVGRTGAITPV
FT                   ARLEPVHVAGVLVSNATLHNADEIERLGLRIGDKVVIRRAGDVIPQVVNVVLSERPEET
FT                   RPVEFPTHCPVCGSDVERVEGEAVARCTGGLICGAQRKESLKHFVSRRAMDVDGMGDKI
FT                   IDQLVEKEYVHTPADLFRLTAGKLTGLDRMGPKSAQNVVNALEKAKETTFARFLYALGI
FT                   REVGEATAAGLAAYFGTLEALEAASIDELQKVPDVGIVVATHVFNFFAEESNRDVIGQL
FT                   LAEGIHWPAPIVVNADEIDSPFAGKTIVLTGSLSLMSRDDAKARLVALGAKVAGSVSKK
FT                   TDLVIAGEAAGSKLAKAQELGIDVIDEAEMLRLLGV"
FT   gene            368317..368535
FT                   /locus_tag="CKO_00383"
FT   CDS_pept        368317..368535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmu:TC0823 9.2e-05 DNA polymerase III, epsilon
FT                   subunit, putative K02342; COG: COG3530 Uncharacterized
FT                   protein conserved in bacteria; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11546"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI3"
FT                   /inference="similar to AA sequence:INSD:AAG57529.1"
FT                   /protein_id="ABV11546.1"
FT                   /translation="MEKEQLIEIANTVMPFGKYKGRRLIDVPEEYLLWFARKDEFPAGR
FT                   LGELMQITLLIKTEGLTQLVQPLKRPL"
FT   gene            complement(368532..369530)
FT                   /locus_tag="CKO_00384"
FT   CDS_pept        complement(368532..369530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00384"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0385 Predicted Na+-dependent transporter;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11547"
FT                   /db_xref="GOA:A8ADI4"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI4"
FT                   /inference="protein motif:HMMPfam:IPR002657"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149763.1"
FT                   /protein_id="ABV11547.1"
FT                   /translation="MKLFRILDPFTLTLITVVLLASFFPAKGDFVPFFEGLTTAAIALL
FT                   FFMHGAKLSREAIIAGGSHWRLHLWVMCSTFILFPVLGVLFAWWAPVNVDPMLYTGFLY
FT                   LCILPATVQSAIAFTSLAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNIHGAEGSLEQ
FT                   VGKIMLQLLLPFVLGHLSRPWIGNWVARHKKWIAKTDQTSILLVVYSAFSEAVVNGIWH
FT                   KVGWGSLLFIVVVSLVLLAIVIGVNVFAARRFGFNKADEITIVFCGSKKSLANGIPMAN
FT                   ILFPTSVIGMMVLPLMIFHQIQLMVCAMLARRYKRQTDKLQAQQEGRAAKA"
FT   gene            complement(369527..369727)
FT                   /locus_tag="CKO_00386"
FT   CDS_pept        complement(369527..369727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11549"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI5"
FT                   /protein_id="ABV11549.1"
FT                   /translation="MAHRRLTQTNDVPCPTKAFSLSNGDEDTKLTQRIIHLLNSYIDAI
FT                   NQFYFSNGKKQNTCIDFQEFL"
FT   gene            369620..370546
FT                   /locus_tag="CKO_00385"
FT   CDS_pept        369620..370546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 2.4e-20 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11548"
FT                   /db_xref="GOA:A8ADI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI6"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:AAL21318.1"
FT                   /protein_id="ABV11548.1"
FT                   /translation="MNYSLRQLRIFVTVAQAKSFSRAGDVIGLSQSAVSHSVKELERQT
FT                   GVKLLDRTTREVTLTEAGQQLAGRLERVLDELHSTLREAGRVGTQLTGTVRVAASQTIS
FT                   AHLIPQCIAQSNQLYPEIDFVLHDRPQQWVLESIRQGDVDFGIVIDPGAVSDLQCEAVL
FT                   SEPFLLLCRQDSPLAQREWVNWQDLKHERLVLQDYASGSRPLIDAAFAHFAIDATIVQE
FT                   IGHPATLFPMVEAGIGISVLPALALPLPQGSHLQVKRLTPVVERQLMLARRKNRSLSTA
FT                   AQALWDVVRMQASELTAGRARDPLYQI"
FT   gene            complement(370537..370947)
FT                   /locus_tag="CKO_00388"
FT   CDS_pept        complement(370537..370947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ddi:DDB0231210 6.3e-05 putative CDC7 family
FT                   protein kinase K02214; COG: NOG12169 non supervised
FT                   orthologous group; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11551"
FT                   /db_xref="InterPro:IPR025577"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI7"
FT                   /inference="similar to AA sequence:INSD:ABP61599.1"
FT                   /protein_id="ABV11551.1"
FT                   /translation="MAGTAEGLFTSADINVLRQEEMVMTTINTSVSAVQSGSTGSKAAT
FT                   GNDLSAQISRITQQITKLTQQLKEVADGSGSTEEKQKQQELIQTQIKMLQAQLAQLQRQ
FT                   QAEETQQKQEQKQLRAEGVNAPSDDHQIDVYI"
FT   gene            370865..371062
FT                   /locus_tag="CKO_00387"
FT   CDS_pept        370865..371062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11550"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI8"
FT                   /protein_id="ABV11550.1"
FT                   /translation="MIVVITISSCLKTLISAEVNRPSAVPAISGGQIRQSLTILFYVSI
FT                   YILYRSSGKTVLVIGWLLSL"
FT   gene            371114..371947
FT                   /locus_tag="CKO_00389"
FT   CDS_pept        371114..371947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2420 3.0e-132 xapA; xanthosine
FT                   phosphorylase (purine nucleoside phosphorylase) K03815;
FT                   COG: COG0005 Purine nucleoside phosphorylase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11552"
FT                   /db_xref="GOA:A8ADI9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010943"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADI9"
FT                   /inference="protein motif:HMMPanther:IPR001369"
FT                   /inference="protein motif:HMMPfam:IPR001369"
FT                   /inference="protein motif:HMMPIR:IPR011268"
FT                   /inference="protein motif:HMMTigr:IPR010943"
FT                   /inference="protein motif:HMMTigr:IPR011268"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217407.1"
FT                   /protein_id="ABV11552.1"
FT                   /translation="MTHTLFSQNPWYSADIIRAHKPDFTPRVAFILGSGLGALAEQIED
FT                   AVAISYARLPGFPVSTVHGHAGELVLGNLAGVPVACMKGRGHFYEGRGMTIMTDAIRTL
FT                   KLLDCELLFCTNAAGSLRPEVGPGSLVALSDHINTMPGTPMVGMNDERFGDRFFSLANA
FT                   YDADYRAILQRVAGEEGFTLHEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVI
FT                   SARHCGLKVVAVSAITNLAEGLGDVKLSHAQTLAAAELSRQNFINLICGFLRQLA"
FT   gene            371962..373221
FT                   /locus_tag="CKO_00390"
FT   CDS_pept        371962..373221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C3355 9.0e-131 nupG; transport of
FT                   nucleosides, permease protein K03289; COG: NOG06211 non
FT                   supervised orthologous group; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11553"
FT                   /db_xref="GOA:A8ADJ0"
FT                   /db_xref="InterPro:IPR004740"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ0"
FT                   /inference="protein motif:HMMPfam:IPR004740"
FT                   /inference="protein motif:HMMTigr:IPR004740"
FT                   /inference="similar to AA sequence:INSD:AAL21315.1"
FT                   /protein_id="ABV11553.1"
FT                   /translation="MALLAGPYFTARNEKMGITSRLKVMSFLQYFIWGSWLVTLGSYMI
FT                   NTLHFTGANVGMIYSSKGLAAIIMPGIMGIVADKWLRAERAYMLCHLVCAGALLYATTV
FT                   TDPDAMFWIMLINAMAYMPTIALSNSVSYACLAQSGQDPVTAFPPVRVFGTVGFIIAMW
FT                   TVSLMGLELSSAQLYIAAGASLLLALYAFTLPKIPVAKKNTSATLASKLGLDAFVLFKN
FT                   PRMAIFFLFAMMLGAVLQITNVFGNPFLHDFARNPAFADSVVVKYPSILLSVSQMAEVG
FT                   FILTIPFFLKRFGIKTVMLMSMLAWTLRFGFFAFGDPSPFGVVLLLMSMIVYGCAFDFF
FT                   NISGSVFVEQEVSSTIRASAQGLFMTMVNGVGAWVGSILSGIAVDYFSVGSVKDWQTIW
FT                   LVFAAYALALAVIFALLFQI"
FT   gene            373362..374246
FT                   /locus_tag="CKO_00391"
FT   CDS_pept        373362..374246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 1.1e-17 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11554"
FT                   /db_xref="GOA:A8ADJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037409"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ1"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:INSD:AAL21314.1"
FT                   /protein_id="ABV11554.1"
FT                   /translation="MERVHRIDLKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHVKEL
FT                   ENQLGTPLFVRHSRSVALTHAGKILMEESRRLLFSANQAFARVEQIGRGEAGRIELGVV
FT                   GTAMWGKMRPVMRRFLKENPNVEVLFREKMPAMQMALLERRELDAGIWRMAIEPTEGFT
FT                   SLRLHESAFLVAMPEDHPLACCPAIPLDALRNEYFVTMPSIHTDWAFLQRVCQKAGFTP
FT                   MIVREVMEPQTVLAMISMGIGITLIADSYAQMNWPGVVFRPLEERIPADLYIVYEPQQA
FT                   TPALTKLIDALIR"
FT   gene            complement(374321..374393)
FT                   /locus_tag="CKO_00392"
FT   tRNA            complement(374321..374393)
FT                   /locus_tag="CKO_00392"
FT                   /product="tRNA-Lys"
FT   gene            complement(374401..374473)
FT                   /locus_tag="CKO_00393"
FT   tRNA            complement(374401..374473)
FT                   /locus_tag="CKO_00393"
FT                   /product="tRNA-Val"
FT   gene            complement(374523..374595)
FT                   /locus_tag="CKO_00394"
FT   tRNA            complement(374523..374595)
FT                   /locus_tag="CKO_00394"
FT                   /product="tRNA-Val"
FT   gene            complement(374643..374715)
FT                   /locus_tag="CKO_00395"
FT   tRNA            complement(374643..374715)
FT                   /locus_tag="CKO_00395"
FT                   /product="tRNA-Val"
FT   gene            374975..376390
FT                   /locus_tag="CKO_00396"
FT   CDS_pept        374975..376390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00396"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2415 5.3e-252 gltX; glutamate tRNA
FT                   synthetase, catalytic subunit K01885; COG: COG0008
FT                   Glutamyl- and glutaminyl-tRNA synthetases; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11555"
FT                   /db_xref="GOA:A8ADJ2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADJ2"
FT                   /inference="protein motif:Gene3D:IPR008925"
FT                   /inference="protein motif:HMMPanther:IPR000924"
FT                   /inference="protein motif:HMMPfam:IPR000924"
FT                   /inference="protein motif:HMMTigr:IPR004527"
FT                   /inference="protein motif:ScanRegExp:IPR001412"
FT                   /inference="protein motif:superfamily:IPR008925"
FT                   /inference="similar to AA sequence:SwissProt:P0A2K4"
FT                   /protein_id="ABV11555.1"
FT                   /translation="MKIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTD
FT                   LERSTPEAIEAIMDGMNWLSLEWDEGPYFQTKRFDRYNAVIDEMLEAGTAYKCYCSKER
FT                   LEALREEQMAKGEKPRYDGRCRHGHEHHSDDEPCVVRFANPQDGSVIFDDQIRGSIEFS
FT                   NQELDDLIIRRTDGSPTYNFCVVVDDWDMEITHVIRGEDHINNTPRQINILKALNAPVP
FT                   VYAHVSMINGDDGKKLSKRHGAVSVMQYRDDGYLPEALLNYLVRLGWSSGDQEIFTREE
FT                   MIKLFSLNAVSKSASAFNTDKLLWLNHHYINSLAPEYVATHLQWHIEQENIDTRNGPQL
FT                   AELVKLLGERCKTLKEMAQSCRYFYEDFAEFDADAAKKHLRPVARQPLEVVRDKLAAIT
FT                   EWSAENVHHAIQATADELEVGMGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSIERIN
FT                   KALAFIAERENQQ"
FT   gene            complement(376467..376856)
FT                   /locus_tag="CKO_00397"
FT   CDS_pept        complement(376467..376856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00397"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09785 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11556"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010749"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ3"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR010749"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:CAD07650.1"
FT                   /protein_id="ABV11556.1"
FT                   /translation="MKKLRSKMTTEELAECLGVARQTVNRWIREQGWETEKFPGVKGGR
FT                   ARLIHIDARVQEFILNIPAFRNHSAFYQAEEPLAEYSHVVRSHAYRQIIDAVENMSSKE
FT                   QEKLAQFLSREGIRGFLARLGLDES"
FT   gene            complement(376858..377220)
FT                   /locus_tag="CKO_00398"
FT   CDS_pept        complement(376858..377220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00398"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG09771 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11557"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010749"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ4"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR010749"
FT                   /inference="protein motif:superfamily:IPR009061"
FT                   /inference="similar to AA sequence:INSD:AAL21311.1"
FT                   /protein_id="ABV11557.1"
FT                   /translation="MFKERMTPEELANLTGYSRQTINKWVRKEGWTTSPKPGVQGGKAR
FT                   LVHVNEQVREYIRSAERSAEGASESFSLTSDTSLESLLVTLAKEMTPSEQKHFTSLLLR
FT                   EGITGLLQRLGIRDSK"
FT   gene            377442..377514
FT                   /locus_tag="CKO_00399"
FT   tRNA            377442..377514
FT                   /locus_tag="CKO_00399"
FT                   /product="tRNA-Ala"
FT   gene            377557..377629
FT                   /locus_tag="CKO_00400"
FT   tRNA            377557..377629
FT                   /locus_tag="CKO_00400"
FT                   /product="tRNA-Ala"
FT   gene            377843..380041
FT                   /locus_tag="CKO_00401"
FT   CDS_pept        377843..380041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0087 2.6e-23 sensory transduction
FT                   protein kinase; COG: COG2199 FOG: GGDEF domain; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11558"
FT                   /db_xref="GOA:A8ADJ5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ5"
FT                   /inference="protein motif:HMMPfam:IPR000160"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR007895"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /protein_id="ABV11558.1"
FT                   /translation="MQGKHNLLKNIRIFIISLTLSIVGIQFSRSISPLAVVDDSSIFLA
FT                   WLPLCVMFSVLFLFGRRGIVPIILAMMATNHWNLHLPLMQAAVLLFCQTFSVLGICGIV
FT                   RWQVGSRWRHGLPDRNIWLRIFWIGFVAPAGIKASMYLAGHCLDYPVAISTFFGTATII
FT                   YTIVDILSLISAVLIFTMLFYYPLRMIINPRYCRIFWRRDIAPYLVKEKRLFTLTWISV
FT                   VVALIVLMCAPFDADYIAGYLVPVFFIVFTLGVGKLSYPLLNLSWAISALCLLVYNRNF
FT                   LQGVGSEYSLAFILSVLISFSICLLYMVCIYQRSEWLNRQWHGQALTDPLTRLPNIRAL
FT                   EQFLLQGTGQTVCCLRMENLEFLSRHYGMLMRVHCKRSVCRMLQPFLQENESVFQVPGS
FT                   ELLLVLRGPETEARLQHMVNLLNSRKIYWNNTGLDMEYGAAWGAYDGRQETLQPLLGQL
FT                   SWLSEQSCANHRVMALTQSLEAVSDQTTERVLLLQKVRKALENGDLVLYAQPILNAQGK
FT                   GYAEVLARLKSDDGIMTPDQFIPLIAQFNLSARFDLQVVEALLRWIATHPTTEPGARFS
FT                   VNLMPLTLLNKESASRIICLFRRYGITPESVIIEITEEQAFSNSEISTQNIAQLRNFGF
FT                   RIAIDDFGTGYANYERLKRLRADIIKIDGCFIKDIMTDSLDAMIVKSITDLAKAKSLCV
FT                   VAEFVETPEQRELLLSLGVNYLQGYLIGRPRPLEALQL"
FT   gene            complement(380122..381309)
FT                   /locus_tag="CKO_00402"
FT   CDS_pept        complement(380122..381309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00402"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1972 Nucleoside permease; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11559"
FT                   /db_xref="GOA:A8ADJ6"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ6"
FT                   /inference="protein motif:BlastProDom:IPR008276"
FT                   /inference="protein motif:HMMPanther:IPR008276"
FT                   /inference="protein motif:HMMPfam:IPR002668"
FT                   /inference="protein motif:HMMPfam:IPR011642"
FT                   /inference="protein motif:HMMPfam:IPR011657"
FT                   /inference="protein motif:HMMTigr:IPR008276"
FT                   /inference="similar to AA sequence:INSD:ABP61591.1"
FT                   /protein_id="ABV11559.1"
FT                   /translation="MDRVLHFVLALAVVAVLALLVSHDRKKIRIRYVIQLLVIEVLLAW
FT                   FFLNSNVGLGFVKGFSEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISAL
FT                   IGILQHIRVLPVVIRAIGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKMSR
FT                   NRMYTMAATAMSTVSMSIVGAYMTMLEPKYVVAALVLNMFSTFIVLSVINPYRVEASEE
FT                   NIQMSNLHEGQSFFEMLGEYILAGFKVAIIVAAMLIGFIALIAALNALFAAVLGISFQG
FT                   ILGYIFYPVAWVMGVPANEALQVGSIMATKLVSNEFVAMMDLQKIASTLSPRAEGIISV
FT                   FLVSFANFSSIGIIAGAIKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALVL"
FT   gene            complement(381476..381631)
FT                   /locus_tag="CKO_00403"
FT   CDS_pept        complement(381476..381631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11560"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ7"
FT                   /protein_id="ABV11560.1"
FT                   /translation="MLCFMLCLLRMIIKCILMGNVDISDSARLWASKGGSKNKTRLFVN
FT                   CMRLAQ"
FT   gene            381637..382893
FT                   /locus_tag="CKO_00404"
FT   CDS_pept        381637..382893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00404"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1914 Mn2+ and Fe2+ transporters of the NRAMP
FT                   family; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11561"
FT                   /db_xref="GOA:A8ADJ8"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADJ8"
FT                   /inference="protein motif:BlastProDom:IPR001046"
FT                   /inference="protein motif:HMMPanther:IPR001046"
FT                   /inference="protein motif:HMMPfam:IPR001046"
FT                   /inference="protein motif:HMMTigr:IPR001046"
FT                   /inference="protein motif:superfamily:IPR008928"
FT                   /inference="similar to AA sequence:REFSEQ:NP_288962.1"
FT                   /protein_id="ABV11561.1"
FT                   /translation="MFLRQKMTNDRVESSSGRAARKLRLALMGPAFIAAIGYIDPGNFA
FT                   TNIQAGASFGYKLLWVVVWANLMAMLIQVLSAKLGIATSKNLAEQIRDHYPRPVVWFYW
FT                   VQAEIIAMATDLAEFIGAAIGFKLILGISLLQGAVLTGIATFLILMLQRRGQKPLEKVI
FT                   GGLLLFVAAAYIVELIFSQPSLAQLSKGMIIPSLPNSEAVFLAAGVLGATIMPHVIYLH
FT                   SSLTQHLHGGSRQQRYAATKWDVAIAMTIAGFVNLAMMATAAAAFHFSGHTGIADLDQA
FT                   YLTLEPLLSHAAATVFGLSLVAAGLSSTVVGTLAGQVVMQGFVRFHIPLWVRRTITMMP
FT                   SFIVILMGLDPTRILVMSQVLLSFGIALALVPLLIFTSDRTLMGDLVNTQWVKYIGWMI
FT                   VVLVVALNIWLLVGTALGL"
FT   gene            complement(382994..383236)
FT                   /locus_tag="CKO_00405"
FT   CDS_pept        complement(382994..383236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00405"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpv:TP01_0149 0.0024 serine/threonine protein
FT                   kinase K08287; COG: NOG09770 non supervised orthologous
FT                   group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11562"
FT                   /db_xref="InterPro:IPR019638"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADJ9"
FT                   /inference="similar to AA sequence:INSD:AAL21307.1"
FT                   /protein_id="ABV11562.1"
FT                   /translation="MPSIKLQIGDRDNYGNYWDGRYWRDRDYWHHHYEWRKNRWWRHDN
FT                   GYHRGWDKRKAYERGYREGWRDRDHHPGRGHGHRH"
FT   gene            383241..383411
FT                   /locus_tag="CKO_00406"
FT   CDS_pept        383241..383411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11563"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK0"
FT                   /protein_id="ABV11563.1"
FT                   /translation="MISPAFAASGVKANKAAARISDLNILFLLHDRAVIGLLTQYYGAV
FT                   KPRFIALTLKS"
FT   gene            complement(383439..384437)
FT                   /locus_tag="CKO_00408"
FT   CDS_pept        complement(383439..384437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02454 8.9e-108 probable
FT                   oxidoreductase protein K05882; COG: COG0667 Predicted
FT                   oxidoreductases (related to aryl-alcohol dehydrogenases);
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11565"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK1"
FT                   /inference="protein motif:BlastProDom:IPR001395"
FT                   /inference="protein motif:Gene3D:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR001395"
FT                   /inference="protein motif:HMMPanther:IPR005399"
FT                   /inference="protein motif:HMMPfam:IPR001395"
FT                   /inference="similar to AA sequence:INSD:AAL21306.1"
FT                   /protein_id="ABV11565.1"
FT                   /translation="MVYRADKNRYQTMEYRRCGQSGLKLPAISLGLWHNFGDTTQVENS
FT                   RALLQRAFDLGITHFDLANNYGPPPGSAERHFGRILQEDFLPWRDELIISTKAGYTMWD
FT                   GPYGDWGSRKYLIASLDQSLKRLGLEYVDIFYHHRPDPETPLKETMKALDHIVRQGKAL
FT                   YVGISNYPADLARQAIEILDDLGTPCLIHQPKYSMFERWVEDGLLALLQEKGVGSIAFS
FT                   PLAGGQLTDRYLNGIPADSRAASGSRFLNPDQITPEKLEKVRQLNALAGRRGQKLSQMA
FT                   LAWVLRDDKVTSVLIGASKTAQIEDAVGMLANRHFSPAECAEINAILNGSQ"
FT   gene            384350..384514
FT                   /locus_tag="CKO_00407"
FT   CDS_pept        384350..384514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11564"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK2"
FT                   /protein_id="ABV11564.1"
FT                   /translation="MKWRGALNRSDRSGDTPLSGSDFYRPDKPCCCPLNDVSFQCIRLH
FT                   GLLFNEITP"
FT   gene            384620..386275
FT                   /locus_tag="CKO_00409"
FT   CDS_pept        384620..386275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2405 6.4e-240 indolepyruvate
FT                   decarboxylase K01568; COG: COG3961 Pyruvate decarboxylase
FT                   and related thiamine pyrophosphate-requiring enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11566"
FT                   /db_xref="GOA:A8ADK3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK3"
FT                   /inference="protein motif:HMMPfam:IPR011766"
FT                   /inference="protein motif:HMMPfam:IPR012000"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR012110"
FT                   /inference="protein motif:ScanRegExp:IPR000399"
FT                   /inference="protein motif:ScanRegExp:IPR000408"
FT                   /inference="similar to AA sequence:INSD:CAC48239.1"
FT                   /protein_id="ABV11566.1"
FT                   /translation="MQTPYSVADYLLDRLAGCGIGHLFGVPGDYNLQFLDHVIAHRDVC
FT                   WVGCANELNAAYAADGYARLAGAGALLTTFGVGELSALNGLAGSYAEYVPVLHIVGAPC
FT                   SGAQRRGELMHHTLGDGDFQHFYRISQAVTAASAVLNEQNACYEIDRVLRGMLTMRRPG
FT                   YLMLPADVAKRPAVPPVNVLTPDRAEGENDTVAAFRYRARQRLMNSPRVALLADFLALR
FT                   FGLQPVLQRWMAETPIAHATLLMGKGLFDEQHPNFVGTYSAGASSESVRQAIEEADTVI
FT                   CVGTRFVDTLTAGFTQQLPQERTIEIQPHASRVGNSWFSGLSMEQAVTTLRELCLELSF
FT                   SPPPTPAHAPGGHIEKGTLTQENFWHTVQAYLLPGDIILADQGTAAFGAADLSLPAGAD
FT                   VLVQPLWGSIGYALPAAFGAQTACPERRVILITGDGAAQLTIQELGSMMRDGQSPVILL
FT                   LNNDGYTVERAIHGANQRYNDIAGWNWTQVPQALSANCQAECWRVTQAIQLEEVLARLK
FT                   SPQRLSLIEVVLPKADLPELLRTVTRALESRNGE"
FT   gene            complement(386289..387500)
FT                   /locus_tag="CKO_00411"
FT   CDS_pept        complement(386289..387500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpr:CPR_1400 4.3e-09 chloride channel protein
FT                   K01529; COG: COG0038 Chloride channel protein EriC; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11568"
FT                   /db_xref="GOA:A8ADK4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR022969"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK4"
FT                   /inference="protein motif:HMMPanther:IPR001807"
FT                   /inference="protein motif:HMMPfam:IPR001807"
FT                   /inference="similar to AA sequence:INSD:AAL21304.1"
FT                   /protein_id="ABV11568.1"
FT                   /translation="MLLLSLPALIIGIASSLVLIAVMKVASVLQRLLWEQIPVGLGIAH
FT                   DSPVWIIGMLTFTGIMVGLVIRYSPGHAGPDPATEPLIGAPMNPVALPGLLIALILGLA
FT                   GGVSLGPEHPIMAVNIALAVAIGARLFPRIGALDWTILASAGTIGALFGTPVAAALIFS
FT                   QTLNSSDDTPLWDRLFAPLMAAAAGSLTTSLFFHPHFSLPIAHYTQMRLSDIFSGAVVA
FT                   AIAIAAGMVAVWCLPRLHSLVHRLKNPVLILGIGGFMLGILGVLGGPLTLFKGLDEMQQ
FT                   LAFSQTLGATDYFMLAIVKLGALVIAAACGFRGGRIFPAVFVGVALGLMLHAHVEAVPA
FT                   AITVSCAILGLMLVVTRDGWLSLFMAAVVVPDTTLLPLLCIVMLPAWLLLAGKPMMAVN
FT                   RHDR"
FT   gene            387472..387612
FT                   /locus_tag="CKO_00410"
FT   CDS_pept        387472..387612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11567"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK5"
FT                   /protein_id="ABV11567.1"
FT                   /translation="MSAGSDNNSIVLARGWSMIYSLILSHMLSLHSLPDGIAANGAETI
FT                   K"
FT   gene            387729..388694
FT                   /locus_tag="CKO_00412"
FT   CDS_pept        387729..388694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00412"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2403 5.7e-161 glk; glucokinase K00845;
FT                   COG: COG0837 Glucokinase; Psort location: Cytoplasmic,
FT                   score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11569"
FT                   /db_xref="GOA:A8ADK6"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADK6"
FT                   /inference="protein motif:HMMPfam:IPR003836"
FT                   /inference="protein motif:HMMTigr:IPR003836"
FT                   /inference="similar to AA sequence:INSD:ABR78154.1"
FT                   /protein_id="ABV11569.1"
FT                   /translation="MTKYALVGDVGGTNARLALCDMTSGEISQAKTYSGLDYPSLEAVV
FT                   RVYLDEHNARVEDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAV
FT                   SMAIPMLRKEHLIQFGGAEPVAGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDF
FT                   APNSEEEGIILEELRAEIGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDITERA
FT                   LADTCIDSRRALSLFCVIMGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGF
FT                   EDKGRFKAYVQDIPVYLIVHDNPGLLGSGAHLRQTLGQIL"
FT   gene            388864..389259
FT                   /locus_tag="CKO_00413"
FT   CDS_pept        388864..389259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c2926 3.9e-50 putative PTS system IIB
FT                   component ypdH K02769; COG: COG1445 Phosphotransferase
FT                   system fructose-specific component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11570"
FT                   /db_xref="GOA:A8ADK7"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK7"
FT                   /inference="protein motif:HMMPfam:IPR003353"
FT                   /inference="protein motif:HMMTigr:IPR003353"
FT                   /inference="similar to AA sequence:REFSEQ:NP_754808.1"
FT                   /protein_id="ABV11570.1"
FT                   /translation="MSDNNAQALTAIISLVNYLEESVMAKKLIAVCACPMGLAHTFMAA
FT                   QALEEAAVEAGYEVKIETLGADGIQNRLTAQDIAEATLIIHSVAVTPEDNERFESRDVY
FT                   EITLQDAIKNAAGIIKEIEEMIAAEQQ"
FT   gene            389280..390527
FT                   /locus_tag="CKO_00414"
FT   CDS_pept        389280..390527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c2925 2.2e-207 putative PTS system IIC
FT                   component ypdG K02770; COG: COG1299 Phosphotransferase
FT                   system, fructose-specific IIC component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11571"
FT                   /db_xref="GOA:A8ADK8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK8"
FT                   /inference="protein motif:HMMPfam:IPR003352"
FT                   /inference="protein motif:HMMTigr:IPR006327"
FT                   /inference="similar to AA sequence:INSD:AAN81375.1"
FT                   /protein_id="ABV11571.1"
FT                   /translation="MAIKKRSATVVHGASGAAAAIKTPPASRNSFWGELPQHVMSGISR
FT                   MVPTLIMGGVILAFSQLIAYSWLKIPADTGIMDALNSGKFDGFNLSLLKFAWLSQSFGG
FT                   VLFGFAIPMFAAFVANSIGGKLAFPAGFIGGLMSTQPTQILNFDPASLQWVTTAPVPST
FT                   FIGALIISIVAGYLVKWMNQKIQLPDFLLAFKTTFLLPILSAIFVMLAMYYVITPFGGW
FT                   INGGIRTLLTAAGEKGTLMYAMGISAATAIDLGGPINKAAGFVAFSFTTDHVLPVTARS
FT                   IAIVIPPIGLGLATILDRRLTGKRLFNAQLYPQGKTAMFLAFMGISEGAIPFALESPIT
FT                   AIPSYMVGAIVGSTTAVWLGAVQWFPESAIWAWPLVSNLGVYMAGIVLGAVITALMVVF
FT                   LRHMMYRRGKLLIESL"
FT   gene            390514..391629
FT                   /locus_tag="CKO_00415"
FT   CDS_pept        390514..391629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2385 8.1e-146 ypdF; putative peptidase
FT                   K08326; COG: COG0006 Xaa-Pro aminopeptidase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11572"
FT                   /db_xref="GOA:A8ADK9"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADK9"
FT                   /inference="protein motif:Gene3D:IPR000994"
FT                   /inference="protein motif:HMMPanther:IPR000994"
FT                   /inference="protein motif:HMMPfam:IPR000994"
FT                   /inference="similar to AA sequence:INSD:EAY49463.1"
FT                   /protein_id="ABV11572.1"
FT                   /translation="MKASEKRTDIMTLRASLRQWLVEQRLDAVLISSRQNKQPHLGISS
FT                   SAGFVFITHKSAHLLVDGRYYADVEARAHGDQLHLLAGSQTLTSIVNQIIDDEQLQVIG
FT                   FEGAQVSWDCAQRWQERLRAKLVSASPDALRQIKTAQEIALIREACRIADCSAEHIRRF
FT                   IRPGLREREIAAELEWFMRQQGAEKASFDTIVASGWRGALPHGKASEKIVAAGEFITLD
FT                   FGAQYQGYCSDMTRTFLVSGQDAPVASHPLFAVYQTVLEAQQTAIAAIRPGVCCQAVDA
FT                   AARRVIEAAGYGDYFGHNTGHAIGIEVHEAPRFSPTDTTRLAAGMLLTVEPGIYLPGQG
FT                   GVRIEDVVLVTEDGAEVLYTMPKTVLLTGEA"
FT   gene            391629..392666
FT                   /locus_tag="CKO_00416"
FT   CDS_pept        391629..392666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00416"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2384 9.0e-163 ypdE; predicted peptidase
FT                   K01269; COG: COG1363 Cellulase M and related proteins;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11573"
FT                   /db_xref="GOA:A8ADL0"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL0"
FT                   /inference="protein motif:HMMPfam:IPR008007"
FT                   /inference="similar to AA sequence:INSD:EAY49462.1"
FT                   /protein_id="ABV11573.1"
FT                   /translation="MDLSLLKALSEADAIASSEQEVRQILLEEADRLHKEVRFDGLGSV
FT                   LIRLNESDGPKVMICAHMDEVGFIVRSISSEGAIDVLPVGNVRMAARQLQPVRITTRED
FT                   SKIPGLLDGERNGNEVGALRVDIGARSYDEVIQAGVRPGDRVTFDSAFQVLPHQRVMGK
FT                   AFDDRLGCYLLIMLLRAWHDAALPAEVWLVASSSEEVGLRGGQTAARAVAPDIAIVLDT
FT                   ACWAKNFDYGAANHRQIGKGPMLVLADKSLIAPPKLTAWVESVASDSGLPLQLDMFSNG
FT                   GTDGGAVHLTGTGTPTVVIGPATRHGHCAASIADCRDIIHTQQLLSALITRLTRETVVH
FT                   LTDFR"
FT   gene            392693..395188
FT                   /locus_tag="CKO_00417"
FT   CDS_pept        392693..395188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S2588 0. putative PTS system enzyme IIA
FT                   component, enzyme I K02766:K02768; COG: COG1762
FT                   Phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11574"
FT                   /db_xref="GOA:A8ADL1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL1"
FT                   /inference="protein motif:BlastProDom:IPR000032"
FT                   /inference="protein motif:BlastProDom:IPR000121"
FT                   /inference="protein motif:BlastProDom:IPR002178"
FT                   /inference="protein motif:Gene3D:IPR000032"
FT                   /inference="protein motif:Gene3D:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR000032"
FT                   /inference="protein motif:HMMPfam:IPR000121"
FT                   /inference="protein motif:HMMPfam:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR008279"
FT                   /inference="protein motif:HMMPfam:IPR008731"
FT                   /inference="protein motif:HMMTigr:IPR004715"
FT                   /inference="protein motif:HMMTigr:IPR006318"
FT                   /inference="protein motif:ScanRegExp:IPR000121"
FT                   /inference="protein motif:superfamily:IPR000032"
FT                   /inference="protein motif:superfamily:IPR008279"
FT                   /inference="protein motif:superfamily:IPR008731"
FT                   /protein_id="ABV11574.1"
FT                   /translation="MLTIQFLCPLPNGLHARPAWELKEQCSQWQSEVTFINHRQNARAD
FT                   AKSSLALIGTGTLFNDSCSLNISGSDEEQARRSLETYLQHRFIDSDSVQPTSAELAAHP
FT                   LPRSLVRLNPDLLYGAVLANGVGAGALTLWQNDNLEAYRAIPASAEDSTRLEHSLATLA
FT                   EQLNQQLRERDGESKTILSAHLSLIQDDEFAGNIRRLMDEQHKGLGAAIIANMEQVCDK
FT                   LSSSASDYLRERVSDIRDISEQLLHITWPERRPRNTLILEQPTILVAEDLTPSQFLSLD
FT                   LQHLSGMILEKTGRTSHTLILARASAIPVLSGLPLDALGRYAGQPAVLDAQCGVLAINP
FT                   NAAVCGYYAIAQQLADKRQQQQAREASLPAFSRDNQRLDIAANIGTALEAPGAFANGAE
FT                   GIGLFRTEMLFMDRDSAPDEQEQFEAYQQVLLAAGEKPVIFRTMDIGGDKNIRYLNIPQ
FT                   EENPFLGYRAVRIYPEFAGLFRTQLRAILRAATFGQAQLMIPMVHSLDQILWVKSELQK
FT                   AIVELKRDGLRHAATIPLGIMVEVPSVCYIIDHFCDEVDFFSIGSNDMTQYLYAVDRNN
FT                   PRVSPLYNPITPSFLRMLQQIVRTAHQHGKWVGICGELGGESRYLPLLLGLELDELSMS
FT                   SPRIPGVKSQLRQMDSQACRALAAQACECRSAEEIETLLNQFAPQKDVRPLLALENIFV
FT                   GESLSNKEQVIQFLCGNLGVNGRTEHPFELEEDVWQREEIVTTAVGFGVAIPHTKSQWI
FT                   RHSSISIARLARPVDWQSEMGEVELVIMLTLGADEGINHVKVFSQLARKLVNKNFRQSL
FT                   FAAQDAESLLALLEAELTF"
FT   gene            complement(395407..396264)
FT                   /locus_tag="CKO_00418"
FT   CDS_pept        complement(395407..396264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bli:BL05281 1.6e-08 adaA;
FT                   methylphosphotriester-DNA alkyltransferase and
FT                   transcriptional regulator (AraC/XylS family) K00567; COG:
FT                   COG2207 AraC-type DNA-binding domain-containing proteins;
FT                   Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11575"
FT                   /db_xref="GOA:A8ADL2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL2"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR000005"
FT                   /inference="protein motif:HMMSmart:IPR000005"
FT                   /inference="protein motif:ScanRegExp:IPR000005"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="protein motif:superfamily:IPR011051"
FT                   /inference="similar to AA sequence:INSD:CAJ31227.1"
FT                   /protein_id="ABV11575.1"
FT                   /translation="MKEPGLPADQQFFADLFSGLVLNPQRLGRVWFATQHTALPTGSLC
FT                   IDLPRLDIVLRGEYGNLLEKKQHALTEGEMLFIPARAANLPGSDKPVMLLSLVFAPAWL
FT                   GLSFYDNRTASLLRPVRRIELAHQQRGEGEAMLTALTHLSRSPQAQDIIQPLVLSLLHL
FT                   CRSVVNTRPDSRRPRSEFLYHSMCNWVQDNYARPLTRESVAQFFNITPNHLSKLFTQHG
FT                   TMSFVEYVRWVRMAKARIILQKYHLSISEVAERCGYHDSDYFCRLFRRQFGLTPGEYSA
FT                   RFQG"
FT   gene            complement(396279..397013)
FT                   /locus_tag="CKO_00419"
FT   CDS_pept        complement(396279..397013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0376 1.2e-18 transcriptional
FT                   regulator, LytR/AlgR family K07705; COG: COG3279 Response
FT                   regulator of the LytR/AlgR family; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11576"
FT                   /db_xref="GOA:A8ADL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL3"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR007492"
FT                   /inference="protein motif:HMMPIR:IPR008246"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:INSD:ABF04548.1"
FT                   /protein_id="ABV11576.1"
FT                   /translation="MKVIIVEDEFLAQQELSWLIKEHSQMEIVGTFDDGLDVLKFLQHN
FT                   RVDAIFLDINIPSLDGVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQ
FT                   ESRIVGMLQKLEAAWQQQQVVAVPGSPVARENDTINLIKDERIIVTPINDIYYAEAHEK
FT                   MTFVYTRRESYVMPMNITEFCSKLPASHFFRCHRSFCVNLNKIREIEPWFNNTYILRLK
FT                   DLEFEIPVSRSKVKEFRQLMHL"
FT   gene            complement(397028..398707)
FT                   /locus_tag="CKO_00420"
FT   CDS_pept        complement(397028..398707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z3645 5.3e-284 putative sensor protein
FT                   K07704; COG: COG3275 Putative regulator of cell autolysis;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11577"
FT                   /db_xref="GOA:A8ADL4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL4"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003018"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR010559"
FT                   /inference="protein motif:HMMPfam:IPR011620"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00923211.1"
FT                   /protein_id="ABV11577.1"
FT                   /translation="MLLAVFDRAALMLFCLFFLIRIRLFRELLHKSAHSPKELLAVTAI
FT                   FSMFALFSTWSGVPVEGSLVNVRIIAVMSGGILFGPWVGIITGVIAGIHRYLIDIGGVT
FT                   AVPCFITSILAGCIAGWINRKIPKAQHWRVGILGGMLCETLTMILVIVWAPTIALGVDI
FT                   VSKIGIPMILGSVCIGFIVLLVQSVEGEKEASAARQAKLALDIANKTLPLFRQVNSESL
FT                   RQVCEIIRHDIHADAVAITNTEHVLAYVGVGETNYRNNDDFVSPTTQQAINYGKIIIKN
FT                   NDEAHRTPEIHSMLVIPLWEKGVVTGTLKIYYCHAHQITSSLQEMAIGLSQIISTQLEV
FT                   SRAEQLREMANKAELRALQSKINPHFLFNALNAISSSIRLNPDTARQLIFNLSRYLRYN
FT                   IELKDDEQIDIKKELYQIKDYIAIEQARFGDKLTVIYDIDEEVNCYIPNLLIQPLVENA
FT                   IVHGIQPCKGKGVVTISVAECGNRVRIAVRDTGHGIDPKVIERMKANEMPGNKIGLLNV
FT                   HHRVKLLYGEGLHIRRLEPGTEIAFYVPNQRSPAAAPATLLL"
FT   gene            399115..400353
FT                   /locus_tag="CKO_00421"
FT   CDS_pept        399115..400353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2379 2.5e-215 yfdZ; putative
FT                   PLP-dependent aminotransferase; COG: COG0436
FT                   Aspartate/tyrosine/aromatic aminotransferase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11578"
FT                   /db_xref="GOA:A8ADL5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL5"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="similar to AA sequence:INSD:EAY49457.1"
FT                   /protein_id="ABV11578.1"
FT                   /translation="MADTRPERRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGN
FT                   PDGATPPHIVEKLCTVAQRPDTHGYSTSRGIPRLRRAISRWYQERYDVDIDPETEAIVT
FT                   IGSKEGLAHLMLATLDHGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELER
FT                   AIRESYPKPKMMILGFPSNPTAQCVELEFFEKVVALAKRYDVLVVHDLAYADIVYDGWK
FT                   APSIMQVPGARDVAVEFFTLSKSYNMAGWRIGFMVGNQTLVSALSRIKSYHDYGTFTPL
FT                   QVAAIAALEGDQQCVRDIAEQYKRRRDVLVKGLHEAGWMVEMPKASMYVWAKIPEQYAA
FT                   MGSLEFAKKLLNDAKVCVSPGIGFGDYGDTHVRFALIENRDRIRQAIRGIKTMFRADGL
FT                   LPAGAKSVTEGTE"
FT   gene            complement(400856..401776)
FT                   /locus_tag="CKO_00422"
FT   CDS_pept        complement(400856..401776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00422"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2404 6.8e-149 putative acyltransferase
FT                   K00680; COG: COG1560 Lauroyl/myristoyl acyltransferase;
FT                   Psort location: CytoplasmicMembrane, score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11579"
FT                   /db_xref="GOA:A8ADL6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="InterPro:IPR030857"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL6"
FT                   /inference="protein motif:HMMPfam:IPR004960"
FT                   /inference="protein motif:HMMTigr:IPR011920"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456943.1"
FT                   /protein_id="ABV11579.1"
FT                   /translation="MFPQCKFSRALLHPRYWLTWFGLTVLWLLVLLPYPVLRFLGTRTG
FT                   RLARPFLKRRESIARKNLELCFPNLTPEEREKMIVENFHSLGMALIETGMAWFWPDKRV
FT                   RKWFDVDGLDNLTQAQAQKRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNSLMEW
FT                   VQTRGRMRSNKAMIGRNNLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVKDVATT
FT                   NGTYVLSRLSGAAMLTVTMIRKGDNSGYRLYITPEMEGYPEEENQAAAYMNKIIEKEIM
FT                   RAPEQYLWIHRRFKTRPLGEASLYV"
FT   gene            complement(401979..402134)
FT                   /locus_tag="CKO_00423"
FT   CDS_pept        complement(401979..402134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11580"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL7"
FT                   /protein_id="ABV11580.1"
FT                   /translation="MLSHSEASDSDRLTGQKRLFRENEHVHTHKKPFKNNKLITKPPPS
FT                   KNIYAS"
FT   gene            402288..402443
FT                   /locus_tag="CKO_00424"
FT   CDS_pept        402288..402443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11581"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL8"
FT                   /protein_id="ABV11581.1"
FT                   /translation="MFRLPHQINLFHLKKTIINIKNISQVINYTYINHVVKKEISVFSM
FT                   IFIFLH"
FT   gene            complement(402297..402440)
FT                   /locus_tag="CKO_00425"
FT   CDS_pept        complement(402297..402440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11582"
FT                   /db_xref="GOA:A8ADL9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADL9"
FT                   /protein_id="ABV11582.1"
FT                   /translation="MQENKNHRKNRYFLFNHMIYIGIINYLTYIFYVYYCFFKVEKIYL
FT                   MG"
FT   gene            402695..409654
FT                   /locus_tag="CKO_00426"
FT   CDS_pept        402695..409654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bme:BMEII0148 2.6e-74 extracellular serine
FT                   protease; COG: COG3468 Type V secretory pathway, adhesin
FT                   AidA"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11583"
FT                   /db_xref="GOA:A8ADM0"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM0"
FT                   /inference="protein motif:HMMPfam:IPR004899"
FT                   /inference="protein motif:HMMPfam:IPR005546"
FT                   /inference="protein motif:HMMTigr:IPR006315"
FT                   /inference="protein motif:HMMTigr:IPR013425"
FT                   /inference="protein motif:superfamily:IPR011050"
FT                   /protein_id="ABV11583.1"
FT                   /translation="MNKVFKVIWNSRLNIFVVASELARGYCKSTAGNTSFGSLLKYPLM
FT                   SALAVSISCILTTGTFAADLQVYDFSPQDPFEEIISGSTHLTGGFSGIQRGETGYTWTT
FT                   LGQAREDGLITGDSGQWVDKDIFRMGSQTKSINYTDPVTGSTVTMKVYDNNDMQTEAAK
FT                   DFRVVVSQPVGKDGQYVDRNLYQVGAGASLDVDVGQKTGNWVGAADNQFNVIMKSSVNT
FT                   QNLSSAYHVTNGGSLNYQSKTVVQLGNSDNNIKDASNALAWMTAADFVGEFDSVIGKQN
FT                   ITNIDEFKAYNDALIQALQDGQIQLTEAQYADELNKARDTSLHGIFADTGSIAADDAIR
FT                   AFVNRDAVSYIHGVGSGTNVVIDKDANIQLVGSDATVVNLENGARLTNNGTLGTAGNTY
FT                   RGAYIIAARNTSFVDNNGVIDAGTNPEMADFFSSGAAGVAQGAHTAILANGSSVINNNS
FT                   SGVINVAARGNYYGNTGVLMSGNATLNNDGAINIAASNEANSILGNGANIGVVTQQNTT
FT                   FNNRGTLYIGRLAQRAPDDANTDIAIKQQSIGVHLYGNGTYNGSDTSQIIIGSKVQNAT
FT                   AIDVGGNATLDQKGSININGAVTGESVSSNIGIIARAGTQAAKVVHDGIINLNGLNSTG
FT                   IQVLENGQITSSGTININGGLDPVTHYANYGIYVQGEKALAILSGTVNLSGDGAIGVHA
FT                   RDKGEIDVTENGTVNFKDGVNQTGYYIFGAGSTIKNAASSVQDASTQNATLYRVDGGAS
FT                   FYGSADSSAQLNASGDGATIIRTTGAGSHFDSGKLALSVTGTGATGIRIEGGATGEITS
FT                   DAVIVRVAGKDTTAGIVDGNYYNLDGSVNDAQKGDSVLTSYAVLETANTADGAFGYIAR
FT                   NGGRLIHEGSIDFTADNSTGILVDGGILENHSDVTVNGVAVNIQGANSEVTNSGVVTAT
FT                   DGQAAYLVGNNATLALNGNGETRAAGTAHGILLDTGAKGLTVDGATITMDSAGSGNAIE
FT                   NKAAISGIQLKNTTINVGNGVGVHTGASMAQTNSGTININGSGTGILFENVADGSDTDQ
FT                   TLDMSDSRDLVINVNGAQGNGIITRASTDLKTGASVNVLDSDGKSALVVQGTTKNVEQS
FT                   GKLISVSDKAAVVDLNNGVLESFINKGDILALDASHTALEMNSGNGITFTNASGANIVG
FT                   QVNLLNGDNTVILESGSTATDITSGSGKDNFILKNIRENESGSLFTSLNGGSGDDTLQL
FT                   ENSSYTLTRADAINGMEHIALANNSVFTLDNVALGLGDDELDGAGTGYTIDGSSQLSIK
FT                   NTADVTFKSHLAGTGVVAVDTANNHFNFDANNAADGFAGTLALTNSRFELDGLNSQALS
FT                   NATLQAGNGSITHVGSGEQNIGGLDFKGGTVQFDGVTPGNPTALGTIHAGAMDLSGRGT
FT                   VQVDSGTVSNDRPQADTHRPILEQDDAQALIKLATSDTAVQGGAGNLVLKDKDGNVISD
FT                   SITADIAQNGAVVAKGTYDYRLTGGDSDDGLYVSYGLTQVDLLGKDADALILDANGKSG
FT                   NAADLSARVTGSGDLAFDSQKGQTVTLSNMDNDYSGVTDVRSGNLAMLNDNVLGNTREL
FT                   KLAGDTGFDMRGHSQTIGKLTAESGSLTDLNGGHLTLTNGGEASGVLTGDGELTVAGGT
FT                   LNVSGANTGLKATTTIAQGATAVLDNTLGLGTGDIVAAGLLNLSNATGVLYNSISDAGK
FT                   VALDASDVVLAGNNSHFAGTFDIDNDSTLTASSAQQLGTSAIQNAGKFVLNTHESWSLE
FT                   NGVTGSGSVVKNGSGNVTLSDSAQWTGATDINAGGLTLGSADNAFTLASHQVNIGKDGR
FT                   LSGFGGVAGNMANQGTLLIGDDVSAARRAASSPVSFTVGGNLTNSGDIWTGSKGKDAGN
FT                   QLVVNGNYQGDGGHLHLNTALNDDNSVTDKLIVKGNTSGTTGVSVTNAGGSGAQTINGI
FT                   EVIHVDGQSDGEFTQDGRIVAGAYDYSLARGQGDNNGNWYLTSHKTDPNPGPGPKPEPD
FT                   IRPEPGSWTANLAAANTLFVTRLHDRLGETQYIDALTGEKKVTSMWMRQAGGHNAWRDS
FT                   SGQLKTQSNRYVMQVGGDVARWSGDGLDRWHLGVMAGYGHNSSNTRSSSTGYRSDGSVN
FT                   GYSAGVYATWYANDETHQGAYLDSWAQYSWFNNSVKGQDIQSESYKSKGITGSLELGYT
FT                   HKLGEFAGSKGSKNEWFIQPQAQAIWMGVEADDHRESNGTRISGEGDGNVQTRLGVRTF
FT                   LKGHSAIDEGKAREFQPFVEVNWLHNTRDFGTKMDGVSIRQEGARNLGEIKTGVEGQIN
FT                   QQLNVWGNVGVQLGDKGYNDTSAMIGIKYNFK"
FT   gene            409752..410333
FT                   /locus_tag="CKO_00427"
FT   CDS_pept        409752..410333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11584"
FT                   /db_xref="GOA:A8ADM1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM1"
FT                   /inference="protein motif:BlastProDom:IPR000792"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000792"
FT                   /inference="protein motif:HMMSmart:IPR000792"
FT                   /protein_id="ABV11584.1"
FT                   /translation="MIVISENSFFHLGVSALVERMALNTTRNLIVFDTGRDCLYMLDTE
FT                   EAKMPFFHEPILIFSHCRRIYLTEKNRKFKIETLLSKTKSHPAVRRKREVLTVSELRVI
FT                   KKVCQGISQRRIAEQFKVSEKTISNQKMNALRKLSINKTTKFFVEYLAWLRLWHEYVEY
FT                   KNNQMRKPVKLSVITPETFTKRQSEVLIEV"
FT   gene            410396..411907
FT                   /locus_tag="CKO_00428"
FT   CDS_pept        410396..411907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0494 7.5e-10 sensory transduction
FT                   protein kinase; COG: COG2200 FOG: EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11585"
FT                   /db_xref="GOA:A8ADM2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM2"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /inference="similar to AA sequence:REFSEQ:NP_707066.2"
FT                   /protein_id="ABV11585.1"
FT                   /translation="MKQHAGGLVGNKLVFVIVFLTITITGMVTFWLGASSRVDNDKRAL
FT                   IQRVDSLLFEAKQISDSLTAHLTERCSDETVRMLTKQIHRYPHIGGIFLLQDSQVYCSS
FT                   GMARPELSNLTAGENGNRLFLVDETPAFRGEPVLAYVTVRGNNAIVVTISTYWFKSLLA
FT                   DSRLLVNVNGNILSDDKLISTNSIDFQNSAWQQSNMFDYQVMEYPEHTGIASVLNFIFI
FT                   LFLSAAIAVPAAFLFNYTLQRIAMSRYIQLRRGLRKQQFVPYYEPVMNCASGALYGAEV
FT                   VMRWKKGNDTSVINEEIISLANKTGMISPLVNFILRQVEKDILSLRLRLPRTFYINFRL
FT                   SESMIAMPELIDSFVEFQKRLPSDVKLTLEFPEVVYRDTTLEFDSVLRRLRVEGIKIKM
FT                   SSLFLERLNADRNLYLPVDAVRIEKSITGLISDSKEPVASVDDIIRSAVNKNYTIIADG
FT                   IENDQQYHYLSLRGVVLQQGNYWSMPLSSFHLMQYIIQSDKVLLC"
FT   gene            complement(412098..412532)
FT                   /locus_tag="CKO_00429"
FT   CDS_pept        complement(412098..412532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00429"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2259 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11586"
FT                   /db_xref="GOA:A8ADM3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM3"
FT                   /inference="protein motif:BlastProDom:IPR011592"
FT                   /inference="protein motif:HMMPfam:IPR011637"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01578924.1"
FT                   /protein_id="ABV11586.1"
FT                   /translation="MTFSQRLTHAVRPLIGAAVCRWLAYLGLCAAYLQGGINKLLDFQG
FT                   AIGEMNHFGLSPAPLFAALVIALELGASIMILTGCLRWLASLALAGFTLVATFLALRFW
FT                   ELPAGMERFSTANAFFEHLGLVGGFLLVAWLDVQKKMADE"
FT   gene            complement(412547..414442)
FT                   /locus_tag="CKO_00430"
FT   CDS_pept        complement(412547..414442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC3411 1.3e-12 metal dependent
FT                   amidohydrolase superfamily protein
FT                   K01443:K01427:K01465:K01486; COG: COG1574 Predicted
FT                   metal-dependent hydrolase with the TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11587"
FT                   /db_xref="GOA:A8ADM4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM4"
FT                   /inference="protein motif:HMMPfam:IPR013108"
FT                   /inference="protein motif:superfamily:IPR011059"
FT                   /protein_id="ABV11587.1"
FT                   /translation="MTQHVVADVILHHGLFTTLDKSNPTASAVAVKDGKFLAVGGDAEI
FT                   MAFAGPATKVVDLKGKRVLPGLIDNHTHVVRGGLNYNMELRWDGVRSLADAMDMLRRQV
FT                   AITPAPQWVRVVGGFTEHQFVEKRLPTIEEINAIAPDTPVFLLHLYDRALLNAAALRAV
FT                   GYTKETPEPPGGEITRDAKGNPTGLLLARPNAGILYATLAKGPKLPFDYQVNSTRHFMR
FT                   ELNRLGVTGVIDAGGGFQNYPDDYAVIQKLADENLMTVRLAYNLFTQKPQEEKEDFLNW
FT                   TRSVTYKQGNDYFRHNGAGEMLVFSAADFEDFRQPRPDMPPEMEGELEEVVRILAENRW
FT                   PWRLHATYDETISRALDVFEKVNQDIPLEGINWFFDHAETISERSIDRIAALGGGIAVQ
FT                   HRMAYQGEYFVERYGAGAAEATPPIARMLEKGVKVSAGTDATRVASYNPWVSLAWMITG
FT                   KTVGGMQLYPRRNCLDRETALRMWTENVTWFSNEEGKKGRIQAGQFADLIVPDKDFFAC
FT                   AEDEISFLSSELTMVGGKIVWGAGPFESLDDNPVPPAMPDWSPTRTFKGYAAWGEPEGA
FT                   GKNSLAVRQMAMASCGCSHGCGLHGHDHAGAWTSSLPVSDLKGFFGALGCSCWAV"
FT   gene            complement(414439..414717)
FT                   /locus_tag="CKO_00431"
FT   CDS_pept        complement(414439..414717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00431"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4317 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11588"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM5"
FT                   /inference="protein motif:HMMPfam:IPR009872"
FT                   /inference="similar to AA sequence:INSD:EAZ53119.1"
FT                   /protein_id="ABV11588.1"
FT                   /translation="MKMYILSLGAGLLVGIIYSLLNVRSPAPPLIALLGLLGMLVGEQV
FT                   IPVGKQLLSGTAFSSACTKTHAISHIFGQLPGRQAAEDSHSSEEKRS"
FT   gene            complement(414783..415463)
FT                   /locus_tag="CKO_00432"
FT   CDS_pept        complement(414783..415463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0343 2.4e-89 hydrolase K01463; COG:
FT                   COG1335 Amidases related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11589"
FT                   /db_xref="GOA:A8ADM6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM6"
FT                   /inference="protein motif:Gene3D:IPR000868"
FT                   /inference="protein motif:HMMPfam:IPR000868"
FT                   /inference="protein motif:superfamily:IPR000868"
FT                   /inference="similar to AA sequence:INSD:EAZ53120.1"
FT                   /protein_id="ABV11589.1"
FT                   /translation="MSHYLDVLTPQNSQLIFIDQQPQMAFGVQSIDRQVLKNNVVGLAK
FT                   AAKLFNIPTTITTVETESFSGNTYPELLAVFPENNILERTSMNSWDDQNVRDALAANGR
FT                   KKVIVSGLWTEVCNTTFALCAVKDADYQIYMVVDASGGTSVDAHKYAIDRMVQAGIVPV
FT                   TWQQVILEWQRDWARKETYNGIMDIVREHSGAYGMGVDYAYTMVHKAPERVQHGERIGP
FT                   NPAK"
FT   gene            415533..415703
FT                   /locus_tag="CKO_00433"
FT   CDS_pept        415533..415703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11590"
FT                   /db_xref="GOA:A8ADM7"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM7"
FT                   /protein_id="ABV11590.1"
FT                   /translation="MPCYSFLTFNIFPSHLFHVTVYVLSAMFVPYPRTLPFYLLSIRHL
FT                   INDRGISLPSF"
FT   gene            415989..416891
FT                   /locus_tag="CKO_00434"
FT   CDS_pept        415989..416891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 3.5e-11 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11591"
FT                   /db_xref="GOA:A8ADM8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM8"
FT                   /inference="protein motif:Gene3D:IPR011991"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01570694.1"
FT                   /protein_id="ABV11591.1"
FT                   /translation="MHLEDIRIFVTIVNMGSFTAAAEHLSLSKQFVSRRMAALEKKVSA
FT                   RLLVRNTRKLSVTDTGQAFFHHARRILEEVHEAEQVISARQQKLAGSFRISLPMTYGIR
FT                   RLAPLIVEFQAAHPELTVHIDMNDRYVDVVGEGYDMVLRIGNLMDSTLIARCLGKLPMV
FT                   ICASPDYLRLHGTPLAPSELAQHSCLLYGREGQFGWKLTEENSPNTYAVRGNLSSNNGD
FT                   VIREAAEAGAGIALLPLFIVEDSLQQGALVQILSDYSPPPLTISALYPKHRQRSAVTRI
FT                   LLPFLAERIAGIVDPIKKT"
FT   gene            417627..418628
FT                   /locus_tag="CKO_00435"
FT   CDS_pept        417627..418628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C1638 1.5e-137 glyceraldehyde
FT                   3-phosphate dehydrogenase A K00134; COG: COG0057
FT                   Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11592"
FT                   /db_xref="GOA:A8ADM9"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADM9"
FT                   /inference="protein motif:HMMPanther:IPR000173"
FT                   /inference="protein motif:HMMPfam:IPR000173"
FT                   /inference="protein motif:HMMTigr:IPR006424"
FT                   /inference="protein motif:ScanRegExp:IPR000173"
FT                   /inference="similar to AA sequence:INSD:ABJ00867.1"
FT                   /protein_id="ABV11592.1"
FT                   /translation="MKRIGINGFGRIGRLVLRRILETELNVEIVAINDLTSPDVLAYLL
FT                   KYDSNYGPFNGTVSHADGSIIVNGKVIKVFAEKNAGDIPWGSLGIDVVVECTGFYTSAE
FT                   KANAHIEAGAKKVLISAPAGDMKTIVYHVNDETLTSADNIISVASCTTNCLAPVAKALN
FT                   DAFGINVGTMTTVHAYTGTQALVDGPRGKDFRASRAAAENIIPHTTGAAKAIGLVIPEL
FT                   NGKLKGHAQRIPVKTGSVTELVTVLNKTVTVEEVNNALRNATVDNESFGYTDEPIVSSD
FT                   IIGIHFGSVFDATQTEVTEFDGVQLVKTVAWYDNEYGFVTQLVRVLKKYISL"
FT   gene            418659..418844
FT                   /locus_tag="CKO_00436"
FT   CDS_pept        418659..418844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11593"
FT                   /db_xref="GOA:A8ADN0"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN0"
FT                   /protein_id="ABV11593.1"
FT                   /translation="MRGFLNDDINLGYVRFLLLMCAVVQVMKTANMASYCVRKGTGQER
FT                   NSRHDKRDIFYTAEWK"
FT   gene            419013..421556
FT                   /locus_tag="CKO_00437"
FT   CDS_pept        419013..421556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C1702 2.7e-177 hypothetical protein;
FT                   COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11594"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN1"
FT                   /inference="protein motif:HMMPfam:IPR000160"
FT                   /inference="protein motif:HMMPfam:IPR001633"
FT                   /inference="protein motif:HMMPfam:IPR003018"
FT                   /inference="protein motif:HMMPfam:IPR013767"
FT                   /inference="protein motif:HMMPIR:IPR012226"
FT                   /inference="protein motif:HMMSmart:IPR000014"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMSmart:IPR001633"
FT                   /inference="protein motif:HMMTigr:IPR000014"
FT                   /inference="protein motif:HMMTigr:IPR000160"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00419846.1"
FT                   /protein_id="ABV11594.1"
FT                   /translation="MKAAADNILFPALEQTFMAVVLVDECNRVLFFNEAAEKLWGYSRD
FT                   EVLGRDMNILIPGPLKHVHGDYVHHHRDGGNSRVVGMNRELQLERKDGTQVWTSFSLSK
FT                   IDVDGRIHYMAAARDVSKEVARREQNRLLLLAVNNTDRAVVVLDEQRRIVQTNRAFTSM
FT                   FGYGADEAMNQVFPDFLLSSGNSDDALKRVEEHLRGSRWFQEELLTATRNGREVWSRVS
FT                   VNPVLNERDHRQTRNLVVTFVDITEERNIRNLERDVLAALTSRMTFQETGDYICQRIGN
FT                   IAPGVLVSVCRIVDNRMRPWAAPGFPKEYGEYWDGVAVGEGVASCGTCAARGEPVMVQD
FT                   ISTDPLWAPYKHQMLPHGFRACWTYPVKRRDGSVAGTFAFYFRTQNEPDTFLVRIADAS
FT                   VHLCALAIEREEGRQQIDRLVRFDALTGLPNRQYLYHHLDKLLSGNEPELAVFFLDINR
FT                   FRKVNESLGYSAGDQVIITLANRLQERFGPHHFISRVGGAQFVVVASACRVDEASHLAE
FT                   LMQHIVGAEMSAAGQTFELKACIGISHSIGGDRETLLAHAESAMERVRESGGSYQFFNP
FT                   ELNQAVMQRLKLGMALRNAITEGHLRLEYQPQIRAADGQVYGFEALTRWHDPHAGDISP
FT                   GTFIPLAEETGEIEHIGLWALREVCRQLFEWRKKGTNVSAVSVNLSAHNFRKPDLPRYI
FT                   ADLLNEYQLPGNILTIEITESAMMELTDEMLARVREIRAMGAGVSMDDFGTGFSSLASL
FT                   AYLPVTEVKIDKSFIDRFARDRRVNALVEAVVSIGHNLDLTVVAEGVENTHQHQQLRKM
FT                   GCSVLQGFLFSRPLSANTLPVWLEAYRSPLQDAQS"
FT   gene            421553..423115
FT                   /locus_tag="CKO_00438"
FT   CDS_pept        421553..423115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:sll1687 1.4e-24 hik17; hypothetical
FT                   protein; COG: COG2199 FOG: GGDEF domain; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11595"
FT                   /db_xref="GOA:A8ADN2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN2"
FT                   /inference="protein motif:HMMPfam:IPR000160"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMSmart:IPR000160"
FT                   /inference="protein motif:HMMTigr:IPR000160"
FT                   /inference="similar to AA sequence:INSD:EAV17689.1"
FT                   /protein_id="ABV11595.1"
FT                   /translation="MKKKLLQMLNLRLLIIAFAFLMTLLTLFNSFYSAWRVQKQVLIEN
FT                   ELSENQAYAERIASTIDLYLAVFMERLEYSASVIGQHFDDESIISGEMMRMQRRDFGFD
FT                   SVTLVDEKGKIIGVLPESLNLKGKMLTTPGGVEALKEMQPTVSSAYNSLSGNLVVYISH
FT                   PVRNAQGKYLGFIGGAIYLQRSNVLSALISNHFRNDDSYIYVVDKNDQLLYHPDPARRG
FT                   EKEEGNAAVKAVEQGLSGAMEVTNSRGVEMLAGYASINTSGWGVVAQKPKDKTLTALDG
FT                   LMWQMIRGVVPLGIVGLFILWWLGNEIVRPLRQLADHAISMDSDESAEKVRNVRSWYIE
FT                   ASRLRRALLQGMELIREKMKWLNDQASTDPLTGLVNRRAAEKLLAEYEHQQRQFAVISL
FT                   DIDRFKAVNDTFGHDIGDVTLKALAQLLKRSCRKNDTACRMGGEEFMMFFPETSVEAAA
FT                   DIAERLRKEVAAAKIETVGHITISLGVTVWPSGVDSVSQALKRADELMYQAKQAGRNQV
FT                   VAG"
FT   gene            complement(423158..424585)
FT                   /locus_tag="CKO_00439"
FT   CDS_pept        complement(423158..424585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syn:slr1608 2.4e-36 gdhB; putative glucose
FT                   dehydrogenase-B, periplasmic protein K00117; COG: COG2133
FT                   Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11596"
FT                   /db_xref="GOA:A8ADN3"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="InterPro:IPR019893"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN3"
FT                   /inference="protein motif:HMMPfam:IPR012938"
FT                   /inference="protein motif:superfamily:IPR011041"
FT                   /inference="similar to AA sequence:INSD:BAE20149.1"
FT                   /protein_id="ABV11596.1"
FT                   /translation="MMNNKIKRISQAVTLALAMSGVSYAATSSQAANSKQTEIQASEPF
FT                   SAHVLISGLDAPWDMVWGPDDYLWVTERKAASIDRINPKTGEKKVAITLSGVHTGPQHE
FT                   GVLGLALSPSFMKPGGDNYVYTAYTYMNGDKEHAKIVRLEYDEKTQTLGNEKEILAGFP
FT                   AGNDHNGGRLRFGPDGKLYYTIGEQGHNQGANFCKPIEAQRIPTEDELKNKDYAAYAGK
FT                   VLRLNTDGSIPDDNPVIKGIKSHLFTYGHRNPQGLVFIGDTLYASEQGPSSDDELNILE
FT                   PGGNYGWPHVAGFQDDQAYVYANYSEAANCPSLTWDPNHIPAGVPVQKETEWKAADFKA
FT                   PIKTFFTVKEGFTYNDASCGPDSSYICWPTIAPSSVAYYPENGVIKGWRNSVIISSMKN
FT                   GALYRVLLNADKKDVQGDVAKYFHTANRYRMVLVSPDTRKIYVATDNFGNVMDESNHPT
FT                   HNLSNPGSIIVFEYTGK"
FT   gene            complement(425097..425234)
FT                   /locus_tag="CKO_00440"
FT   CDS_pept        complement(425097..425234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11597"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN4"
FT                   /protein_id="ABV11597.1"
FT                   /translation="MLMNVVLPYKYALQLKMTGNHLLVTGINDIVIKIQNRKIRFMGNI
FT                   "
FT   gene            425264..426814
FT                   /locus_tag="CKO_00441"
FT   CDS_pept        425264..426814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1971 3.6e-14 dTMP kinase K00943; COG:
FT                   COG0477 Permeases of the major facilitator superfamily;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11598"
FT                   /db_xref="GOA:A8ADN5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN5"
FT                   /inference="protein motif:HMMPfam:IPR010290"
FT                   /inference="similar to AA sequence:REFSEQ:YP_297089.1"
FT                   /protein_id="ABV11598.1"
FT                   /translation="MLWIATLFSNIGTWMNDVGAGWLMTNLSPDPVMIAAIQAMTTLPV
FT                   FLLALPAGAIADIFDKRKLLILVNIMMLCAASLLAIIVYFNVVSIGWLLFITFILGSGA
FT                   AFLGPAWQAIVPAIVEPHELKSGIALNSMGINISRAIGPALAGILISQVGLYLPFLLNA
FT                   LSFIAIIAAVWWWKGEEKTNGSLPAESVVAAMVSGLRYARYSPELMRTIIKAASFFVFA
FT                   SAYWAMLPLVVRLSLQGDATLYGVLTTSIGIGAVCGAFSLPALRKRLSAGALITSGTFG
FT                   TAAVLLIFAGAASQYAAIFASIVAGFSWIITLSTLMISAQTALPDWVRARGLALYLTVF
FT                   SGSMAFGSLVWGQIASHTSVTTALLSAAIGIVVVWLCVLKVKIDHDNINLQHSDHFSLA
FT                   EDGLNDITGHTGPMLVSVYYHVDAEKNGQFISLMKKLKNIRLRDGGYAWGLFVVPEKSN
FT                   EFIETFMVSSLAEHLRQHDRATVDDRQIQQQLDDIILDKKATHYFSASVAESFVIQEE"
FT   gene            complement(426990..427061)
FT                   /locus_tag="CKO_00442"
FT   tRNA            complement(426990..427061)
FT                   /locus_tag="CKO_00442"
FT                   /product="tRNA-Arg"
FT   gene            complement(427137..428069)
FT                   /locus_tag="CKO_00443"
FT   CDS_pept        complement(427137..428069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_4690 4.6e-10 formate transporter
FT                   K00122; COG: COG2116 Formate/nitrite family of
FT                   transporters; Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11599"
FT                   /db_xref="GOA:A8ADN6"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN6"
FT                   /inference="similar to AA sequence:INSD:CAD07625.1"
FT                   /protein_id="ABV11599.1"
FT                   /translation="MDKFSEEKIDQHSDELEVESEEKQRGKKIEVDEDRLPSRAMAIHE
FT                   HIRQDGEKELERDAMALLWSAIAAGLSMGASLLAKGIFHVQLDGVPGSFLLENLGYTFG
FT                   FIIVIMARQQLFTENTVTAVLPVMQNPTMGNAGLLMRLWSVVLLGNVVGTGIAAWAFEY
FT                   MPIFDEETRDAFVKIGMDVMKNSPGEMFANAIISGWIIATMVWMFPAAGAAKIVVIILM
FT                   TWLIALADTTHIVVGSVEILYLVFNGTLHWSDFFWPFALPTLAGNICGGTFIFALMSHA
FT                   QIRNDMSARRKEEARLRAGKKAEKQKKQS"
FT   gene            complement(427982..428152)
FT                   /locus_tag="CKO_00444"
FT   CDS_pept        complement(427982..428152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11600"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN7"
FT                   /protein_id="ABV11600.1"
FT                   /translation="MRFQSLPCLQSDKSHYALDKCVHHEVSQWINSAKRKLINTVTNSK
FT                   SKAKKNNAGKR"
FT   gene            428262..429113
FT                   /locus_tag="CKO_00445"
FT   CDS_pept        428262..429113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00445"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2853 Surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11601"
FT                   /db_xref="GOA:A8ADN8"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN8"
FT                   /inference="protein motif:HMMPfam:IPR007428"
FT                   /inference="similar to AA sequence:INSD:AAV76474.1"
FT                   /protein_id="ABV11601.1"
FT                   /translation="MLLQSLTPKQADTVSFRHGWQSAIAIINRETFMKLRLSALALGST
FT                   LLVGCASSGTEQQGRSDPLEGFNRTMYNFNFNVLDPYVVRPVAVAWRDYVPQPARNGLS
FT                   NFTSNLEEPAIMVNYFLQGDPYQGMVHFTRFFLNSILGMGGFIDVAGMANPKLQRVEPH
FT                   RFGSTLGHYGVGYGPYVQLPFYGSFTLREDGGDMADTLYPVLSWLTWPMSIGKWTIEGI
FT                   ETRAQLLDSDGLLRQSSDPYILVREAYFQRHDFIANGGKLKPQENPNAQAIQDDLKEID
FT                   SE"
FT   gene            complement(429176..430531)
FT                   /locus_tag="CKO_00446"
FT   CDS_pept        complement(429176..430531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00446"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2067 Long-chain fatty acid transport
FT                   protein; Psort location: OuterMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11602"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADN9"
FT                   /inference="protein motif:HMMPfam:IPR005017"
FT                   /inference="similar to AA sequence:INSD:CAE55848.1"
FT                   /protein_id="ABV11602.1"
FT                   /translation="MVMSQKTLFTKSALAVAVAIVSTQAWSAGFQLNEFSSSGLGRAYS
FT                   GEGAIADDAGNVSRNPALIMMFDRPTFSAGAVYIDPDVNVTGRSNLTGQNANANNIAPT
FT                   AWVPNLHFVAPINDQFGWGASITSNYGLATEFNKDYSAGIYGGKTDLQTVNLNLSGAYR
FT                   LNNSWSFGVGFDAVYAKAKIERYAGSLGPVLSQQLVGQGVPSQWTDGINSPDSQIAHLK
FT                   GDEWGFGWNAGILYELDKDNRWGLTYRSEVKIDFEGDYKSSINPNLNNIFASMGLSSLP
FT                   YGTGGATQNGSLTLNLPEMWEISGYNRVAPQWAIHYSLTYTSWSQFQELKAKGDDGQTL
FT                   FYKDESFKDAYRIALGTTYYYDKNWTFRTGIAYDDSPVPANKRSISIPDQDRLWLSAGA
FT                   TYAFNEDASIDVGASYMHGQNVKFTEGEGPAAYSFKSDGKAWLFGTNFNYAF"
FT   gene            430939..431181
FT                   /locus_tag="CKO_00447"
FT   CDS_pept        430939..431181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00447"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3691 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11603"
FT                   /db_xref="InterPro:IPR005272"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADP0"
FT                   /inference="protein motif:HMMPfam:IPR005272"
FT                   /inference="protein motif:HMMTigr:IPR005272"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456931.1"
FT                   /protein_id="ABV11603.1"
FT                   /translation="MDVGTIMDNSDCTASYSRVFENRAQAEETLAALTEKARGVESEPC
FT                   QITSTFTEEAEGVRLDIDFVFACEAETLIFQLGLR"
FT   gene            431359..432669
FT                   /locus_tag="CKO_00448"
FT   CDS_pept        431359..432669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c2887 2.1e-216 acetyl-CoA
FT                   acetyltransferase K00632; COG: COG0183 Acetyl-CoA
FT                   acetyltransferase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11604"
FT                   /db_xref="GOA:A8ADP1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADP1"
FT                   /inference="protein motif:HMMPanther:IPR002155"
FT                   /inference="protein motif:HMMPfam:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR012806"
FT                   /inference="protein motif:ScanRegExp:IPR002155"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737841.1"
FT                   /protein_id="ABV11604.1"
FT                   /translation="MSQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVELGKMVV
FT                   GELLARSEIPAEVIEQLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQ
FT                   AVANVAESLMAGTIRAGIAGGADSSSVLPIGVSKKLARILVDVNKARTTGQKLKLFSRL
FT                   RLRDLMPVPPAVAEYSTGLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKL
FT                   ADEVMTTYAPPYKEPFSEDNNIRGNSTLADYAKLRPAFDRQHGTVTAANSTPLTDGAAA
FT                   VILMTESRAKELGLAPLGYLRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTLADLSLI
FT                   DMHEAFAAQTLANIQLLGSERFARDVLGRAHATGEVDDSKFNVLGGSIAYGHPFAATGA
FT                   RMITQTLHELRRRGGGFGLVTACAAGGLGAAMVLEAE"
FT   gene            432669..434816
FT                   /locus_tag="CKO_00449"
FT   CDS_pept        432669..434816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2388 0. yfcX; enoyl-CoA hydratase /
FT                   3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA
FT                   epimerase K00022:K01692:K01782; COG: COG1250
FT                   3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11605"
FT                   /db_xref="GOA:A8ADP2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012802"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADP2"
FT                   /inference="protein motif:Gene3D:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR001753"
FT                   /inference="protein motif:HMMPfam:IPR006108"
FT                   /inference="protein motif:HMMPfam:IPR006176"
FT                   /inference="protein motif:HMMTigr:IPR012802"
FT                   /inference="protein motif:ScanRegExp:IPR006180"
FT                   /inference="protein motif:superfamily:IPR008927"
FT                   /protein_id="ABV11605.1"
FT                   /translation="MDMTSAFTLNVRLDNVAVVSIDVPGEKMNTLKAEFATQVRAILKQ
FT                   IRENKALRGVVFISAKPDNFIAGADINMIGNCKSAQEAETLARQGQQIMAEIQALSVPV
FT                   VAAIHGACLGGGLEMALACHRRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVST
FT                   ALDMILTGKQLRPKQALRVGLVDEVVPHAILLEAAVELAIKGRSAQRNLPVRERILAGP
FT                   LGRTLLFRMVSKKTGQKTQGNYPATERILEVIETGLAQGSSSGYDAEARAFGELAMTPQ
FT                   SQALRNIFFASTEVKKDPGSDAQPGPLASVGVLGGGLMGGGIAYVTACKGGLSVRIKDI
FT                   NAKGINHALKYSWDQLETKVRRRHIKAGERDKQLALISGSTDYRGFSHRDLVIEAVFED
FT                   LALKQQMVAEVEQNCAPHTIFASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVE
FT                   VIPHATTSAQTIATTVKLAKKQGKTPIVVSDKAGFYVNRILAPYINEAIRLLTEGERVE
FT                   AIDAALVKFGFPVGPIQLLDEVGIDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKG
FT                   RKNGRGFYLYGVKGRKSKKQVDPAIYRLIGTQGQSRLSAQQMAERCVMLMLNEAARCFD
FT                   EKVIRSARDGDIGAVFGIGFPPFLGGPFRYMDTLGAGEVVAVLQRLATQYGDRFTPCER
FT                   LLRMAERGERFWNSGETDLKE"
FT   gene            complement(434915..435046)
FT                   /locus_tag="CKO_00451"
FT   CDS_pept        complement(434915..435046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11607"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADP3"
FT                   /protein_id="ABV11607.1"
FT                   /translation="MTHDKNLHIAPLLLTRITHILSKNPDGYDKNAVAGIVPYPFTE"
FT   gene            435023..435508
FT                   /locus_tag="CKO_00450"
FT   CDS_pept        435023..435508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0477 3.3e-78 sixA; phosphohistidine
FT                   phosphatase K08296; COG: COG2062 Phosphohistidine
FT                   phosphatase SixA; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11606"
FT                   /db_xref="GOA:A8ADP4"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADP4"
FT                   /inference="protein motif:HMMPfam:IPR013078"
FT                   /inference="protein motif:HMMTigr:IPR004449"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149791.1"
FT                   /protein_id="ABV11606.1"
FT                   /translation="MQVFIMRHGDAALDAASDSVRPLTSCGCDESRLMANWLKGQKVDI
FT                   ERVLVSPFLRAEQTLDVVGECMNLPGNVDVLPELTPCGDVGMVSAWLQTLANEGVASVL
FT                   VISHLPLVGYLVSELCPGETPPMFTTSAIASVTLDESGKGVFNWQMSPCNLKMAKAI"
FT   gene            435524..435655
FT                   /locus_tag="CKO_00452"
FT   CDS_pept        435524..435655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11608"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADP5"
FT                   /protein_id="ABV11608.1"
FT                   /translation="MDTVPDGASLIRPTSCTDSVGRIRRLIALRLSDLQPALNPQAG"
FT   gene            complement(435561..435782)
FT                   /locus_tag="CKO_00453"
FT   CDS_pept        complement(435561..435782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11609"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADP6"
FT                   /protein_id="ABV11609.1"
FT                   /translation="MVAAGASLTMPIADCRMAAQAPYPAYGVSAGYRPDKRSAIRRLIR
FT                   PAGSVQAVGLISEALSGALSGLRSQCRM"
FT   gene            complement(435758..436309)
FT                   /locus_tag="CKO_00454"
FT   CDS_pept        complement(435758..436309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00454"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2840 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11610"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADP7"
FT                   /inference="protein motif:HMMPfam:IPR002625"
FT                   /inference="protein motif:HMMSmart:IPR002625"
FT                   /inference="similar to AA sequence:INSD:ABB66930.1"
FT                   /protein_id="ABV11610.1"
FT                   /translation="MKKKTSLSEEDQALFRQLMTGTRQIKQDTIVHRPQRKKITEVPVK
FT                   RLIQEQADASHYFSDEFQPLLNTDGPVKYVRADVSHFELKKMRRGDYSPELFLDLHGLT
FT                   QQQAKQELGALIAACRREHVFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYG
FT                   GDAALLVLIEVEEWLPPELP"
FT   gene            436475..437407
FT                   /locus_tag="CKO_00455"
FT   CDS_pept        436475..437407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2385 9.0e-163 yfcB; putative methylase
FT                   K07320; COG: COG2890 Methylase of polypeptide chain release
FT                   factors; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11611"
FT                   /db_xref="GOA:A8ADP8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADP8"
FT                   /inference="protein motif:HMMPfam:IPR013217"
FT                   /inference="protein motif:HMMTigr:IPR004556"
FT                   /inference="protein motif:ScanRegExp:IPR002052"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456926.1"
FT                   /protein_id="ABV11611.1"
FT                   /translation="MDKIFVDEAVSELHTIQDMLRWAVSRFSAANIWYGHGTDNPWDEA
FT                   VQLVLPSLYLPLDIPEDMRTARLTSSERHRIVERVIRRVNERIPVAYLTNKAWFCGHEF
FT                   YVDERVLVPRSPIGELINNRFAGLISEQPHHILDMCTGSGCIAIACAYAFPEAEVDAVD
FT                   ISSDALAVTEHNIEEHGLLNHVTPIRSDLFRDLPKVQYDLIVTNPPYVDAEDMSDLPNE
FT                   YRHEPELGLASGTDGLKLTRRILGNAPDYLSDDGILICEVGNSMVHLIEQYPDVPFTWL
FT                   EFDNGGDGVFMLTKAQLIAAREHFSIYKD"
FT   gene            437446..438531
FT                   /locus_tag="CKO_00456"
FT   CDS_pept        437446..438531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_2368 2.6e-188 chorismate synthase
FT                   K01736; COG: COG0082 Chorismate synthase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11612"
FT                   /db_xref="GOA:A8ADP9"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADP9"
FT                   /inference="protein motif:BlastProDom:IPR000453"
FT                   /inference="protein motif:HMMPfam:IPR000453"
FT                   /inference="protein motif:HMMTigr:IPR000453"
FT                   /inference="protein motif:ScanRegExp:IPR000453"
FT                   /inference="similar to AA sequence:INSD:AAG57458.1"
FT                   /protein_id="ABV11612.1"
FT                   /translation="MAGNTLGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDL
FT                   DRRRPGTSRYTTQRREPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRP
FT                   GHADYTYEQKYGLRDYRGGGRSSARETAMRVAAGAIAKKYLAEKHGIVIQGCLTQMGDI
FT                   PLEIKDWQQVEQNPFFCPDPDKIDALDELMRALKKEGDSIGAKVTVVANGVPAGLGEPV
FT                   FDRLDADIAHALMSINAVKGVEIGDGFDVVALRGSQNRDEITKEGFLSNHAGGILGGIS
FT                   SGQQIVAHMALKPTSSITVPGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVL
FT                   MDHLLRQRAQNADVKTDIPRW"
FT   gene            438535..439359
FT                   /locus_tag="CKO_00457"
FT   CDS_pept        438535..439359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2613 1.4e-143 mepA;
FT                   penicillin-insensitive murein endopeptidase precursor
FT                   K07261; COG: COG3770 Murein endopeptidase; Psort location:
FT                   Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11613"
FT                   /db_xref="GOA:A8ADQ0"
FT                   /db_xref="InterPro:IPR005073"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADQ0"
FT                   /inference="protein motif:BlastProDom:IPR005073"
FT                   /inference="protein motif:HMMPfam:IPR005073"
FT                   /inference="protein motif:HMMPIR:IPR005073"
FT                   /inference="similar to AA sequence:INSD:ABG70361.1"
FT                   /protein_id="ABV11613.1"
FT                   /translation="MKKTALALLALLVSSASLAATPWQKITHPVPGSAQSIGGFSNGCI
FT                   VGADTLPVQSEHYQVMRTDQRRYFGHPDLVMFIQRLSTQVSNLGFGTVLIGDMGMPAGG
FT                   RFNGGHASHQTGLDVDIFLQLPKTRWTQAQLLRPQAIDLVSRDGKHVVPSLWKPEISSL
FT                   IKLAAEDNDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLE
FT                   CEDQPLPPPGDGCGAELQSWFEPPEPGTTKPEKKTPPPLPPSCQALLDEHVL"
FT   gene            439359..440168
FT                   /locus_tag="CKO_00458"
FT   CDS_pept        439359..440168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00458"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0730 Predicted permeases; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11614"
FT                   /db_xref="GOA:A8ADQ1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ1"
FT                   /inference="protein motif:HMMPfam:IPR002781"
FT                   /inference="similar to AA sequence:INSD:AAV76484.1"
FT                   /protein_id="ABV11614.1"
FT                   /translation="MDNFLNLFMVSPLLLIVLFFVAMLAGFIDSLAGGGGLLTIPALMA
FT                   AGMSPAQALATNKLQACGGSLSASIYFIRRKVVNLADQKLNILMTFIGSMSGALLVQYV
FT                   QASILRQILPVLVICIGLYFLLMPKLGEEDRQRRLYGLPFALVAGGCVGFYDGFFGPAA
FT                   GSFYALAFVTLCGYNLAKSTAHAKVLNATSNIGGLLLFAIGGKVIWATGFVMLIGQFLG
FT                   ARMGSRLVLSKGQKLIRPMIVIVSAVMSAKLLYDNHGQEILHLLGMN"
FT   gene            440168..440716
FT                   /locus_tag="CKO_00459"
FT   CDS_pept        440168..440716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00459"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3101 Uncharacterized protein conserved in
FT                   bacteria; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11615"
FT                   /db_xref="InterPro:IPR007411"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ2"
FT                   /inference="protein motif:HMMPfam:IPR007411"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737826.1"
FT                   /protein_id="ABV11615.1"
FT                   /translation="MNSTHHYQQLIDIFNGCFADDFNTRLIKGDDEPVYLPADADVPYH
FT                   RIVFAHGFYASALHEISHWCIAGKARRELVDFGYWYCPDGRDAQTQSQFEDVEVKPQAF
FT                   DWLFCVAAGYPFNVSCDNLEGDFEPDRVVFQRRVHAQVMEYLEKGIPERPARFIKALQN
FT                   YYHTPDITAEQFPWPEALN"
FT   gene            440749..441027
FT                   /locus_tag="CKO_00460"
FT   CDS_pept        440749..441027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00460"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG13546 non supervised orthologous group;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11616"
FT                   /db_xref="InterPro:IPR014987"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ3"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456922.1"
FT                   /protein_id="ABV11616.1"
FT                   /translation="MIAEFESRILALIDDMVEHASDDELFASGYLRGHLTLAVAELEGG
FT                   DDHSAEAVYANVTSSLEKAIGAGELSPRDQALVKEMWDNLFQKAINA"
FT   gene            complement(441096..443156)
FT                   /locus_tag="CKO_00461"
FT   CDS_pept        complement(441096..443156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF1701 5.9e-182 hypothetical protein
FT                   K00599; COG: COG0665 Glycine/D-amino acid oxidases
FT                   (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11617"
FT                   /db_xref="GOA:A8ADQ4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADQ4"
FT                   /inference="protein motif:HMMPfam:IPR006076"
FT                   /inference="protein motif:HMMPfam:IPR008471"
FT                   /protein_id="ABV11617.1"
FT                   /translation="MRLRAHIAKIVTLPVRRVTYVKQYAIQPANLEFNAEGTPVSRDFD
FT                   DVYFSNDNGLEETRYVFLGGNQLEERFPLHPRPLFVVAESGFGTGLNFLTLWQAFSQFR
FT                   DAHPEATLQRLHFISFEKFPLTQADLALAHQHWPELAPWAQQLHAQWPLPLAGCHRLIL
FT                   DDGRVTLDLWFGDINELTGKLDESLNQKVDAWFLDGFAPAKNPDMWTQNLFSTMARLAR
FT                   PGGTLATFTSAGFVRRGLQEAGFTMQKRKGFGRKREMLCGVMAHALTFPSPTPWFTRSG
FT                   SAKRDVAIIGGGIASALLSLALLRRGWQVTLYCSDEQPAQGASGNRQGALYPLLSKHDA
FT                   AINLFFPSAFTFARRLYDALPVTFDHDWCGVTQLGWDEKSQHKIDQMLSLALPDALAVA
FT                   VDPDQAQQETGVATHCRGITYPAGGWLCPAQLTAALLALAATQGLRRHYTHTLTALSRQ
FT                   ATGWQLQFAEGKAVEHEVVVLANGHQINHVDQTRPLPVYSVAGQVSHIPTTPALSALRQ
FT                   VLCYDGYLTPQNPATHQHCIGASYHRGSEETAYREDDQQQNRQRLIDCFPDAAWAKEVD
FT                   ISEKAARCGVRCATRDHLPMVGNVPDYDATLAQYAALARQKDAAERAPVYPDLFMLGAL
FT                   GSRGLCSAPLCAEILAAQMSEEPIPMDADTLAALNPNRLWVRKLLKGKAVK"
FT   gene            443255..444475
FT                   /locus_tag="CKO_00462"
FT   CDS_pept        443255..444475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_2381 1.2e-206 fabB;
FT                   3-oxoacyl-[acyl-carrier-protein] synthase I K00647; COG:
FT                   COG0304 3-oxoacyl-(acyl-carrier-protein) synthase; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11618"
FT                   /db_xref="GOA:A8ADQ5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ5"
FT                   /inference="protein motif:HMMPanther:IPR000794"
FT                   /inference="protein motif:HMMPfam:IPR000794"
FT                   /inference="protein motif:ScanRegExp:IPR000794"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00700372.1"
FT                   /protein_id="ABV11618.1"
FT                   /translation="MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMR
FT                   SHVWGNVKLDTTGLIDRKVVRFMSDASIYAYLSMEQAIADAGLSVETYQNNPRVGLIAG
FT                   SGGGSPKFQVFGADAMRSPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSAC
FT                   ATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNNDPSKASRTY
FT                   DANRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCM
FT                   QMAMHGVDTLIDYLNSHGTSTPVGDVKELGAIREVFGDKSPAISATKAMTGHSLGAAGV
FT                   QEAIYSLLMLEHGFIAPSINIEEMDEQAAGLNIVTEATDRELTTVMSNSFGFGGTNATL
FT                   VMRKLKA"
FT   gene            complement(444587..445111)
FT                   /locus_tag="CKO_00463"
FT   CDS_pept        complement(444587..445111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00463"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG26784 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11619"
FT                   /db_xref="InterPro:IPR024289"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ6"
FT                   /inference="similar to AA sequence:INSD:AAV76490.1"
FT                   /protein_id="ABV11619.1"
FT                   /translation="MKAFPLITLILLLCGCATPHRDSTQDINQFYLSWMKTFTEDQDTP
FT                   HDKSALMQRYVAKELINRLTLIDNLYEQEIVASDYFMYVQDYAPEWIAKFHAGTASAFL
FT                   GGEKVDVWLGDSDTRLIHLMVYTRRENGQWKIYRVRDLTHQFEHPIYDAGAIARARAWS
FT                   AKVAQEYENKQ"
FT   gene            445353..446531
FT                   /locus_tag="CKO_00464"
FT   CDS_pept        445353..446531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C5041 8.8e-07 yjiJ; hypothetical
FT                   protein YjiJ K00403; COG: COG0477 Permeases of the major
FT                   facilitator superfamily; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11620"
FT                   /db_xref="GOA:A8ADQ7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR037541"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ7"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149806.1"
FT                   /protein_id="ABV11620.1"
FT                   /translation="MTAVSQKEKTPSANFSLFRIAFAVFLTYMTVGLPLPVIPLFVHHE
FT                   LGYGNTMVGIAVGIQFLATVLTRGYAGRLADQYGAKRSALQGMLACALAGGAWLLAALL
FT                   PVSVPVKFALLIVGRLILGFGESQLLTGTLTWGMGLVGPSRSGKVMSWNGMAIYGALAA
FT                   GAPLGLLIHSHYGFAALAGTTMALPLLAWAFNGTVRKVPAHAGERPSLWSVVGLIWKPG
FT                   LGLALQGVGFAVIGTFISLYFASKGWAMAGFTLTAFGGAFVLMRVLFGWMPDRFGGVKV
FT                   AVASLLVETAGLVLLWLAPVAWIALLGAALTGAGCSLIFPALGVEVVKRVPSQVRGTAL
FT                   GGYAAFQDISYGVTGPLAGLLATSCGYSSVFLAGAISAVVGIVVTLLSFRRG"
FT   gene            complement(446528..447532)
FT                   /locus_tag="CKO_00465"
FT   CDS_pept        complement(446528..447532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00465"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG06277 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11621"
FT                   /db_xref="GOA:A8ADQ8"
FT                   /db_xref="InterPro:IPR023597"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADQ8"
FT                   /inference="similar to AA sequence:INSD:AAV76495.1"
FT                   /protein_id="ABV11621.1"
FT                   /translation="MMQPISGTPARPPGEGQTAPSVAGEQPLSTQQRTVLERLITRLIS
FT                   LTQQQSAEVWAGMKHDLGVKSDTPLLSRHFPAAEQNLTQRLSVAQQNHANRQVLSQLTE
FT                   LLSQGNNRQAVSDFIRQQYGQTALSQLTPEQLKNVLTLLQQGQLSIPQPQQRPPTDRPL
FT                   LPAEHNTLNQLVTKLAAATGESGKLIWQSMLELSGVKSGELIPAKQFTHLVTWLQARQT
FT                   LSNQSAPTLQTLQAALKLPLEPNEFTALRDYAQQTYQALPHTILTTAQVQDLLNQIFLR
FT                   RVARERELTEPHHIQPIYSPFAPMIETIKSVTARPGLIFIALAVAFILFWLVS"
FT   gene            447632..448768
FT                   /locus_tag="CKO_00466"
FT   CDS_pept        447632..448768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00466"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2372 2.2e-184 pdxB;
FT                   erythronate-4-phosphate dehyrogenase K03473; COG: COG0111
FT                   Phosphoglycerate dehydrogenase and related dehydrogenases;
FT                   Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11622"
FT                   /db_xref="GOA:A8ADQ9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR020921"
FT                   /db_xref="InterPro:IPR024531"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038251"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADQ9"
FT                   /inference="protein motif:HMMPfam:IPR006139"
FT                   /inference="protein motif:HMMPfam:IPR006140"
FT                   /inference="protein motif:ScanRegExp:IPR006140"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217359.1"
FT                   /protein_id="ABV11622.1"
FT                   /translation="MKILVDENMPYARELFSRLGEVKAVPGRPIPVAELDDADALMVRS
FT                   VTKVNEALLGGKSIKFVGTATAGTDHVDEAWLKQAGVGFSAAPGCNAIAVVEYVFSALL
FT                   MLAERDGFALSDRTVGIVGVGNVGARLQARLEALGIRTLLCDPPRADRGDEGDFRSLDE
FT                   LVQEADILTFHTPLYKEGPYKTLHLADEALIGRLKPGTILINACRGPVVDNTALLARLN
FT                   AGQSLSVVLDVWEGEPDLNVALLEKIDIGTSHIAGYTLEGKARGTTQVFEAYSTFIGRA
FT                   QKVALDTLLPAPEFGRITLHGPLDQPTLKRLAHLVYDVRRDDAPLRKVAGIPGEFDKLR
FT                   KNYLERREWSSLYVMCDDASAATLLHKLGFNAVHHPAH"
FT   gene            448830..449843
FT                   /locus_tag="CKO_00467"
FT   CDS_pept        448830..449843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2604 2.8e-159 usg; USG-1 protein
FT                   K00133; COG: COG0136 Aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11623"
FT                   /db_xref="GOA:A8ADR0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR0"
FT                   /inference="protein motif:HMMPfam:IPR000534"
FT                   /inference="protein motif:HMMPfam:IPR012280"
FT                   /inference="protein motif:HMMPIR:IPR012080"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456911.1"
FT                   /protein_id="ABV11623.1"
FT                   /translation="MSEGWNIAILGATGAVGEALLETLAERQFPVGEIYALARNESAGE
FT                   HLRYSGKSVIVQDVADFDWTQAQLAFFVAGAEASAAWVEEATNAGCLVIDSSGLFALEP
FT                   DVPLVVPEVNPSVLADYRNRNVIAVANSLTSQLLASLKPLIDEGGLSRISVTSLLSASA
FT                   HGKKAVDALAGQSAKLLNGIPIDEDDFFGRQLAFNMLPLLPDSEGSVREERRIVDEVRK
FT                   ILQDDGLMISASCIQSPVFYGHAQMVSFEALRPLAAEEARDAFSRGEDIVLSEETDFPT
FT                   QVGDASGNPQLSVGCVRNDYGMPEQVQFWSVADNVRFGGALMAVKTAEKLVQEYLY"
FT   gene            449843..450655
FT                   /locus_tag="CKO_00468"
FT   CDS_pept        449843..450655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecj:JW2315 4.4e-138 truA; pseudouridylate
FT                   synthase I K06173; COG: COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11624"
FT                   /db_xref="GOA:A8ADR1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADR1"
FT                   /inference="protein motif:Gene3D:IPR001406"
FT                   /inference="protein motif:HMMPanther:IPR001406"
FT                   /inference="protein motif:HMMPfam:IPR001406"
FT                   /inference="protein motif:HMMTigr:IPR001406"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00737818.1"
FT                   /protein_id="ABV11624.1"
FT                   /translation="MSAVEQPPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQ
FT                   VANEPVNVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKAVP
FT                   EDFHARFSATARRYRYIIYNHRLRPAILGHGVTHFYEPLDAERMHRAAQCLIGENDFTS
FT                   FRAVQCQSRTPWRNVMHINVTRHGAYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPES
FT                   WIAELLAAKDRRLSAATAKAEGLYLVAVDYPERFDLPKTPLGPLFLAD"
FT   gene            450679..451338
FT                   /locus_tag="CKO_00469"
FT   CDS_pept        450679..451338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsl:LSL_1322 1.6e-14 alkaline phosphatase
FT                   K01077; COG: COG0586 Uncharacterized membrane-associated
FT                   protein; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11625"
FT                   /db_xref="GOA:A8ADR2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR2"
FT                   /inference="similar to AA sequence:INSD:EAY49414.1"
FT                   /protein_id="ABV11625.1"
FT                   /translation="MDLIYFLIDFILHIDVHLAELVAEYGVWVYAILFLILFCETGLVV
FT                   TPFLPGDSLLFVAGALASLETNDLNVHIMVMLMLIAAIVGDAVNYTIGRLFGERLFSNP
FT                   NSKIFRRSYLDKTHQFYEKHGGKTIILARFVPIVRTFAPFVAGMGHMSYRHFAAYNVIG
FT                   ALLWVLLFTYAGYFFGTIPMIQDNLKLLIVGIIVVSILPGVVEIIRHKRAASRAAK"
FT   gene            451491..452405
FT                   /locus_tag="CKO_00470"
FT   CDS_pept        451491..452405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z3578 5.4e-156 accD; acetylCoA
FT                   carboxylase, carboxytransferase component, beta subunit
FT                   K01963; COG: COG0777 Acetyl-CoA carboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11626"
FT                   /db_xref="GOA:A8ADR3"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADR3"
FT                   /inference="protein motif:HMMPfam:IPR000022"
FT                   /inference="protein motif:HMMTigr:IPR000438"
FT                   /inference="similar to AA sequence:INSD:EAY49413.1"
FT                   /protein_id="ABV11626.1"
FT                   /translation="MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEV
FT                   CPKCDHHMRMSARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGE
FT                   KDALVVMKGTLHDMPIVAAAFEFSFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASG
FT                   GARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPK
FT                   ALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASVLAKLMNLP
FT                   APNPDAPREGEVVPPVPDQEPEA"
FT   gene            452475..453743
FT                   /locus_tag="CKO_00471"
FT   CDS_pept        452475..453743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2596 2.1e-202 folC; folylpolyglutamate
FT                   synthase K01927:K01930; COG: COG0285 Folylpolyglutamate
FT                   synthase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11627"
FT                   /db_xref="GOA:A8ADR4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR4"
FT                   /inference="protein motif:HMMPanther:IPR001645"
FT                   /inference="protein motif:HMMPfam:IPR004101"
FT                   /inference="protein motif:HMMPfam:IPR013221"
FT                   /inference="protein motif:HMMTigr:IPR001645"
FT                   /inference="protein motif:ScanRegExp:IPR001645"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456907.1"
FT                   /protein_id="ABV11627.1"
FT                   /translation="MDNKRIPQAASPLAAWLSYLENLHSKTIDLGLERVSRVAARLGVL
FT                   KPAPFVFTVAGTNGKGTTCRTLESVLTAAGYKVGVYSSPHLVRYTERVRVQGNELPESA
FT                   HTASFAEIEAAREDISLTYFEYGTLSALWLFKQAQLDVVILEVGLGGRLDATNIVDADV
FT                   AVVTSIALDHTDWLGPDRESIGREKAGIFRAEKPAIVGEPEMPYTIADVAQETGAQLQR
FT                   RGVDWHYDVTGDGWSFTDGEGTLANLPLPQVPQPNAATALAALRASGLNISEQAIRDGI
FT                   ARAILPGRFQIVSESPRVILDVAHNPHAAEYLTERLKMLPKNGRILAVIGMLHDKDIAG
FT                   TLAWLKSVVDDWYCAPLEGPRGATAEQLLEHLGKGTVYDSVALAWHAALAEAKPEDTVL
FT                   VCGSFHTVAHVMEVMDAGRSGGE"
FT   gene            453733..454416
FT                   /locus_tag="CKO_00472"
FT   CDS_pept        453733..454416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfo:Pfl_1900 7.6e-15 argininosuccinate
FT                   synthase K03749; COG: COG3147 Uncharacterized protein
FT                   conserved in bacteria; Psort location: CytoplasmicMembrane,
FT                   score:8.02"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11628"
FT                   /db_xref="GOA:A8ADR5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032898"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR5"
FT                   /inference="protein motif:HMMPfam:IPR007730"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456906.1"
FT                   /protein_id="ABV11628.1"
FT                   /translation="MASKFQNRLVGTIVLVALGVIVLPGLLDGQKKHYQDEFAAIPLVP
FT                   KPGDRDEPDMMPAATQALPTQPPEGAAEEVRAGDAAAPSLDPSRFAAENNASFDPVPAP
FT                   VEPPKPKPVEKPKPQPKPQQPVAATPTPAPEPKPAAEEKPAPTGKAYVVQLGALKNADK
FT                   VNEIVGKLRGAGFRVYTSPSTPVQGKITRILVGPDASRDKLKNSLGELQQISGLSGVVM
FT                   GYSPN"
FT   gene            454731..455219
FT                   /locus_tag="CKO_00473"
FT   CDS_pept        454731..455219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cal:CaalfMp14 0.0017 NAD4; NADH dehydrogenase
FT                   subunit 4 K03881; COG: COG1286 Uncharacterized membrane
FT                   protein, required for colicin V production; Psort location:
FT                   CytoplasmicMembrane, score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11629"
FT                   /db_xref="GOA:A8ADR6"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR6"
FT                   /inference="protein motif:HMMPfam:IPR003825"
FT                   /inference="similar to AA sequence:INSD:ABI37070.1"
FT                   /protein_id="ABV11629.1"
FT                   /translation="MVWIDYAIIAVIGFSCLVSLIRGFVREALSLVTWGCAFFVASHYY
FT                   TYLSVWFTGFEDELVRNGIAIAILFIATLIVGAIVNFVIGQLVEKTGLSGTDRVLGICF
FT                   GALRGALIVAAILFFLDTFTGLSKSEDWSKSQLIPQFSFIIRWFFDYLQSSSSFLPRT"
FT   gene            455255..456772
FT                   /locus_tag="CKO_00474"
FT   CDS_pept        455255..456772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00474"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0502 1.9e-265 purF;
FT                   amidophosphoribosyltransferase K00764; COG: COG0034
FT                   Glutamine phosphoribosylpyrophosphate amidotransferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11630"
FT                   /db_xref="GOA:A8ADR7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR7"
FT                   /inference="protein motif:HMMPanther:IPR005854"
FT                   /inference="protein motif:HMMPfam:IPR000583"
FT                   /inference="protein motif:HMMPfam:IPR000836"
FT                   /inference="protein motif:HMMTigr:IPR005854"
FT                   /inference="protein motif:ScanRegExp:IPR000583"
FT                   /inference="protein motif:ScanRegExp:IPR002375"
FT                   /inference="similar to AA sequence:INSD:ABR78119.1"
FT                   /protein_id="ABV11630.1"
FT                   /translation="MCGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRL
FT                   RKANGLVSDVFEARHMQRMQGNMGIGHVRYPTAGSSSASEAQPFYVNSPYGITLAHNGN
FT                   LTNAHELRKKLFEEKRRHINTTSDSEILLNIFASELDNFRHYPLEADNIFAAIAATNRQ
FT                   IRGAYACVAMIIGHGMVAFRDPNGIRPLVLGKRDIGDGRTEYMVASESVALDTLGFEFL
FT                   RDVAPGEAVYITEKGQLFTRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGT
FT                   KLGEKIAREWEDLDIDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQ
FT                   QLRRKSVRRKLNANRAEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPE
FT                   IRFPNVYGIDMPTANELIAHGREVDEIRQIIGADGLIFQDLDDLIEAVRAENPDIQQFE
FT                   CSVFNGVYVTKDVDQQYLDYLDSLRNDDVKAMQRQNEVENLEMHNEG"
FT   gene            456870..457439
FT                   /locus_tag="CKO_00475"
FT   CDS_pept        456870..457439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t0508 1.2e-89 ubiX; putative decarboxylase
FT                   K03186; COG: COG0163 3-polyprenyl-4-hydroxybenzoate
FT                   decarboxylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11631"
FT                   /db_xref="GOA:A8ADR8"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR8"
FT                   /inference="protein motif:Gene3D:IPR003382"
FT                   /inference="protein motif:HMMPfam:IPR003382"
FT                   /inference="protein motif:HMMTigr:IPR004507"
FT                   /inference="protein motif:superfamily:IPR003382"
FT                   /inference="similar to AA sequence:INSD:AAX66264.1"
FT                   /protein_id="ABV11631.1"
FT                   /translation="MKRLIVGISGASGAIYGVRLLQVLRDVADVETHLVMSPAARQTLA
FT                   LETEFSLREVQALADVTHDARDIAASISSGSFQTAGMVILPCSIKTLSGIVHSYTDGLL
FT                   TRAADVVLKERRPLVLCVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHCPQTLDDVI
FT                   NQTVNRVLDQFDITLPHDLFTRWQGA"
FT   gene            complement(457528..457698)
FT                   /locus_tag="CKO_00476"
FT   CDS_pept        complement(457528..457698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11632"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADR9"
FT                   /protein_id="ABV11632.1"
FT                   /translation="MFCIVLCVCRLFHAGLMPFSRRRPYLTLNMLIKRCNIVLMLKIAG
FT                   MTVEPQRFGRF"
FT   gene            457728..458510
FT                   /locus_tag="CKO_00477"
FT   CDS_pept        457728..458510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4695 7.1e-28 ABC polar amino
FT                   acid transporter, periplasmic ligand binding protein
FT                   K01713; COG: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain; Psort
FT                   location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11633"
FT                   /db_xref="GOA:A8ADS0"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS0"
FT                   /inference="protein motif:HMMPfam:IPR001638"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:HMMTigr:IPR005768"
FT                   /inference="protein motif:ScanRegExp:IPR001638"
FT                   /inference="similar to AA sequence:INSD:AAV76511.1"
FT                   /protein_id="ABV11633.1"
FT                   /translation="MKKTVLALSLLVGLSATAASYAALPQTVRIGTDATYAPFSSKDAK
FT                   GDFVGFDIDLGNEMCKRMQIKCTWVGSDFDALIPSLKAKKIDAIISSLSITEKRQQEIA
FT                   FSDKLYAADSRLIAAKGSSVQPTIDSLKGKHVGVLQGSTQEAYANDNWRSKGVDVVAYA
FT                   NQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKDYAFAGPSVKDKKYFGDGTGVGLR
FT                   KDDTELKAAFDKALSDLRADGTYDKMAKKYFDFNVYGD"
FT   gene            458758..459540
FT                   /locus_tag="CKO_00478"
FT   CDS_pept        458758..459540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4695 3.7e-31 ABC polar amino
FT                   acid transporter, periplasmic ligand binding protein
FT                   K01713; COG: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain; Psort
FT                   location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11634"
FT                   /db_xref="GOA:A8ADS1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005768"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS1"
FT                   /inference="protein motif:HMMPfam:IPR001638"
FT                   /inference="protein motif:HMMSmart:IPR001638"
FT                   /inference="protein motif:HMMTigr:IPR005768"
FT                   /inference="protein motif:ScanRegExp:IPR001638"
FT                   /inference="similar to AA sequence:INSD:ABG70342.1"
FT                   /protein_id="ABV11634.1"
FT                   /translation="MKKLVLSLSLVLAFSSATAAFAAIPQKVRIGTDPTYAPFESKNAQ
FT                   GELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIA
FT                   FTDKFYAADSRLVVAKDSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQ
FT                   GQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLR
FT                   KEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG"
FT   gene            459726..460412
FT                   /locus_tag="CKO_00479"
FT   CDS_pept        459726..460412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0855 4.8e-22 ABC transporter permease
FT                   protein K02028; COG: COG4215 ABC-type arginine transport
FT                   system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11635"
FT                   /db_xref="GOA:A8ADS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030199"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS2"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR010065"
FT                   /inference="similar to AA sequence:INSD:AAL21254.1"
FT                   /protein_id="ABV11635.1"
FT                   /translation="MLYGFSGVIFQGALVTLELALSSVVLAVLIGLVGAGAKLSQNRVT
FT                   GLIFEGYTTLIRGVPDLVLMLLIFYGLQIALNAVTDAMGIGQIDIDPMVAGIITLGFIY
FT                   GAYFTETFRGAFMAVPKGHIEAATAFGFTGSQIFRRIMFPAMMRYALPGIGNNWQVILK
FT                   ATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGLIYLVFTTVSNGVLLFLERRYSVG
FT                   VKRADL"
FT   gene            460409..461125
FT                   /locus_tag="CKO_00480"
FT   CDS_pept        460409..461125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6546 2.8e-24 putative ABC transporter
FT                   permease K02028; COG: COG4160 ABC-type arginine/histidine
FT                   transport system, permease component; Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11636"
FT                   /db_xref="GOA:A8ADS3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS3"
FT                   /inference="protein motif:HMMPfam:IPR000515"
FT                   /inference="protein motif:HMMTigr:IPR010065"
FT                   /inference="similar to AA sequence:INSD:ABR78114.1"
FT                   /protein_id="ABV11636.1"
FT                   /translation="MIEIIQEYWKSLLWSDGYRFTGVAITLWLLISSVVMGGILALFLA
FT                   IGRVSSNKFIQFPIWLFTYVFRGTPLYVQLLVFYSGMYTLEIVKGTDLLNAFFRSGLNC
FT                   TVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCIILPSALRIALPAY
FT                   SNEVILMLHSTALAFTATVPDLLKIARDINSATYQPFTAFGIAAVLYLIISYVLISLFR
FT                   KAEKRWLQHVKPSSTH"
FT   gene            461133..461906
FT                   /locus_tag="CKO_00481"
FT   CDS_pept        461133..461906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfl:SF2382 1.5e-128 hisP; ATP-binding
FT                   component of histidine transport K02028; COG: COG4598
FT                   ABC-type histidine transport system, ATPase component;
FT                   Psort location: CytoplasmicMembrane, score:7.88"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11637"
FT                   /db_xref="GOA:A8ADS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS4"
FT                   /inference="protein motif:BlastProDom:IPR003439"
FT                   /inference="protein motif:HMMPfam:IPR003439"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR003439"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00722094.1"
FT                   /protein_id="ABV11637.1"
FT                   /translation="MSENKLNVIDLHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKS
FT                   TFLRCINFLEKPSEGSIVVSGQNISLVRDNDGQLKVADKNQLRLLRTRLTMVFQHFNLW
FT                   SHMTVLENVMEAPIQVLGLSKHEARERAVKYLAKVGIDERAQGKYPVHLSGGQQQRVSI
FT                   ARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSTHV
FT                   IFLHQGKIEEEGDPEQVFGNPQSPRLQQFLKGSLK"
FT   gene            complement(462004..462543)
FT                   /locus_tag="CKO_00482"
FT   CDS_pept        complement(462004..462543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bca:BCE_1955 1.8e-13 acetyltransferase, GNAT
FT                   family K00676; COG: COG1670 Acetyltransferases, including
FT                   N-acetylases of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11638"
FT                   /db_xref="GOA:A8ADS5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS5"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:INSD:ABP61519.1"
FT                   /protein_id="ABV11638.1"
FT                   /translation="MPDFWNGDFMAIITTSRLTLSLFQPTDWSFFLALRENPDIMRYMA
FT                   DITPEKDTRLLFARRLVSKHTFVIRLHNSDKPLGDIGLQISHHYPQEADIGYTVLPEAQ
FT                   GRGIATEALYAVCDYAFTHTSVKAINAYVLAENHASVRVLEKRGFTRTQVLENAYEVNG
FT                   IRYDEWVYRLESEMGR"
FT   gene            complement(462587..463480)
FT                   /locus_tag="CKO_00483"
FT   CDS_pept        complement(462587..463480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ava:Ava_0206 8.6e-55 hypothetical protein;
FT                   COG: COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11639"
FT                   /db_xref="GOA:A8ADS6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS6"
FT                   /inference="protein motif:HMMPanther:IPR010099"
FT                   /inference="protein motif:HMMPfam:IPR001509"
FT                   /inference="protein motif:HMMPfam:IPR013549"
FT                   /inference="protein motif:HMMTigr:IPR010099"
FT                   /inference="similar to AA sequence:INSD:CAD07582.1"
FT                   /protein_id="ABV11639.1"
FT                   /translation="MQILITGGTGLIGRHLIPRLLALGHQVTVVTRSPDKARQLLDSRV
FT                   ALWKGLEDRQNLNDIDAVVNLAGEPIADKRWTAQQKERLCQSRWSITQKLADLINASET
FT                   PPAALISGSAAGYYGDLGEVVVTEEEPPHNEFTHKLCARWEQIACSAQSDKTRVCLLRT
FT                   GVVLAPEGGILAKMIPPFRLGLGGPIGNGRQYLAWIHIDDMVNGILWLLDNDLRGPFNM
FT                   VSPYPVRNEQFAHALGHALNRPAILRVPATVIRLLMGESSVLVLGGQRALPKRLEAAGF
FT                   SFRWYDLEEALADVIR"
FT   gene            complement(463500..463862)
FT                   /locus_tag="CKO_00484"
FT   CDS_pept        complement(463500..463862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_2500 2.5e-55 folX;
FT                   D-erythro-7,8-dihydroneopterin tri P epimerase K07589; COG:
FT                   COG1539 Dihydroneopterin aldolase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11640"
FT                   /db_xref="GOA:A8ADS7"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS7"
FT                   /inference="protein motif:HMMPfam:IPR006157"
FT                   /inference="protein motif:HMMTigr:IPR006157"
FT                   /inference="similar to AA sequence:INSD:EAY49400.1"
FT                   /protein_id="ABV11640.1"
FT                   /translation="MSQPDAIIRIKNLRLRTFIGIKEEEILNRQDIVINVAIHYPAEKA
FT                   RVSEDINDALNYRTITKNIIQHVESNRFSLLEKLTQDVLDIAREHHWVTYAEVEIDKLH
FT                   ALRYADSVSMTLSWRR"
FT   gene            463984..464703
FT                   /locus_tag="CKO_00485"
FT   CDS_pept        463984..464703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2585 1.9e-89 yfcF; hypothetical
FT                   protein K00799; COG: COG0625 Glutathione S-transferase;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11641"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034338"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS8"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPfam:IPR004045"
FT                   /inference="protein motif:superfamily:IPR010987"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177566.1"
FT                   /protein_id="ABV11641.1"
FT                   /translation="MSFHQVTVCERLYILRESPKNEEDIMSKPEITLWSDANFFSPYVL
FT                   SVYVALQEKGLPFTLKTVDLSSGEHLQPSWQGYALTRRVPVLEIDGFELSESSAITEYL
FT                   EDRFAPPQWERIYPHDLQKRARARQIQAWLRSDLMPIREERSTDVVFAAARKGPLSEAG
FT                   KESAAKLVATASGLLAHGKPNLFGEWCIADTDLALMLNRLVLNGDEIPEALAEYAAFQW
FT                   QRASVQRFIALSAKRSG"
FT   gene            464759..465310
FT                   /locus_tag="CKO_00486"
FT   CDS_pept        464759..465310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2584 3.9e-82 yfcE; hypothetical
FT                   protein; COG: COG0622 Predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11642"
FT                   /db_xref="GOA:A8ADS9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADS9"
FT                   /inference="protein motif:HMMPfam:IPR004843"
FT                   /inference="protein motif:HMMPIR:IPR000979"
FT                   /inference="protein motif:HMMTigr:IPR000979"
FT                   /inference="protein motif:ScanRegExp:IPR000979"
FT                   /inference="similar to AA sequence:REFSEQ:YP_670234.1"
FT                   /protein_id="ABV11642.1"
FT                   /translation="MKLMFASDIHGSLPATERVLERFAQSGAQWLVILGDVLYHGPRNA
FT                   LPEGYAPAQVAERLNEQAARIIAVRGNCDSEVDQMLLHFLITAPWQQVLLENRRIFLTH
FT                   GHLFGADNVPALNAGDVLAYGHTHLPVAEKRGELYHFNPGSVSIPKGGFAASYGILDDN
FT                   VLSVIALNDQSIIAQVAINP"
FT   gene            465366..465920
FT                   /locus_tag="CKO_00487"
FT   CDS_pept        465366..465920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssn:SSO_2356 8.5e-87 putative regulator; COG:
FT                   COG0494 NTP pyrophosphohydrolases including oxidative
FT                   damage repair enzymes; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11643"
FT                   /db_xref="GOA:A8ADT0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR024195"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT0"
FT                   /inference="protein motif:BlastProDom:IPR002667"
FT                   /inference="protein motif:Gene3D:IPR000086"
FT                   /inference="protein motif:HMMPfam:IPR000086"
FT                   /inference="protein motif:superfamily:IPR000086"
FT                   /inference="similar to AA sequence:INSD:AAL21247.1"
FT                   /protein_id="ABV11643.1"
FT                   /translation="MVEQRRLASTEWVDIVNEENEVIAQSSREQMRAQRLRHRATYIVV
FT                   HDGMGKILVQRRTETKDFLPGMLDATAGGVVQADEQLLESARREAEEELGIAGVPFAEH
FT                   GQFYFEDDNCRVWGGLFSCVSHGPFALQEEEISEVCWLTPEEITARCDEFTPDSLKALA
FT                   LWMTRNANNESAKQEKQEETE"
FT   gene            complement(465926..466945)
FT                   /locus_tag="CKO_00488"
FT   CDS_pept        complement(465926..466945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: efa:EF1922 1.4e-06 transcriptional regulator,
FT                   LacI family/carbohydrate kinase, PfkB family protein
FT                   K00852; COG: COG1609 Transcriptional regulators; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11644"
FT                   /db_xref="GOA:A8ADT1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT1"
FT                   /inference="protein motif:HMMPfam:IPR000843"
FT                   /inference="protein motif:HMMPfam:IPR001761"
FT                   /inference="protein motif:HMMSmart:IPR000843"
FT                   /inference="protein motif:ScanRegExp:IPR000843"
FT                   /inference="protein motif:superfamily:IPR010982"
FT                   /inference="similar to AA sequence:INSD:AAL21246.1"
FT                   /protein_id="ABV11644.1"
FT                   /translation="MSITRKRRSTGKVTIADVAQLAGVGTMTVSRALRTPEQVSDKLRE
FT                   KIEAAVNELGYMPNLAASALASASSRTIAMVVPNLTEAGCSEMFAGLQQVLQPAGYQIM
FT                   LAESLHHLEQEEKLLETLLASNIAAAILLSVEHSDTVRHWLKNASIPVMEIGAIRTDPI
FT                   DMNIGIDNVAAMYELTEMLIQRGYQNIGLLCANQEQWIFQQHLQGWYKAMLRHHMSPNR
FT                   VINAALPPNFSTGASQLPEFILAWPELDALVCVSDELACGALYECQRRRIKVPDDLAVV
FT                   GFGDSDVSRVCQPPLTTMAVPHRKIGLEAGRALLERLKDGNWSDRKQIASSLCLRDSC"
FT   gene            467229..467639
FT                   /locus_tag="CKO_00489"
FT   CDS_pept        467229..467639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00489"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2574 4.4e-58 putative sugar
FT                   phosphotransferase component II A K02821; COG: COG1762
FT                   Phosphotransferase system mannitol/fructose-specific IIA
FT                   domain (Ntr-type); Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11645"
FT                   /db_xref="GOA:A8ADT2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT2"
FT                   /inference="protein motif:BlastProDom:IPR002178"
FT                   /inference="protein motif:Gene3D:IPR002178"
FT                   /inference="protein motif:HMMPfam:IPR002178"
FT                   /inference="similar to AA sequence:INSD:CAD07576.1"
FT                   /protein_id="ABV11645.1"
FT                   /translation="MRQARVENWPQALEICARPLLDAGVITPEYVTAIVEQHHKLGAYY
FT                   VLAPGLAMPHARPEEGAKGLGLSLLKLEQGVSFGAGEFDPVDIIVMLAAPDKHSHIEMI
FT                   SALAELFSSDDDMDKLHQAKSLEEIKTIIARF"
FT   gene            467716..467994
FT                   /locus_tag="CKO_00490"
FT   CDS_pept        467716..467994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0521 9.6e-40 putative sugar
FT                   phosphotransferase component II B K02822; COG: COG3414
FT                   Phosphotransferase system, galactitol-specific IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11646"
FT                   /db_xref="GOA:A8ADT3"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT3"
FT                   /inference="protein motif:HMMPfam:IPR003501"
FT                   /inference="similar to AA sequence:INSD:"
FT                   /protein_id="ABV11646.1"
FT                   /translation="MIMKIMAICGSGLGSSFMVEMNIKKVLRKLEIDADVEHSDLSSAT
FT                   PGAADLFVMAKDIAASASVPESQLVVINNIIDINELEAQLRAWFAKQ"
FT   gene            468017..469408
FT                   /locus_tag="CKO_00491"
FT   CDS_pept        468017..469408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcp:MCAP_0590 2.1e-90 PTS system, IIBC
FT                   component, putative K02822:K03475; COG: COG3037
FT                   Uncharacterized protein conserved in bacteria; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11647"
FT                   /db_xref="GOA:A8ADT4"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT4"
FT                   /inference="protein motif:HMMPfam:IPR007333"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461284.1"
FT                   /protein_id="ABV11647.1"
FT                   /translation="MFILETLNFVVDILKVPSVLVGLIALIGLVAQKKAFSDVVKGTIK
FT                   TILGFIVLGGGATVLVGSLNPLGGMFEHAFNIQGIIPNNEAIVSIALEKYGASTALIMA
FT                   FGMVANIVVARFTRLKYIFLTGHHTFYMACMIGVILTVAGFDGVGLVFTGSLILGLVMA
FT                   FFPALAQRYMKRITGTDDIAFGHFGTLGYVLSGWIGSLCGKGSRSTEEMNLPKNLSFLR
FT                   DSSISISLTMMIIYLIMAVSAGREYVESTFSGGQNYLVYAIIMAITFAAGVFIILQGVR
FT                   LILAEIVPAFTGFSEKLVPNARPALDCPVVYPYAPNAVLIGFLFSFLGGLVGLFLLGQM
FT                   KLVLILPGVVPHFFTGATAGVFGNATGGRRGAMIGAFANGLLITFLPVLLLPVLGAIGF
FT                   ANTTFSDADFGAVGIVLGNLARYLSPLAITGLVVALFVLLVAYNVFAKNKSAGGNTQEN
FT                   TGAKL"
FT   gene            469405..470235
FT                   /locus_tag="CKO_00492"
FT   CDS_pept        469405..470235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2342 5.8e-136 tktN; putative
FT                   transketolase K00615; COG: COG3959 Transketolase,
FT                   N-terminal subunit; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11648"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT5"
FT                   /inference="protein motif:HMMPfam:IPR005474"
FT                   /inference="protein motif:HMMPIR:IPR012058"
FT                   /inference="similar to AA sequence:INSD:ABP61508.1"
FT                   /protein_id="ABV11648.1"
FT                   /translation="MNVNEVTQLARDIRVATLKSLTQLGFGHYGGSMSVVETLAVLYGA
FT                   VMKIDPADPDWPERDYFVLSKGHAGPALYSTLAIKGYFPTEELNTLNQNGTRLPSHPDR
FT                   LKTRGVDATTGSLGQGISIAGGMALSHKLAGRPNRVFCIVGDGELNEGQCWEAFQFIAH
FT                   HRLNNLTVFIDWNKQQLDGELDEIICPFDLEGKFRAFGFDVVTVKGDDIAQLLEVVQPV
FT                   PAADARPRVVILDSIKGQGVPYLEQLSNSHHLRLTDEMKKALNETIRQLEAAHD"
FT   gene            470228..471181
FT                   /locus_tag="CKO_00493"
FT   CDS_pept        470228..471181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2340 7.1e-154 putative transketolase
FT                   K00615; COG: COG3958 Transketolase, C-terminal subunit;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11649"
FT                   /db_xref="GOA:A8ADT6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT6"
FT                   /inference="protein motif:Gene3D:IPR009014"
FT                   /inference="protein motif:HMMPfam:IPR005475"
FT                   /inference="protein motif:HMMPfam:IPR005476"
FT                   /inference="protein motif:HMMPIR:IPR012068"
FT                   /inference="protein motif:superfamily:IPR009014"
FT                   /inference="similar to AA sequence:INSD:ABP61507.1"
FT                   /protein_id="ABV11649.1"
FT                   /translation="MIKVAPAGQKENMEMRKVYAGFVAEQIEAGSQIIALEADLMSSMA
FT                   MDGVARDYPQHVINCGIMEANVIGTAAGLSLTGRKPFVHTFTAFASRRCFDQLFMSLDY
FT                   QRNNVKVIASDAGVTACHNGGTHMSFEDMGIVRGLAHSVVLEVTDAVMFKDILRQLIEL
FT                   EGFYWVRTIRKQAPSIYAPGSTFTIGKGNVLREGSDITLIANGIMVAEALEAARQLEQD
FT                   GVNAAVIDMFTLKPIDRMLVKNYAEKTGRIVTCENHSIHNGLGSAVAEVLVETCPVPMR
FT                   RVGVKERYGQVGTQDFLQKEYGLTAEAIVEAAKTLL"
FT   gene            471153..471317
FT                   /locus_tag="CKO_00494"
FT   CDS_pept        471153..471317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11650"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT7"
FT                   /protein_id="ABV11650.1"
FT                   /translation="MWKRRKRCCNNDVLLPDGATAYPAYNNLTRRPDKTRQRRHPAFLI
FT                   NGIPSTARR"
FT   gene            complement(471286..472764)
FT                   /locus_tag="CKO_00495"
FT   CDS_pept        complement(471286..472764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00495"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1288 Predicted membrane protein; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11651"
FT                   /db_xref="GOA:A8ADT8"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT8"
FT                   /inference="protein motif:HMMPfam:IPR004669"
FT                   /inference="similar to AA sequence:REFSEQ:NP_804382.1"
FT                   /protein_id="ABV11651.1"
FT                   /translation="MPDTLVIIFFVAILTSLATWVVPVGMFDSQEVQYQVDGQTKTRKV
FT                   VDPHSFRILTNEAGEAQYHRVQLFTTGDERPGLMNFPFEGLTSGSKFGTAVGIIMFMLV
FT                   IGGAFGIVMRTGTIDNGILALIRHTRGNEVLFIPVLFILFSLGGAVFGMGEEAVAFAII
FT                   IAPLMVRLGYDSITTVLVTYIATQIGFASSWMNPFCVVVAQGIAGVPVLSGSSLRIVVW
FT                   FVSTLIGLLFTLTYAARVKKNPHLSRVHESDRYFREKQDEIAQRPFTAGDWLVLIVLTG
FT                   VMIWVIWGVTVHAWFIPEIASQFFTMGVVIGIIGVIFRLNGMTVNIMASSFTEGARMMI
FT                   APALLVGFAKGILLLVGNGEAGDASVLNTLLNSIAHGISGLNNAVAAWFMLLFQAVFNF
FT                   FVTSGSGQAALTMPLLAPLGDLVGVNRQVTVLAFQFGDGFSHIIYPTSASLMATLGVCR
FT                   VDFRNWLKVGATLLGLLFIMSSVVVIGAQLMGYH"
FT   gene            complement(472871..473020)
FT                   /locus_tag="CKO_00496"
FT   CDS_pept        complement(472871..473020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11652"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADT9"
FT                   /protein_id="ABV11652.1"
FT                   /translation="MCRIATLRRPYPASTSYLRSGNSDYFQIFYARRTGMNEIRFSRLA
FT                   ALYQ"
FT   gene            complement(473029..475158)
FT                   /locus_tag="CKO_00497"
FT   CDS_pept        complement(473029..475158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0526 0. pta; phosphate
FT                   acetyltransferase K00625; COG: COG0857 BioD-like N-terminal
FT                   domain of phosphotransacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11653"
FT                   /db_xref="GOA:A8ADU0"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU0"
FT                   /inference="protein motif:HMMPfam:IPR002505"
FT                   /inference="protein motif:HMMPfam:IPR010766"
FT                   /inference="protein motif:HMMTigr:IPR004614"
FT                   /protein_id="ABV11653.1"
FT                   /translation="MLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRAGGNAP
FT                   DQTTAIVRANSSVPAAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTKDAEVVLVEGL
FT                   VPTRKHQFAQSLNYEIAKTLNAEIVFVMSQGTDTPEQLNERIELTRSSFGGAKNTNITG
FT                   VIVNKLNAPVDEQGRTRPDLSEIFDDSSKAKVVKVDPAKLQESSPLPVLGAVPWSFDLI
FT                   ATRAIDMARHLNATVVNEGDINTRRVKSVTFCARSIPHMLEHFRAGSLLVTSADRPDVL
FT                   VAACLAAMNGVEIGALLLTGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSLSLQSF
FT                   NLEVPVDDHERIEKVQEYVANYINADWIESLTATSERSRRLSPPAFRYQLTELARKAGK
FT                   RVVLPEGDEPRTVKAAAICAERGIATCVLLGNPEEINRVAASQGVELGAGIEIVDPEVV
FT                   RESYVARLVELRKSKGMTETVAREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRP
FT                   PLQLIKTAPGSSLVSSVFFMLLPEQVYVYGDCAINPDPTAEQLAEIAIQSAESAIAFGI
FT                   EPRVAMLSYSTGTSGAGSDVEKVREATRLAQEKRPDLMIDGPLQYDAAVMADVAKSKAP
FT                   NSPVAGRATVFIFPDLNTGNTTYKAVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIV
FT                   YTIALTAIQSSQQQQ"
FT   gene            complement(475250..476452)
FT                   /locus_tag="CKO_00498"
FT   CDS_pept        complement(475250..476452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2337 1.8e-203 ackA; acetate/propionate
FT                   kinase K00925; COG: COG0282 Acetate kinase; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11654"
FT                   /db_xref="GOA:A8ADU1"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU1"
FT                   /inference="protein motif:HMMPanther:IPR000890"
FT                   /inference="protein motif:HMMPfam:IPR000890"
FT                   /inference="protein motif:HMMPIR:IPR004372"
FT                   /inference="protein motif:HMMTigr:IPR004372"
FT                   /inference="protein motif:ScanRegExp:IPR000890"
FT                   /inference="similar to AA sequence:INSD:CAD07569.1"
FT                   /protein_id="ABV11654.1"
FT                   /translation="MSSKLVLVLNCGSSSLKFAIIDAANGEEYLSGLAECFHLPEARIK
FT                   WKMDGNKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVV
FT                   IDDSVIQGIKDAAPFAPLHNPAHLIGITEALKSFPELKEKNVAVFDTAFHQTMPEESYL
FT                   YALPYSLYKEHGVRRYGFHGTSHYYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRN
FT                   GQCVDTSMGLTPLEGLVMGTRTGDIDPAIIFFLHDNLGMNIDQINKMLTKESGLLGLTE
FT                   VTSDCRYVEDNYTAKEDAKRAMDVYCHRLAKYIGSYTALMEGRLDAVVFTGGIGENAAM
FT                   VRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLT
FT                   A"
FT   gene            476513..476671
FT                   /locus_tag="CKO_00499"
FT   CDS_pept        476513..476671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11655"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU2"
FT                   /protein_id="ABV11655.1"
FT                   /translation="MMTLTFMINIMRNNLFRHDGRNTFESMPFCVFFSQWHTICKFDDS
FT                   MILDYWP"
FT   gene            476791..477246
FT                   /locus_tag="CKO_00500"
FT   CDS_pept        476791..477246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00500"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3092 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11656"
FT                   /db_xref="GOA:A8ADU3"
FT                   /db_xref="InterPro:IPR007334"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADU3"
FT                   /inference="protein motif:HMMPfam:IPR007334"
FT                   /inference="similar to AA sequence:INSD:AAV76530.1"
FT                   /protein_id="ABV11656.1"
FT                   /translation="MSTPDNRSVNFFSLFRRGQHYAKTWPMEKRLAPVFVENRVIRMTR
FT                   YAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGMWWLGKRSVTPLPPSILN
FT                   WFYEVRGKLQEAGQALSPVEGKPDYQALADTLKRAFKQLDKTFLDDL"
FT   gene            477330..477824
FT                   /locus_tag="CKO_00501"
FT   CDS_pept        477330..477824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00501"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3013 Uncharacterized conserved protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11657"
FT                   /db_xref="InterPro:IPR005587"
FT                   /db_xref="InterPro:IPR023145"
FT                   /db_xref="InterPro:IPR023146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADU4"
FT                   /inference="protein motif:BlastProDom:IPR005587"
FT                   /inference="protein motif:HMMPfam:IPR005587"
FT                   /inference="protein motif:HMMPIR:IPR005587"
FT                   /inference="similar to AA sequence:INSD:CAD07567.1"
FT                   /protein_id="ABV11657.1"
FT                   /translation="MEMTNAQRLILSNQYKMMTMLDPTNAERYRRLQTIIERGYGLQMR
FT                   ELDREFGELKEETCRTIIDIMEMYHALHVSWTNLKDAQTIDERRVTFLGFDAATEARYL
FT                   GYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHSCPRQYHLSSNEINQIIN
FT                   A"
FT   gene            477817..478494
FT                   /locus_tag="CKO_00502"
FT   CDS_pept        477817..478494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2575 2.6e-94 yfbT; protein YfbT
FT                   K01112; COG: COG0637 Predicted
FT                   phosphatase/phosphohexomutase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11658"
FT                   /db_xref="GOA:A8ADU5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU5"
FT                   /inference="protein motif:FPrintScan:IPR005833"
FT                   /inference="protein motif:HMMPfam:IPR005834"
FT                   /inference="protein motif:HMMTigr:IPR006402"
FT                   /inference="protein motif:HMMTigr:IPR006439"
FT                   /inference="similar to AA sequence:INSD:CAD07566.1"
FT                   /protein_id="ABV11658.1"
FT                   /translation="MPEGVSVQCKGFLFDLDGTLVDSLPVVERTWCNWADRFGLTHDEV
FT                   LSFIHGKQAITSLRHFMAGKPEEEIAAEFTRLEQIEATDTAGIVALPGAVELLNHLNKA
FT                   GIPWAIVTSGSMPVARARHQAAGLPAPEVFVTAERVKRGKPEPDAYLLGAQLLGLSPQE
FT                   CAVVEDAPAGILSGLAAGCHVIAVNAPEDTPRIADVDFALSSLEHISVTKQPNGNVVVL
FT                   RNT"
FT   gene            478572..480404
FT                   /locus_tag="CKO_00503"
FT   CDS_pept        478572..480404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00503"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0471 Di- and tricarboxylate transporters;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11659"
FT                   /db_xref="GOA:A8ADU6"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU6"
FT                   /inference="protein motif:HMMPfam:IPR004680"
FT                   /inference="protein motif:HMMPfam:IPR006037"
FT                   /inference="protein motif:ScanRegExp:IPR001898"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217321.1"
FT                   /protein_id="ABV11659.1"
FT                   /translation="MNGELIWVLSLLAIAVILFATGKVRMDAIALLVIVAFVLSGTLSI
FT                   SEAFSGFSDPNVVLIAALFIIGDGLVRTGVATVMGAWLVKMAGSSEVKMLVLLMITVAG
FT                   LGAFMSSTGVVAIFIPVVLSVSMRMQTSPSRLMMPLSFAGLISGMMTLVATPPNLVVNS
FT                   ELLREGLHGFSFFSVTPIGLVVLFLGIIYMLVMRFMLKGDDASQQRDGWKRRAFRDLIK
FT                   EYRLTGRARRLAIRPGSPMVGQRLDDLKLRERYGANVIGVERWRRFRRVIVNVNGVSEF
FT                   RARDVLLIDMSAAEVDLREFCSEQLLEPMVLRGEYFSDQALDVGMAEISLIPESELIGK
FT                   SVREIGFRTRYGLNVVGLKRDGVAIEGSLADEALLMGDIILVVGNWKLIGQLAKQGRDF
FT                   VVLNMPVEVSDASPAHSQAPHAIFCLVLMVALMLTDEIPNPIAAIIACLLMGKFRCIDA
FT                   ESSYKAIHWPSIILIVGMMPFALALQKTGGVDLVVKGLMDVGGGYGPYMMLACLFVLCA
FT                   TIGLFISNTATAVLMAPIALAAAKSMGVSPYPFAMVVAMAASAAFMTPVSSPVNTLVLG
FT                   PGNYSFSDFVKIGVPFTIIVMAVCVVMIPVLFPF"
FT   gene            complement(480496..481095)
FT                   /locus_tag="CKO_00504"
FT   CDS_pept        complement(480496..481095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_2487 1.3e-97 putative alpha helix
FT                   protein K08722; COG: COG1896 Predicted hydrolases of HD
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11660"
FT                   /db_xref="GOA:A8ADU7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR022971"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADU7"
FT                   /inference="protein motif:HMMPfam:IPR006674"
FT                   /inference="protein motif:HMMSmart:IPR003607"
FT                   /inference="similar to AA sequence:INSD:ABB62557.1"
FT                   /protein_id="ABV11660.1"
FT                   /translation="MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALA
FT                   AIKNRKFGGQVNAERIALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKL
FT                   VDMVPDELRDIFAPLIDEHAYSEEEKSVVKQADALCAYLKCLEELSAGNNEFLLAKTRL
FT                   EKTLASRRSEEMDYFMAVFVPSFHLSLDEISQDSPL"
FT   gene            complement(481200..482417)
FT                   /locus_tag="CKO_00505"
FT   CDS_pept        complement(481200..482417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdy:SDY_2486 1.9e-217 putative
FT                   aminotransferase K00812; COG: COG0436
FT                   Aspartate/tyrosine/aromatic aminotransferase; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11661"
FT                   /db_xref="GOA:A8ADU8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU8"
FT                   /inference="protein motif:HMMPfam:IPR004839"
FT                   /inference="similar to AA sequence:INSD:ABB62556.1"
FT                   /protein_id="ABV11661.1"
FT                   /translation="MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAP
FT                   FGFEAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGV
FT                   SELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRA
FT                   KITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHS
FT                   IAALAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVP
FT                   AQHAIQTALGGYQSISEFIMPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDA
FT                   KRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRIDDIEMSLSKFGRFL
FT                   SGYHQL"
FT   gene            482537..482668
FT                   /locus_tag="CKO_00506"
FT   CDS_pept        482537..482668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11662"
FT                   /db_xref="GOA:A8ADU9"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADU9"
FT                   /protein_id="ABV11662.1"
FT                   /translation="MWDCAVKSCFNAIITVFITAFIYFIGFLFLVSGFCVVVCFVKK"
FT   gene            483353..484291
FT                   /locus_tag="CKO_00507"
FT   CDS_pept        483353..484291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3435 0.00027 transcriptional
FT                   regulator, LysR family K06022; COG: COG0583 Transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11663"
FT                   /db_xref="GOA:A8ADV0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADV0"
FT                   /inference="protein motif:FPrintScan:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR000847"
FT                   /inference="protein motif:HMMPfam:IPR005119"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461272.1"
FT                   /protein_id="ABV11663.1"
FT                   /translation="MINANRPIINLDLDLLRTFVAVADLNTFAAAAAAVCRTQSAVSQQ
FT                   MQRLEQLVGKELFARHGRNKLLTEHGIQLLGYARKILRFNDEACSSLMFSNLQGVLTIG
FT                   ASDESADTILPFLLNRISSVYPKLALDVRVKRNAFMVDMLKSQEVDLIVTTHRPGSFEF
FT                   LNLRTSPTHWYCAAEYVLQKGEPIPLVLLDDPSPFRDIVLATLNAANIPWRLAYVASTL
FT                   AAVRAAVKAGLGITARPVEMMSPDLRVLGAADGLPPLPDTEYLLCRDPSGQNELAQVIY
FT                   QAMDSYQNPWQYSQFTPEGGDDSLMVEGDFE"
FT   gene            484920..485363
FT                   /locus_tag="CKO_00508"
FT   CDS_pept        484920..485363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfx:S2499 5.7e-74 nuoA; NADH dehydrogenase I
FT                   chain A K00330; COG: COG0838 NADH:ubiquinone oxidoreductase
FT                   subunit 3 (chain A); Psort location: CytoplasmicMembrane,
FT                   score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11664"
FT                   /db_xref="GOA:A8ADV1"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADV1"
FT                   /inference="protein motif:HMMPanther:IPR000440"
FT                   /inference="protein motif:HMMPfam:IPR000440"
FT                   /inference="similar to AA sequence:INSD:ABJ01676.1"
FT                   /protein_id="ABV11664.1"
FT                   /translation="MSMSTSTEIIAHHWAFAIFLIIAIGLCCLMLVGGWFLGGRARARS
FT                   KNTPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAA
FT                   IFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR"
FT   gene            485379..486053
FT                   /locus_tag="CKO_00509"
FT   CDS_pept        485379..486053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu3088 1.4e-116 nuoB; NADH dehydrogenase
FT                   I chain B (NADH-ubiquinone oxidoreductase chain 2) (NUO2)
FT                   K00331; COG: COG0377 NADH:ubiquinone oxidoreductase 20 kD
FT                   subunit and related Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11665"
FT                   /db_xref="GOA:A8ADV2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADV2"
FT                   /inference="protein motif:HMMPfam:IPR006137"
FT                   /inference="protein motif:HMMTigr:IPR006138"
FT                   /inference="protein motif:ScanRegExp:IPR006138"
FT                   /inference="similar to AA sequence:INSD:ABR78094.1"
FT                   /protein_id="ABV11665.1"
FT                   /translation="MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEINKSVYMGKLEHA
FT                   LHDMVNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAG
FT                   TCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCP
FT                   PRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPD
FT                   EI"
FT   gene            486139..487941
FT                   /locus_tag="CKO_00510"
FT   CDS_pept        486139..487941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecc:c2827 0. nuoC; NADH dehydrogenase I chain
FT                   C/D K00332:K00333; COG: COG0649 NADH:ubiquinone
FT                   oxidoreductase 49 kD subunit 7; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11666"
FT                   /db_xref="GOA:A8ADV3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADV3"
FT                   /inference="protein motif:BlastProDom:IPR001268"
FT                   /inference="protein motif:HMMPfam:IPR001135"
FT                   /inference="protein motif:HMMPfam:IPR001268"
FT                   /inference="protein motif:HMMTigr:IPR010218"
FT                   /inference="protein motif:HMMTigr:IPR010219"
FT                   /inference="protein motif:ScanRegExp:IPR001135"
FT                   /inference="protein motif:superfamily:IPR008992"
FT                   /protein_id="ABV11666.1"
FT                   /translation="MVNNMTDLTAQDAVWQTRDHLDDPVIGELRNRFGPDAFTVQATRT
FT                   GVPVVWVKREQLLEVGDFLKKLPKPYVMLFDLHGMDERLRTHRDGLPAADFSVFYHLIS
FT                   IDRNRDIMLKVALSENDLHVPTFTKLFPNANWYERETWEMFGITFDGHPHLTRLLMPPT
FT                   WEGHPLRKDYPARATEFDPFELTKAKQDLEMEALTFKPEDWGMQRGTENEDFMFLNLGP
FT                   NHPSSHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGC
FT                   VNEMPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAF
FT                   TDRQKIYDVVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLRDFLDWMPKRLDSYEKAAL
FT                   RNTILKGRSQGVAAYGKKEALDWGCTGAALRATGIDFDVRKSRPYSGYENFDFEIPVGG
FT                   GVSDCYTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLIT
FT                   HFLQVSWGPVMPANESFQMVEATKGINSYYLTSDGSTMSYRTRIRTPSYAHLQQIPVAV
FT                   RGSLVSDLIVHLGSIDFVMSDVDR"
FT   gene            487944..488444
FT                   /locus_tag="CKO_00511"
FT   CDS_pept        487944..488444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2555 2.2e-88 nuoE; NADH dehydrogenase I
FT                   chain E K00334; COG: COG1905 NADH:ubiquinone oxidoreductase
FT                   24 kD subunit; Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11667"
FT                   /db_xref="GOA:A8ADV4"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADV4"
FT                   /inference="protein motif:BlastProDom:IPR002023"
FT                   /inference="protein motif:Gene3D:IPR012335"
FT                   /inference="protein motif:HMMPanther:IPR002023"
FT                   /inference="protein motif:HMMPfam:IPR002023"
FT                   /inference="protein motif:HMMTigr:IPR002023"
FT                   /inference="protein motif:ScanRegExp:IPR002023"
FT                   /inference="protein motif:superfamily:IPR012336"
FT                   /inference="similar to AA sequence:INSD:AAL21226.1"
FT                   /protein_id="ABV11667.1"
FT                   /translation="MHENQQPQTEAFELSAAEREAIEHEKHHYEDPRAASIEALKIVQK
FT                   QRGWVPDGAIYAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQG
FT                   IQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHSHLTPEAIPELLE
FT                   RYK"
FT   gene            488441..489778
FT                   /locus_tag="CKO_00512"
FT   CDS_pept        488441..489778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0540 6.7e-245 nuoF; NADH dehydrogenase
FT                   I chain F K00335; COG: COG1894 NADH:ubiquinone
FT                   oxidoreductase, NADH-binding (51 kD) subunit; Psort
FT                   location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11668"
FT                   /db_xref="GOA:A8ADV5"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADV5"
FT                   /inference="protein motif:HMMPfam:IPR011538"
FT                   /inference="protein motif:HMMTigr:IPR011537"
FT                   /inference="protein motif:ScanRegExp:IPR001949"
FT                   /inference="similar to AA sequence:INSD:AAV76542.1"
FT                   /protein_id="ABV11668.1"
FT                   /translation="MKNVIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGL
FT                   SPDEIVNQVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLL
FT                   MEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVHLRRAIAEATEAGLLGKNIMGT
FT                   GFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPASSGVWGKPTCVNNVETL
FT                   CNVPAILANGVEWYQNISKSKDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGM
FT                   RDGLKFKAWQPGGAGTDFLTEAHLDLPMEFESIGKAGSRLGTALAMAVDHEIGMVSLVR
FT                   NLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCA
FT                   HAPGAVEPLQSAIKYFREEFEAGIKQPFSNTHVIGGIQPNLLKERW"
FT   gene            489851..492586
FT                   /locus_tag="CKO_00513"
FT   CDS_pept        489851..492586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2553 0. nuoG; NADH dehydrogenase I
FT                   chain G K00336; COG: COG1034 NADH
FT                   dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit
FT                   (chain G)"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11669"
FT                   /db_xref="GOA:A8ADV6"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADV6"
FT                   /inference="protein motif:Gene3D:IPR012675"
FT                   /inference="protein motif:HMMPfam:IPR001041"
FT                   /inference="protein motif:HMMPfam:IPR006656"
FT                   /inference="protein motif:HMMPfam:IPR006657"
FT                   /inference="protein motif:HMMPfam:IPR006963"
FT                   /inference="protein motif:HMMTigr:IPR010228"
FT                   /inference="protein motif:ScanRegExp:IPR000283"
FT                   /inference="protein motif:superfamily:IPR001041"
FT                   /inference="protein motif:superfamily:IPR009010"
FT                   /protein_id="ABV11669.1"
FT                   /translation="MLTMATIHVDGKEYEVNGADNLLQACLSLGLDIPYFCWHPALGSV
FT                   GACRQCAVKQYQNAEDTRGRLVMSCMTPATDGTFISIDDEEAKQFRESVVEWLMTNHPH
FT                   DCPVCEEGGNCHLQDMTVMTGHNFRRYRFTKRTHRNQDLGPFISHEMNRCIACYRCVRY
FT                   YKDYADGADLGVYGAHDNVYFGRPEDGTLESEFSGNLVEICPTGVFTDKTHSERYNRKW
FT                   DMQFAPSICQQCSIGCNTSPGERYGELRRIENRYNGTVNHYFLCDRGRFGYGYVNLKDR
FT                   PRQPIQRRGDDLITLNAEQAMQGAADILRQSKKVIGIGSPRASVESNFALRELVGADNF
FT                   YTGIAQGEQERLQLALKVLREGGIHTPALRDIESYDAVLVLGEDITQTGARVALAVRQA
FT                   VKGKAREMAAAQKVADWQIAAILNIGQRAKHPLFVTNVDNTRLDDIAAWTYRAPVEDQA
FT                   RLGFAIAHALDDSAPTVNGISSDLQNKIDVIVQALAGAKKPLIISGTNAGSAEVIQAAA
FT                   NVAKALKGRGSDVGITMIARSVNSMGLGMMGGGSLDDALTELETGRADAVVVLENDLHR
FT                   HASAVRVNAALAKAPLVMVVDHQRTAIMENAHLVLSAASFAESDGTVINNEGRAQRFFQ
FT                   VYDPAYYDSNTVMLESWRWLHSLHSTVQNREVDWTQLDHVIDAAIAAMPQLAGIKDAAP
FT                   DATFRIRGQKLAREPHRYSGRTAMRANISVHEPRQPQDKDTMFAFSMEGNNQPGAPRSQ
FT                   IPFAWAPGWNSPQAWNKFQDEVGGKLRHGDPGVRLIEASENGLDYFTTVPASFQAQDGQ
FT                   WRIAPYYHLFGSDEMSQRSPVFQSRMPQPYIKLNPADAAKLGVNAGTRVSFSYDGNTVT
FT                   LPVEIAEGLTAGQVGLPMGMPGIAPVLAGGRLENLQEAQQ"
FT   gene            492583..493560
FT                   /locus_tag="CKO_00514"
FT   CDS_pept        492583..493560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2322 1.4e-171 nuoH; NADH dehydrogenase I
FT                   chain H K00337; COG: COG1005 NADH:ubiquinone oxidoreductase
FT                   subunit 1 (chain H); Psort location: CytoplasmicMembrane,
FT                   score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11670"
FT                   /db_xref="GOA:A8ADV7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADV7"
FT                   /inference="protein motif:HMMPanther:IPR001694"
FT                   /inference="protein motif:HMMPfam:IPR001694"
FT                   /inference="protein motif:ScanRegExp:IPR001694"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177542.1"
FT                   /protein_id="ABV11670.1"
FT                   /translation="MSWITPDLIEILLSILKAVVILLVVVTCGAFMSFGERRLLGLFQN
FT                   RYGPNRVGWGGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVS
FT                   PTWVVADLNIGILFFLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLS
FT                   LMGVVAQAGSFNMTDIVNNQADIWNVIPQFFGFVTFAIAGVAVCHRHPFDQPEAEQELA
FT                   DGYHIEYSGMKFGLFFVGEYIGIVTISALMVTLFFGGWHGPFLPPFIWFALKTAFFMMM
FT                   FILIRASLPRPRYDQVMSFGWKVCLPLTLINLLVTAAVILWQAQ"
FT   gene            493575..494117
FT                   /locus_tag="CKO_00515"
FT   CDS_pept        493575..494117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ece:Z3540 1.3e-97 nuoI; NADH dehydrogenase I
FT                   chain I K00338; COG: COG1143 Formate hydrogenlyase subunit
FT                   6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11671"
FT                   /db_xref="GOA:A8ADV8"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADV8"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:HMMTigr:IPR010226"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:INSD:ABF04459.1"
FT                   /protein_id="ABV11671.1"
FT                   /translation="MTLKELLVGFGTQVRSIWMIGLHAFAKRETQMYPEEPVYLPPRYR
FT                   GRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAEMKDGRWYPEFFRINFSRCIFCGL
FT                   CEEACPTTAIQLTPDFEMGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDK
FT                   GEAENEAKPIDVKSLLP"
FT   gene            494129..494683
FT                   /locus_tag="CKO_00516"
FT   CDS_pept        494129..494683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00516"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfl:SF2356 6.5e-89 nuoJ; NADH dehydrogenase I
FT                   chain J K00339; COG: COG0839 NADH:ubiquinone oxidoreductase
FT                   subunit 6 (chain J); Psort location: CytoplasmicMembrane,
FT                   score:9.46"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11672"
FT                   /db_xref="GOA:A8ADV9"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADV9"
FT                   /inference="protein motif:HMMPfam:IPR001457"
FT                   /inference="similar to AA sequence:INSD:ABF04458.1"
FT                   /protein_id="ABV11672.1"
FT                   /translation="MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFS
FT                   LGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIML
FT                   VVIVYAILGVNDQGIDGTPISAKAVGISLFGPYVLAVELASMLLLAGLVVAFHVGREER
FT                   VGEVLSNRPGDSAKRKTEEHA"
FT   gene            494680..494982
FT                   /locus_tag="CKO_00517"
FT   CDS_pept        494680..494982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2279 6.8e-46 nuoK; NADH dehydrogenase I
FT                   chain K K00340; COG: COG0713 NADH:ubiquinone oxidoreductase
FT                   subunit 11 or 4L (chain K); Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11673"
FT                   /db_xref="GOA:A8ADW0"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADW0"
FT                   /inference="protein motif:BlastProDom:IPR003214"
FT                   /inference="protein motif:HMMPfam:IPR001133"
FT                   /inference="similar to AA sequence:INSD:ABJ01667.1"
FT                   /protein_id="ABV11673.1"
FT                   /translation="MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALA
FT                   FVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG"
FT   gene            494979..496820
FT                   /locus_tag="CKO_00518"
FT   CDS_pept        494979..496820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2318 0. nuoL; NADH dehydrogenase I
FT                   chain L K00341; COG: COG1009 NADH:ubiquinone oxidoreductase
FT                   subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA
FT                   subunit; Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11674"
FT                   /db_xref="GOA:A8ADW1"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADW1"
FT                   /inference="protein motif:FPrintScan:IPR003916"
FT                   /inference="protein motif:FPrintScan:IPR003945"
FT                   /inference="protein motif:HMMPfam:IPR001516"
FT                   /inference="protein motif:HMMPfam:IPR001750"
FT                   /inference="protein motif:HMMTigr:IPR003945"
FT                   /protein_id="ABV11674.1"
FT                   /translation="MNMLALTIILPLIGFVLLAFSRGRWSENLSATVGVGSIGLAALVT
FT                   AFVGVDFFANGKQAFSQPLWTWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMFAS
FT                   WYMRGEEGYSRFFAYTNLFIASMVILVLSDNLLLMYLGWEGVGLCSYLLIGFYYTDPKN
FT                   GAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLML
FT                   LGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVLH
FT                   LVGIVGAITLVLAGFAALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAF
FT                   FKALLFLASGSVILACHHEQNIFKMGGLRKSIPLVYLCFLVGGAALSALPLITAGFFSK
FT                   DEILAGAMANGHINLMVAGLVGAFMTSLYTFRMIFIVFHGKEQIHAHAGKGITHHLPLI
FT                   VLMVLSTFVGALIVPPLQGVLPQTTELEHSRVMTLEIASGVVAIVGILIAAWLWLGKRT
FT                   LVTSVANSAPGRLLGTWWYNAWGFDWLYDKVFVKPFLGVAWLLKRDPLNALMNVPAILS
FT                   RFAGKGLLLSENGYLRWYVASMSIGAVVVLALLMVLR"
FT   gene            497004..498533
FT                   /locus_tag="CKO_00519"
FT   CDS_pept        497004..498533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2317 5.7e-271 nuoM; NADH dehydrogenase
FT                   I chain M K00342; COG: COG1008 NADH:ubiquinone
FT                   oxidoreductase subunit 4 (chain M); Psort location:
FT                   CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11675"
FT                   /db_xref="GOA:A8ADW2"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADW2"
FT                   /inference="protein motif:FPrintScan:IPR003918"
FT                   /inference="protein motif:HMMPfam:IPR001750"
FT                   /inference="protein motif:HMMTigr:IPR010227"
FT                   /inference="protein motif:superfamily:IPR008948"
FT                   /inference="similar to AA sequence:INSD:AAL21218.1"
FT                   /protein_id="ABV11675.1"
FT                   /translation="MLLPWLILIPFIGGFLCWQTERFGVKVPRWIALITMGLTLALGLQ
FT                   LWLQGGYSLTQAAGIPQWQSEFILPWIPRFGISIHLAIDGLSLLMVVLTGLLGVLAVLC
FT                   SWNEIEKYQGFFHLNLMWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASD
FT                   GKTRITAATKFFIYTQASGLVMLIAILALVFVHHNATGVWTFNYEDLLKTPMSHGVEYL
FT                   LMLGFFIAFAVKMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPN
FT                   ASAEFAPIAMWLGVIGIFYGAWMAFTQYDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQG
FT                   AVIQMIAHGLSAAGLFILCGQLYERLHTRDMRMMGGLWSKIKWLPALSMFFAVATLGMP
FT                   GTGNFVGEFMILFGSYQVVPVITVISTFGLVFASVYSLAMLHRAYFGKAKSQIASQDMP
FT                   GMSLRELFIILLLVVLLVLLGFYPQPILDTSHSAMSNIQQWFVNSVTTTRP"
FT   gene            498540..499997
FT                   /locus_tag="CKO_00520"
FT   CDS_pept        498540..499997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2316.S 4.1e-245 nuoN; NADH
FT                   dehydrogenase subunit N K00343; COG: COG1007
FT                   NADH:ubiquinone oxidoreductase subunit 2 (chain N); Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11676"
FT                   /db_xref="GOA:A8ADW3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADW3"
FT                   /inference="protein motif:HMMPfam:IPR001750"
FT                   /inference="protein motif:HMMTigr:IPR010096"
FT                   /inference="similar to AA sequence:SwissProt:Q8Z530"
FT                   /protein_id="ABV11676.1"
FT                   /translation="MTITPQHLIALLPLLIVGLTVVVVMLSIAWRRNHFLNATLSVIGL
FT                   NAALVSLWFVGQAGAMDVTPLMRVDGFAMLYTGLVLLASLATCTFAYPWLEGYNDNQEE
FT                   FYLLVLIAALGGILLANANHLAALFLGIELISLPLFGLIGYAFRQKRSLEASIKYTILS
FT                   AAASSFLLFGMALVYAQSGNLSFVALGKSLGDGMLHEPLLLAGFGLMIVGLGFKLSLVP
FT                   FHLWTPDVYQGAPAPVSTFLATASKIAIFGVVMRLFLYAPVGDSEAVRIVLGVIAFASI
FT                   IFGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQSGEMSMEAVGVYLAGYLFSSLGA
FT                   FGVVSLMSSPFRGPDADSLFSYRGLFWHRPILAAVMTVMMLSLAGIPMTLGFIGKFYVL
FT                   AVGVQASLWWLVAAVVVGSAIGLYYYLRVAVSLYLSAPQQLNRDAPSNWQYSAGGIVVL
FT                   ISALLVLVLGIYPQPLISIVQLATPLM"
FT   gene            complement(500060..501064)
FT                   /locus_tag="CKO_00521"
FT   CDS_pept        complement(500060..501064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00521"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2314 1.5e-162 putative chemotaxis
FT                   signal transduction protein K03415; COG: COG0784 FOG:
FT                   CheY-like receiver; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11677"
FT                   /db_xref="GOA:A8ADW4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADW4"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR002545"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR002545"
FT                   /inference="protein motif:superfamily:IPR002545"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149863.1"
FT                   /protein_id="ABV11677.1"
FT                   /translation="MDNFQKDIDDRANLTLSNRFELLLFRLGTSLHEQKSELFGINVFK
FT                   LREIVPMPTFTRPAGMKAPLLGMVNIRDQVIPVIDLPAVAGCKPENGLNILLITEYARS
FT                   VQAFAVESVENIMRLDWQQVHTAEKAVNGRYITSIACLDEDKETNNLALVLDVEQILYD
FT                   IVPSNHDLRATNLKTSKFNITPGAVAIVAEDSKVARAMLEKGLNAMEIPHQMHVTGQDA
FT                   WEKIQQLAKEAEAEGKPISEKIALVLTDLEMPEMDGFTLTRKIKTDERLKKIPVVIHSS
FT                   LSGSANEDHVRKVKADGYVAKFEVNELSSVIQEVMERAAQNVSGPLVSRQLLS"
FT   gene            complement(501129..502046)
FT                   /locus_tag="CKO_00522"
FT   CDS_pept        complement(501129..502046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2268 8.0e-139 elaC, zipD, ecoZ;
FT                   hypothetical protein K00784; COG: COG1234 Metal-dependent
FT                   hydrolases of the beta-lactamase superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11678"
FT                   /db_xref="GOA:A8ADW5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013469"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADW5"
FT                   /inference="protein motif:HMMPfam:IPR001279"
FT                   /inference="protein motif:HMMTigr:IPR013469"
FT                   /inference="protein motif:HMMTigr:IPR013471"
FT                   /inference="similar to AA sequence:INSD:AAC75328.2"
FT                   /protein_id="ABV11678.1"
FT                   /translation="MELIFLGTSAGVPTRTRNVTAILLNLQHPTQAGLWLFDCGEGTQH
FT                   QMLNTAFNPGKLDRIFISHLHGDHLFGLPGLLCSRSMAGNAQPLTIYGPKGIREFTETA
FT                   LRLSGSWTDYPLEIVEITAGEILNDGLRKVTAFALEHPLECYGYRIEEHDKPGALDASA
FT                   LKAAGVKPGPLFQDLKAGKTVTLNDGRVINGADFLAPATPGKSVAIFGDTAPCASAITL
FT                   AKGVDVMVHEATLDTSMEEKANSRGHSSTRQAAQLAHNAEVGQLIITHVSSRYDDRGCQ
FT                   RLLAECQAIFPATALAHDFAVFTV"
FT   gene            502112..502573
FT                   /locus_tag="CKO_00523"
FT   CDS_pept        502112..502573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VF0317 8.5e-32 acetyltransferase K02348;
FT                   COG: COG2153 Predicted acyltransferase; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11679"
FT                   /db_xref="GOA:A8ADW6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADW6"
FT                   /inference="protein motif:HMMPfam:IPR000182"
FT                   /inference="similar to AA sequence:INSD:AAL21213.1"
FT                   /protein_id="ABV11679.1"
FT                   /translation="MIHWQDLHHSELSVPQLYALLKLRCAVFVVEQRCPYLDVDGDDLV
FT                   GENRHILGWHNDELVAYARILKSDDELEPVVIGRVIVSEALRGEKLGQQLMAQTLASCE
FT                   QHWPEKALYLGAQAHLQSFYARFGFVPVTDVYDEDGIPHMGMAREVSQV"
FT   gene            502627..502932
FT                   /locus_tag="CKO_00524"
FT   CDS_pept        502627..502932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00524"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4575 Uncharacterized conserved protein;
FT                   Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11680"
FT                   /db_xref="GOA:A8ADW7"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADW7"
FT                   /inference="protein motif:HMMPfam:IPR010279"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456854.1"
FT                   /protein_id="ABV11680.1"
FT                   /translation="MSFHSYGSRIDDDLELLSETLEEVLRSSGDPADQKYVELKARAER
FT                   ALEEVKNRVSHASDSYYYRAKQAVYKADDYVHEKPWQGIGAGAAVGLVLGLLLARR"
FT   gene            503100..504326
FT                   /locus_tag="CKO_00525"
FT   CDS_pept        503100..504326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00525"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2310 3.3e-188 menF; isochorismate
FT                   synthase (isochorismate hydroxymutase 2), menaquinone
FT                   biosynthesis K02552; COG: COG1169 Isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11681"
FT                   /db_xref="GOA:A8ADW8"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADW8"
FT                   /inference="protein motif:BlastProDom:IPR005801"
FT                   /inference="protein motif:HMMPfam:IPR005801"
FT                   /inference="protein motif:HMMPIR:IPR004561"
FT                   /inference="protein motif:HMMTigr:IPR004561"
FT                   /inference="similar to AA sequence:INSD:AAX66216.1"
FT                   /protein_id="ABV11681.1"
FT                   /translation="MRIVDVPFPLNDAFDALSWLASQAIWPQFYWQQRNGDEEAAVLGA
FT                   VETFPSLEQAQHFLRQHESQSDLRIWGLNAFEPQQGHLLLPRLEWRRAGAMATLRLYLY
FT                   SPVSLREDARRAIAFLSSLRGVKPIPALRLHLTGEQHWPDKAGWTSLIQLATQTIAEDD
FT                   LDKVVLARATDLQFSHSVNAAAVMASSRRLNLNCYHFFMAFSAGSAFLGSSPERLWRRR
FT                   ETALRTEALAGTVANHPDDHQAWQLGEWLMKDDKNQRENMLVVEDICQRLQSCTHSLDV
FT                   LPPQVLRLRKVQHLRRCIWTALNQADDTLCLLQLQPTAAVAGIPRERARAFIQQHEPFE
FT                   REWYAGSAGYLSLQQSEFCVTLRSAKVAANVVRLYAGAGIVRGSDPEQEWQEIDNKAAG
FT                   LRTLLQMES"
FT   gene            504455..506125
FT                   /locus_tag="CKO_00526"
FT   CDS_pept        504455..506125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2309 5.5e-289 menD; bifunctional:
FT                   2-oxoglutarate decarboxylase; SHCHC synthase K02551; COG:
FT                   COG1165
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11682"
FT                   /db_xref="GOA:A8ADW9"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADW9"
FT                   /inference="protein motif:HMMPfam:IPR012001"
FT                   /inference="protein motif:HMMPIR:IPR004433"
FT                   /inference="protein motif:HMMTigr:IPR004433"
FT                   /inference="similar to AA sequence:INSD:AAL21210.1"
FT                   /protein_id="ABV11682.1"
FT                   /translation="MSVSAFNRRWAAVILEALTRHGVRHVCIAPGSRSTPLTLAAAENS
FT                   AFIHHTHFDERGLGHLALGLAKVSKQPVAVIVTSGTAVANLYPALIEAGLTGEKLILLT
FT                   ADRPPELIDCGANQAIRQAGMFASHPSQTLSLPRPTQDISARWLVSTLDNVLATLHAGA
FT                   VHINCPFAEPLYGDMDDTGLAWQQSLGDWWQDDKPWLREARRLESDKQRDWFFWRQKRG
FT                   VVVAGRMSAEEGKKVALWAQTLGWPLIGDVLSQTGQPLPCADLWLGNAKAVTELQQAQI
FT                   VVQLGSSLTGKRLLQWQAACEPEEYWIIDNIEGRLDPAHHRGRRLVAKIADWLELHPAE
FT                   KRHPWCVDIPRLAEQAWQAVAARRDMFGEAQLAHRIRDYLPEQGQLFVGNSLVVRLIDA
FT                   LSQLPAGYPVYSNRGASGIDGLISTAAGVQRASAKSTLAIVGDLSALYDLNALALLRQV
FT                   SAPFVLIVVNNNGGQIFSLLPTPQSERERFYLMPQNVHFEHAAAMFNLKYHRPQSWDEL
FT                   DAALAGAWRTPTTTVIELVVNDTDGAQTLQQLLAQVSHL"
FT   gene            506122..506880
FT                   /locus_tag="CKO_00527"
FT   CDS_pept        506122..506880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0555 3.5e-106 yfbB; hypothetical
FT                   protein K08680; COG: COG0596 Predicted hydrolases or
FT                   acyltransferases (alpha/beta hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11683"
FT                   /db_xref="GOA:A8ADX0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADX0"
FT                   /inference="protein motif:HMMPfam:IPR000073"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149869.1"
FT                   /protein_id="ABV11683.1"
FT                   /translation="MILRAQANGGQPGSPWLVFLHGFSGDCREWQQIGEQFPDFSRLYI
FT                   DLPGHGDSADIRVSGFADVCDLLRNTLFSYNILKYWLVGYSLGGRVAMMAACQTLPGFC
FT                   GLVVEGGHPGLQREAERDARRRSDGRWAARFRREPLRDVFTDWYQQPVFASLDASQREA
FT                   LVALRSQNNGETLAAMLEATSLAVQPDLRARLNARTFPFYYLCGERDSKFRALAAELSV
FT                   PCHMIRNAGHNAHRENPAGVVDSLAQILRL"
FT   gene            506895..507752
FT                   /locus_tag="CKO_00528"
FT   CDS_pept        506895..507752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0556 2.7e-154 menB; naphthoate synthase
FT                   K01661; COG: COG0447 Dihydroxynaphthoic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11684"
FT                   /db_xref="GOA:A8ADX1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX1"
FT                   /inference="protein motif:HMMPfam:IPR001753"
FT                   /inference="protein motif:HMMTigr:IPR010198"
FT                   /inference="protein motif:ScanRegExp:IPR001753"
FT                   /inference="similar to AA sequence:INSD:AAV76558.1"
FT                   /protein_id="ABV11684.1"
FT                   /translation="MIYPDETMLYAPVEWHDCSEGYTDIRYEKSTDGIAKITINRPQVR
FT                   NAFRPLTVKEMIQALADARYDDNVGVIILTGEGEKAFCAGGDQKVRGDYGGYQDDSGVH
FT                   HLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFD
FT                   GGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLDSLEKETVRWCREML
FT                   QNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKF
FT                   KRNP"
FT   gene            507752..508714
FT                   /locus_tag="CKO_00529"
FT   CDS_pept        507752..508714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sty:STY2536 5.9e-150 menC;
FT                   O-succinylbenzoate-CoA synthase K02549; COG: COG1441
FT                   O-succinylbenzoate synthase; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11685"
FT                   /db_xref="GOA:A8ADX2"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADX2"
FT                   /inference="protein motif:HMMTigr:IPR010196"
FT                   /inference="similar to AA sequence:REFSEQ:NP_456849.1"
FT                   /protein_id="ABV11685.1"
FT                   /translation="MRSAQVYRWQIPMDAGVVLRDRRLKTRDGLYVRLCDGEREGWGEI
FT                   SPLPGFSQETLEEAQAALLDWVNGWLQGQSTLPEVPSVAFGVSCALAEAAGTLPEAADY
FT                   RAAPLCTGDPDDLVLQLADMPGEKVAKIKVGLYEAVRDGMVVNLLLEAVPDLHLRLDAN
FT                   RAWTPLKAQQFAKYVNPDYRARIAFLEEPCKTRDDSRAFARETGIAIAWDESLREDDFV
FT                   FAAEAGVSAVVIKPTLTGSLEKVREQVQAAHTLGLTAVISSSIESSLGLTQLARIAAWL
FT                   TPQTIPGLDTLSLMQTQQVRRWPGSALPCVSDDALERLL"
FT   gene            508711..510126
FT                   /locus_tag="CKO_00530"
FT   CDS_pept        508711..510126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0558 4.1e-206 menE; O-succinylbenzoic
FT                   acid-CoA ligase K01911; COG: COG0318 Acyl-CoA synthetases
FT                   (AMP-forming)/AMP-acid ligases II; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11686"
FT                   /db_xref="GOA:A8ADX3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX3"
FT                   /inference="protein motif:HMMPfam:IPR000873"
FT                   /inference="protein motif:HMMTigr:IPR010192"
FT                   /inference="protein motif:ScanRegExp:IPR000873"
FT                   /inference="similar to AA sequence:REFSEQ:YP_149872.1"
FT                   /protein_id="ABV11686.1"
FT                   /translation="MSLREMPDSASVSGLQPSSFNDWPWRHWRQMRGDAPALRLNDEVL
FT                   SWRTLCTRIDALASGFAAQGVSEGCGVMLRAWNHPQTLLAWLALLQCGARILPVNPQLP
FT                   QPLLDALLPDLTLRFALLLEGENTFPALQPLQMQQEAGEHAADWQPTRLSSMTLTSGST
FT                   GLPKAAVHTCQAHLTSAEGVLSLMPFANGDDWLLSLPLFHVSGQGIMWRWLFAGARMTV
FT                   REKQPLEAMLQGCTHASLVPTQLWRLLENPASVTLKAVLLGGAAIPVELTEQARAQGIR
FT                   CWCGYGLTEFASTVCAKEADGLGDVGAALPGREVRIVNGEVWLRAASMAEGYWRDGKLI
FT                   PLVNGEGWFATRDRGELNDGKLTIAGRLDNLFFSGGEGIQPEEVERVISAHPHVLQAFV
FT                   VPVEDREFGHRPVAVVEYDAQAGNVDLAEWVKDKLARFQQPVRWLTLPSALKNGGIKVS
FT                   RRALQEWVRANRP"
FT   gene            complement(510165..511613)
FT                   /locus_tag="CKO_00531"
FT   CDS_pept        complement(510165..511613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypk:y2981 5.4e-227 katE; catalase;
FT                   hydroperoxidase HPII(III) K03781; COG: COG0753 Catalase;
FT                   Psort location: Cytoplasmic, score:9.26"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11687"
FT                   /db_xref="GOA:A8ADX4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX4"
FT                   /inference="protein motif:BlastProDom:IPR002226"
FT                   /inference="protein motif:Gene3D:IPR011614"
FT                   /inference="protein motif:HMMPanther:IPR002226"
FT                   /inference="protein motif:HMMPfam:IPR011614"
FT                   /inference="protein motif:ScanRegExp:IPR002226"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01534029.1"
FT                   /protein_id="ABV11687.1"
FT                   /translation="MSKKGLTTAAGVPVAHNNSVATAGPRGPMLLQDIWFLEKLAHFDR
FT                   EVIPERRMHAKGSGAYGTFTVTHDISRYTRAKIFSEPGKKTDLFLRFSTVAGERGAADA
FT                   ERDIRGFAIKFYTEEGNWDLVGNNTPVFYLRDPLKFPDLNHVVKRDPRTNLRNPTYKWD
FT                   FFSHLPESLHQLTIDFSDRGLPFSYRTMHGFGSHTFSFINSDNERFWVKFHLKSQQGIA
FT                   NLMDDEAKRLVADDRESSQRDLYNAIEQGNFPRWKFYVQIMPEAEASQVPYNPFDLTKV
FT                   WPHGDYPLIEVGVLELNRNPENYFSEVEQVAMNPANVVPGISFSPDRMLQGRLFSYGDA
FT                   HRYRLGVNHQQIPVNAPRCPFHNYHRDGAMRVDGNSGNGPTYEPNSFGVFQEQPDFSEP
FT                   PLSVEGAAAHWDHREDTDYFSQPRKLYELLSDEEHQRMFARIAGDMKDVPEFIQQRQIG
FT                   LFSEVHPDYGAGVAAALRALKEAK"
FT   gene            511886..512428
FT                   /locus_tag="CKO_00532"
FT   CDS_pept        511886..512428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00532"
FT                   /product="hypothetical protein"
FT                   /note="COG: NOG08732 non supervised orthologous group"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11688"
FT                   /db_xref="InterPro:IPR009998"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX5"
FT                   /inference="protein motif:HMMPfam:IPR009998"
FT                   /inference="similar to AA sequence:INSD:AAL21195.1"
FT                   /protein_id="ABV11688.1"
FT                   /translation="MKKSILLGVAGLLFASASANAMSISGQAGKDYTNVGVGFGTESTG
FT                   LALSGNWMHNDDDGDAAGVGLGLNIPLGPLLATVGGKGVYTNPNDGDEGYAAAVGGGLQ
FT                   WKIGDSFRLFGEYYYSPDSLSSGIDSYEEANAGARFTIMRPLSIEAGYRYLNLAGKDGN
FT                   RDNAIADGPYVGVNASF"
FT   gene            512565..513761
FT                   /locus_tag="CKO_00533"
FT   CDS_pept        512565..513761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmu:319945 0.00037 Flad1; RFad1, flavin
FT                   adenine dinucleotide synthetase, homolog (yeast) K00953;
FT                   COG: COG1058 Predicted nucleotide-utilizing enzyme related
FT                   to molybdopterin-biosynthesis enzyme MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11689"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX6"
FT                   /inference="protein motif:BlastProDom:IPR001453"
FT                   /inference="protein motif:HMMPfam:IPR001453"
FT                   /inference="protein motif:HMMPIR:IPR008135"
FT                   /inference="protein motif:HMMTigr:IPR001453"
FT                   /inference="protein motif:HMMTigr:IPR008135"
FT                   /inference="protein motif:superfamily:IPR001453"
FT                   /inference="similar to AA sequence:INSD:AAO68276.1"
FT                   /protein_id="ABV11689.1"
FT                   /translation="MLNVEMLSTGDEVLHGQIVDTNAAWLADFFFNQGLPLSRRNTVGD
FT                   NLDALVAILRERSEHADVLIVNGGLGPTSDDLSALAAATAKGEGLVLHDAWLAEMERFF
FT                   HERGRVMAPSNRKQAELPASAEFINNPVGTACGFAVKLNRCLMFFTPGVPSEFKVMVEH
FT                   EIMPRLRARFALPEPPVCLRLTTFGRSESDLAQSLDSLPLPAGVTMGYRSSMPIIELKL
FT                   TGPDAQRDAMLALWPEVKRVAGQNLIFEGTEGLPAQIARCLQTRQLSLTLSEQFTSGLL
FT                   ALQLSRANAPILASEVVPSQEETLAQTAHWTTERRSNHYAGLALAVSGLENDHLNFALA
FT                   TPDGTFALRVHFSASRYSLAVRQEVCAMMALNMVRRWLNGQDIASEHGWIEVVESLTL"
FT   gene            complement(513825..515015)
FT                   /locus_tag="CKO_00534"
FT   CDS_pept        complement(513825..515015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2286 1.6e-211 glpC;
FT                   sn-glycerol-3-phosphate dehydrogenase (anaerobic), K-small
FT                   subunit K00113; COG: COG0247 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11690"
FT                   /db_xref="GOA:A8ADX7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX7"
FT                   /inference="protein motif:Gene3D:IPR012285"
FT                   /inference="protein motif:HMMPfam:IPR001450"
FT                   /inference="protein motif:HMMPfam:IPR004017"
FT                   /inference="protein motif:HMMPIR:IPR011349"
FT                   /inference="protein motif:ScanRegExp:IPR001450"
FT                   /inference="protein motif:superfamily:IPR009051"
FT                   /inference="similar to AA sequence:INSD:AAX66195.1"
FT                   /protein_id="ABV11690.1"
FT                   /translation="MSDTSFESCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKD
FT                   GALYDDALKYCINCKRCEVACPSDVKIGDIIQRARARYDTSRPSLRNFILSHTDLMGSV
FT                   STPFAPVVNTATSLKPVRQLLDYALKIDHRRTLPKYSFGTFRRWYRSVAAQQAQYKDQV
FT                   AFFHGCFVNYNHPQLGKDLINVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAVSN
FT                   VASLREAIGVKGIPVIATSSTCTFALRDEYPEVLDVDNSGLREHIELATRWLWRKIDAG
FT                   QTLPLKKLPLKVVYHTPCHMEKMGWTLYTLELLRQIPGLELTVLDSQCCGIAGTYGFKK
FT                   ENYPTSQSIGAPLFRQIEESGANIVVTDCETCKWQIEMSTSKRCEHPITLLAQALG"
FT   gene            complement(515012..516271)
FT                   /locus_tag="CKO_00535"
FT   CDS_pept        complement(515012..516271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC2288 7.3e-200 glpB;
FT                   sn-glycerol-3-phosphate dehydrogenase (anaerobic), membrane
FT                   anchor subunit K00112; COG: COG3075 Anaerobic
FT                   glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11691"
FT                   /db_xref="GOA:A8ADX8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADX8"
FT                   /inference="protein motif:HMMPfam:IPR003953"
FT                   /inference="protein motif:HMMPIR:IPR009158"
FT                   /inference="similar to AA sequence:REFSEQ:YP_217275.1"
FT                   /protein_id="ABV11691.1"
FT                   /translation="MKFDTVIMGGGLAGLLCGLELQKHGLRCAIVTRGQSALHFSSGSL
FT                   DLLSTLPDGQPVTNITEGLNALREQAPTHPYTTIGASAVLELAQQAQALLEASGAHLQG
FT                   DVQQSHQRVTPLGTLRATWLSSPEVPVWPLAAQRICVVGISGLLDFQAHLAAASLRQHH
FT                   LTVETAEIDLPELDVLRDNPTEFRAVNIARLLDNEEKWPLLHDALLPIAKTCDMIIMPA
FT                   CFGLADDSLWRWLNERLPCSLNLLPTLPPSVPGIRLHNRLQRQFVRQGGIWMPGDEVKK
FT                   VTCRNGVVSEVWTRNHADIPLRPRFAVLASGSFFSSGLVAERDGIREPIMGLDVQQTAT
FT                   RAEWYQRDFFDAQPWQQFGVTTDDALRPSLAGQTVENLFAIGSVLGGFDPIAQGCGGGV
FT                   CAVSALHAARHIAERAGGQQ"
FT   gene            complement(516261..517889)
FT                   /locus_tag="CKO_00536"
FT   CDS_pept        complement(516261..517889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2284 3.4e-282 glpA;
FT                   sn-glycerol-3-phosphate dehydrogenase (anaerobic), large
FT                   subunit K00111; COG: COG0578 Glycerol-3-phosphate
FT                   dehydrogenase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11692"
FT                   /db_xref="GOA:A8ADX9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADX9"
FT                   /inference="protein motif:FPrintScan:IPR000447"
FT                   /inference="protein motif:HMMPfam:IPR006076"
FT                   /inference="protein motif:HMMPfam:IPR007419"
FT                   /inference="protein motif:ScanRegExp:IPR000447"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461226.1"
FT                   /protein_id="ABV11692.1"
FT                   /translation="MKTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATG
FT                   ATGRNHGLLHSGARYAVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDELSFQ
FT                   ATFIRACEEAGIRAEAIDPQQARLIEPAVNPQLIGAVKVPDGTVDPFRLTAANMLDARE
FT                   HGAIILTAHEVTGLIREGATICGVNVHNHLTGESQSLHAPVVVNAAGIWGQRIAEYADL
FT                   SIRMFPAKGSLLIMDHRINQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSN
FT                   RVTAEEVDILLREGEKLAPVMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAA
FT                   RDGLDGFITITGGKLMTYRLMAEWATDAVCRKLGNTRPCVTAQTALPGSQEPTENTLKR
FT                   VISLPAPLRGSAVYRHGDRTPAWLSEGRQHRSLVCECEAVTAGEVQYAVENLTVNSLLD
FT                   LRRRTRVGMGTCQGELCACRAAGLLQRFNVTTAAQSITQLSAFLNERWKGVQPVAWGDA
FT                   LRESEFTRWVYQGLCGLEKEHQDEI"
FT   gene            518163..519521
FT                   /locus_tag="CKO_00537"
FT   CDS_pept        518163..519521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00537"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2271 Sugar phosphate permease; Psort
FT                   location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11693"
FT                   /db_xref="GOA:A8ADY0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY0"
FT                   /inference="protein motif:HMMPfam:IPR011701"
FT                   /inference="protein motif:HMMTigr:IPR000849"
FT                   /inference="protein motif:HMMTigr:IPR005267"
FT                   /inference="protein motif:ScanRegExp:IPR000849"
FT                   /inference="similar to AA sequence:REFSEQ:NP_461225.1"
FT                   /protein_id="ABV11693.1"
FT                   /translation="MLSIFKPAQHKTRLPAAEIDPTYRRLRWQIFLGIFFGYAAYYLVR
FT                   KNFALAMPYLVEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNC
FT                   AHNVGGGIPPLLFLLGMAWFNDWKAALYMPAFGAVLVAIFAFALMRDTPQSCGLPPIEE
FT                   YKNDYPDDYNEKAEEELTAKQIFMQYVLPNKLLWYIAIANVFVYLLRYGILDWSPTYLR
FT                   EVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATVVYW
FT                   LNPPGNPTVDMACMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDFFGWDGGFMVMIGGSVLAVILLIIVMIGEKRHHEELMLKRNGA"
FT   gene            519526..520596
FT                   /locus_tag="CKO_00538"
FT   CDS_pept        519526..520596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0582 2.9e-180 glpQ; glycerophosphoryl
FT                   diester phosphodiesterase periplasmic precursor K01126;
FT                   COG: COG0584 Glycerophosphoryl diester phosphodiesterase;
FT                   Psort location: Periplasmic, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11694"
FT                   /db_xref="GOA:A8ADY1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY1"
FT                   /inference="protein motif:HMMPanther:IPR004129"
FT                   /inference="protein motif:HMMPfam:IPR004129"
FT                   /inference="similar to AA sequence:INSD:AAL21183.1"
FT                   /protein_id="ABV11694.1"
FT                   /translation="MKTTLKNLSVALMLAGMVVSSAAIAADKIVIAHRGASGYLPEHTL
FT                   PAKAMAYAQGADYLEQDLVMTKDDHLVVLHDHYLDRVTDVAERFPNRARKDGRYYAIDF
FT                   TLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNI
FT                   GIYPEIKAPWFHHQEGKDIAAKTLDVLKKYGYTGKKDNVYLQCFDAAELKRIKNELEPK
FT                   RGMDLNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKEIASYADGIGPDYHML
FT                   IDEKSKVGHITLTGMVKEAQQNKMVVHPYTVRADQLPDYATDVNQLYDILYNKAGVDGL
FT                   FTDFPDKAVVFLKDKH"
FT   gene            complement(520686..520940)
FT                   /locus_tag="CKO_00539"
FT   CDS_pept        complement(520686..520940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ype:YPO3116 1.4e-08 ddhD, ascD, rfbI;
FT                   CDP-6-deoxy-delta-3,4-glucoseen reductase K00523; COG:
FT                   COG0633 Ferredoxin; Psort location: Cytoplasmic,
FT                   score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11695"
FT                   /db_xref="GOA:A8ADY2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY2"
FT                   /inference="protein motif:Gene3D:IPR012675"
FT                   /inference="protein motif:HMMPfam:IPR001041"
FT                   /inference="protein motif:ScanRegExp:IPR006058"
FT                   /inference="protein motif:superfamily:IPR001041"
FT                   /inference="similar to AA sequence:REFSEQ:YP_001177519.1"
FT                   /protein_id="ABV11695.1"
FT                   /translation="MGRVTLRLSGTEVLCREEHPSLLVALEAHQVEVEYQCRAGYCGSC
FT                   RCRLVAGQVDWLTEPLAFISEGEILPCCCRAKGDIEIEM"
FT   gene            complement(520940..522070)
FT                   /locus_tag="CKO_00540"
FT   CDS_pept        complement(520940..522070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stm:STM2278 2.3e-196 nrdB;
FT                   ribonucleoside-diphosphate reductase 1, beta subunit
FT                   K00526; COG: COG0208 Ribonucleotide reductase, beta
FT                   subunit; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11696"
FT                   /db_xref="GOA:A8ADY3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY3"
FT                   /inference="protein motif:Gene3D:IPR012348"
FT                   /inference="protein motif:HMMPfam:IPR000358"
FT                   /inference="protein motif:ScanRegExp:IPR000358"
FT                   /inference="protein motif:superfamily:IPR009078"
FT                   /inference="similar to AA sequence:INSD:AAX66187.1"
FT                   /protein_id="ABV11696.1"
FT                   /translation="MAYTTFSQTKNDQLKEPMFFGQPVNVARYDQQKYDIFEKLIEKQL
FT                   SFFWRPEEVDVSRDRIDFQSLPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPE
FT                   LETWVETWAFSETIHSRSYTHIIRNIVNDPAVVFDDIVTNEQIQKRAEGISHYYDELIE
FT                   MTSYWHLLGEGTHNVNGKTVTVNLRALKKQLYLCLMSVNALEAIRFYVSFACSFAFAER
FT                   KLMEGNAKIIRLIARDEALHLTGTQHMLNLLRSGIDDPEMAEIAEESKQACYDLFVQAA
FT                   QQEKEWADYLFRDGSMIGLNKDILCQYVEYITNIRMQAVGLELPFQTRSNPIPWINTWL
FT                   VSDNVQVAPQEVEVSSYLVGQIDSEVDTDDLSNFQL"
FT   gene            complement(522173..524458)
FT                   /locus_tag="CKO_00541"
FT   CDS_pept        complement(522173..524458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs3117 0. ribonucleoside diphosphate
FT                   reductase 1 alpha subunit K00525; COG: COG0209
FT                   Ribonucleotide reductase, alpha subunit; Psort location:
FT                   Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11697"
FT                   /db_xref="GOA:A8ADY4"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY4"
FT                   /inference="protein motif:HMMPanther:IPR000788"
FT                   /inference="protein motif:HMMPfam:IPR000788"
FT                   /inference="protein motif:HMMPfam:IPR005144"
FT                   /inference="protein motif:HMMPfam:IPR013509"
FT                   /inference="protein motif:HMMTigr:IPR013346"
FT                   /inference="protein motif:ScanRegExp:IPR000788"
FT                   /inference="protein motif:superfamily:IPR008926"
FT                   /protein_id="ABV11697.1"
FT                   /translation="MNQSLLVTKRDGRTERINLDKIHRVLDWAAEGLNNVSISQVELRS
FT                   HIQFYDGIKTSDIHETIIKAAADLISRDAPDYQYLAARLAIFHLRKKAYGEFEPPALYD
FT                   HVVKMVELGKYDNHLLEDYTEEEFKQMDSFIVHDRDMTFSYAAVKQLEGKYLVQNRVTG
FT                   EIYESAQFLYILVAACLFSNYPRETRLDYVKRFYDAVSTFKISLPTPIMSGVRTPTRQF
FT                   SSCVLIECGDSLDSINATSSAIVKYVSQRAGIGINAGRIRALGSPIRGGEAFHTGCIPF
FT                   YKHFQTAVKSCSQGGVRGGAATLFYPMWHLEVESLLVLKNNRGVEGNRVRHMDYGVQIN
FT                   KLMYTRLLKGEDITLFSPSDVPGLYDAFFADQDEFERLYTKYEKDDSIRKQRVKAVDLF
FT                   SLMMQERASTGRIYIQNVDHCNTHSPFDAQVAPVRQSNLCLEIALPTKPLMDVNDENGE
FT                   IALCTLSAFNLGAINSLDELEELAVLAVRALDALLDYQDYPIPAAKRGAMGRRTLGIGV
FT                   INYAYYLAKHGVRYSDGSANNLTHKTFEAIQYYLLKASNELAKEQGACPWFNETTYAQG
FT                   ILPIDTYKKDLDAIANEALHYNWEALRESIKTHGLRNSTLSALMPSETSSQISNATNGI
FT                   EPPRGHVSIKASKDGVLRQVVPDYEGLKDRYELLWEMPSNDGYLQLVGIMQKFIDQAIS
FT                   ANTNYDPTRFPSGKVPMQQLLKDLLTAYKFGVKTLYYHNTRDGAEDAQDDLVPSIQDDG
FT                   CESGACKI"
FT   gene            complement(524899..525627)
FT                   /locus_tag="CKO_00542"
FT   CDS_pept        complement(524899..525627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00542"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2513 1.8e-123 ubiG; UbiG, subunit
FT                   of 3-demethylubiquinone 3-methyltransferase /
FT                   2-octaprenyl-6-hydroxyphenol methylase K00568; COG: COG2227
FT                   2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol
FT                   methylase; Psort location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11698"
FT                   /db_xref="GOA:A8ADY5"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8ADY5"
FT                   /inference="protein motif:HMMPfam:IPR013216"
FT                   /inference="protein motif:HMMTigr:IPR010233"
FT                   /inference="similar to AA sequence:INSD:BAA16049.1"
FT                   /protein_id="ABV11698.1"
FT                   /translation="MNAEKPPVTHNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRL
FT                   GYIAERSGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQ
FT                   VDYVQETVEEHAAKHAHQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGEVFFSTLNRN
FT                   GKSWLMAVVGAEYILRMVPKGTHDVKKFIKPAELLNWVDQTVLKERHMTGLHYNPITNT
FT                   FKLGPGVDVNYMVHTTAQVD"
FT   gene            525787..528423
FT                   /locus_tag="CKO_00543"
FT   CDS_pept        525787..528423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA0592 0. gyrA; DNA gyrase subunit A
FT                   K02469; COG: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II, topoisomerase IV), A subunit; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11699"
FT                   /db_xref="GOA:A8ADY6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY6"
FT                   /inference="protein motif:BlastProDom:IPR002205"
FT                   /inference="protein motif:Gene3D:IPR013758"
FT                   /inference="protein motif:HMMPfam:IPR002205"
FT                   /inference="protein motif:HMMPfam:IPR006691"
FT                   /inference="protein motif:HMMSmart:IPR002205"
FT                   /inference="protein motif:HMMTigr:IPR005743"
FT                   /inference="protein motif:superfamily:IPR013760"
FT                   /protein_id="ABV11699.1"
FT                   /translation="MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVH
FT                   RRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVD
FT                   GQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKI
FT                   PNLLVNGSSGIAVGMATNIPPHNLKEVINGCLAYIDDEDISIEGLMEYIPGPDFPTAAI
FT                   INGRRGIEEAYRTGRGKVYIRARAEVEADAKTGRETIIVHEIPYQVNKARLIEKIAELV
FT                   KDKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHG
FT                   QPKIMNLKEIISAFVRHRREVVTRRTIFELRKARDRAHILEALAIALANIDPIIEMIRR
FT                   APTPAEAKAALISRSWDLGNVASMLERAGDDAARPEWLEPEFGVRDGQYYLTEQQAQAI
FT                   LDLRLQKLTGLEHEKLLDEYKELLEQIAELLHILGSADRLMEVIREEMELIRDQFGDER
FT                   RTEITANSADINIEDLISQEDVVVTLSHQGYVKYQPLTDYEAQRRGGKGKSAARIKEED
FT                   FIDRLLVANTHDTILCFSSRGRLYWMKVYQLPEASRGARGRPIVNLLPLEADERITAIL
FT                   PVREYEEGVNVFMATASGTVKKTALTEFSRPRSAGIIAVNLNEGDELIGVDLTSGSDEV
FT                   MLFSAAGKVVRFKEDAVRAMGRTATGVRGIKLAGEDSVVSLIIPRGEGAILTVTQNGYG
FT                   KRTAEGEYPTKSRGTQGVISIKVTERNGSVVGAVQVDDADQIMMITDAGTLVRTRVSEI
FT                   SVVGRNTQGVILIRTAEDENVVGLQRVAEPVDDEELDSIDGSVAEGDEDIAPEAETDDD
FT                   AADDADE"
FT   gene            complement(528532..529716)
FT                   /locus_tag="CKO_00545"
FT   CDS_pept        complement(528532..529716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2506 4.2e-181 atoB; acetyl-CoA
FT                   acetyltransferase K00626; COG: COG0183 Acetyl-CoA
FT                   acetyltransferase; Psort location: Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11701"
FT                   /db_xref="GOA:A8ADY7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY7"
FT                   /inference="protein motif:HMMPanther:IPR002155"
FT                   /inference="protein motif:HMMPfam:IPR002155"
FT                   /inference="protein motif:HMMTigr:IPR002155"
FT                   /inference="protein motif:ScanRegExp:IPR002155"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00736687.1"
FT                   /protein_id="ABV11701.1"
FT                   /translation="MKNCVIVSAARTAIGSFNGALATTSAIDLGATVIKAALERAQLDP
FT                   QRVDEVIMGNVLQAGLGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAIQA
FT                   GQAQAIVAGGMENMSQAPYLLDAKARWGYRLGDGQLSDVILRDGLICATHGYHMGITAE
FT                   NVAREYGISREMQDELALLSQRKAVAAIDSGAFQAEIVPVSVTSRKKTVVFERDEFPKA
FT                   DSTAEGLAALRPAFDKAGTVTAGNASGINDGAAALVVMEESAALAAGLTPLARIKAYAS
FT                   GGVAPALMGMGPVPATQKALQLSGLTLSDIDLIEANEAFAAQFLAVGKTLGFDPQKVNV
FT                   NGGAIALGHPIGASGARILVTLLHALSAHDKTLGLATLCIGGGQGIAMIVERMN"
FT   gene            529637..529810
FT                   /locus_tag="CKO_00544"
FT   CDS_pept        529637..529810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11700"
FT                   /db_xref="GOA:A8ADY8"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY8"
FT                   /protein_id="ABV11700.1"
FT                   /translation="MALVVASAPLKLPIAVRAALTMTQFFIFCSLKVRGCRQKKVKPMT
FT                   KMIPEKSRAVMQ"
FT   gene            complement(529747..531069)
FT                   /locus_tag="CKO_00546"
FT   CDS_pept        complement(529747..531069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00546"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2031 Short chain fatty acids transporter;
FT                   Psort location: CytoplasmicMembrane, score:10.00"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11702"
FT                   /db_xref="GOA:A8ADY9"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="InterPro:IPR006161"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADY9"
FT                   /inference="protein motif:BlastProDom:IPR006160"
FT                   /inference="protein motif:HMMPfam:IPR006160"
FT                   /inference="protein motif:HMMTigr:IPR006161"
FT                   /inference="similar to AA sequence:INSD:ABJ01616.1"
FT                   /protein_id="ABV11702.1"
FT                   /translation="MIGRISRFMTRVVSRWLPDPLIFAMLLTLLTFGIALWLTPQTPVS
FT                   MVRFWGDGFWNLLAFGMQMALIIVTGHALASSGPVKSLLRTAASAAKTPAQGVMLVTFF
FT                   GSVACVINWGFGLVVGAMFAREVARRVPGSDYPLLIACAYIGFLTWGGGFSGSMPLLAA
FT                   TPGNPVEHVAGLIPVSDTLFTGFNIFITLGLIVVMPFITRMMTPKPSDVVSIDPKLLLE
FT                   EADFQKKLPADAPPSEKLEESRILALIIGALGIAYLGLYFAEKGFNITINTVNLMFMIA
FT                   GLLLHKTPMAYMRAISAAARSTAGILVQFPFYAGIQLMMEHSGLGGLITEFFINVANKD
FT                   TFPVMTFFSSALINFAVPSGGGHWVIQGPFVMPAAQALGADLGKSVMAIAYGEQWMNMA
FT                   QPFWALPALAIAGLGVRDIMGYCITALLFSGIIFVIGLTFF"
FT   gene            complement(531066..531716)
FT                   /locus_tag="CKO_00547"
FT   CDS_pept        complement(531066..531716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2504 1.0e-106 atoA; acetate
FT                   CoA-transferase beta subunit K01035; COG: COG2057 Acyl
FT                   CoA:acetate/3-ketoacid CoA transferase, beta subunit; Psort
FT                   location: Cytoplasmic, score:8.96"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11703"
FT                   /db_xref="GOA:A8ADZ0"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADZ0"
FT                   /inference="protein motif:HMMPanther:IPR004165"
FT                   /inference="protein motif:HMMPfam:IPR004165"
FT                   /inference="protein motif:HMMTigr:IPR012791"
FT                   /inference="protein motif:ScanRegExp:IPR004164"
FT                   /inference="similar to AA sequence:INSD:AAN81219.1"
FT                   /protein_id="ABV11703.1"
FT                   /translation="MDAKQRIARRVAQELHDGDVVNLGIGLPTMVANYLPDDIHITLQS
FT                   ENGFLGLGPVTTAHPDLVNAGGQPCGILPGAAMFDSAMSFALIRGGHVDACVLGGLQVD
FT                   EQANLANWVVPGKMVPGMGGAMDLVTGARKVIIAMEHCAKDGSAKILRQCTMPLTAQHA
FT                   VHMLVTELAVFRFIDGKMWLTEIAEGCDLETLRAKTEAHFEVAADLVIQRGDA"
FT   gene            complement(531716..532396)
FT                   /locus_tag="CKO_00548"
FT   CDS_pept        complement(531716..532396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2221 1.1e-102 atoD;
FT                   acetyl-CoA:acetoacetyl-CoA transferase alpha subunit
FT                   K01034; COG: COG1788 Acyl CoA:acetate/3-ketoacid CoA
FT                   transferase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11704"
FT                   /db_xref="GOA:A8ADZ1"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADZ1"
FT                   /inference="protein motif:HMMPanther:IPR004165"
FT                   /inference="protein motif:HMMPfam:IPR004165"
FT                   /inference="protein motif:HMMTigr:IPR012792"
FT                   /inference="protein motif:ScanRegExp:IPR004163"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00736690.1"
FT                   /protein_id="ABV11704.1"
FT                   /translation="MQKGNIMKTKLITLQNASGFFRDGMTIMVGGFMGVGTPPRLVEAL
FT                   LESGVRDLTLIANDTAFVDTGIGPLIVNGRVRKVIASHIGTNPETGRRMIAKEMEVQLV
FT                   PQGTLIEQIRCGGAGLGGFLTPTGVGTVVEEGKQTLQLDGRTWLLERPLRADLALIRAH
FT                   CADPLGNLTYQLSARNFNPLIALAADITLVEPDEMVETGDLLPDQIVTPGAVIDHIVIP
FT                   QESK"
FT   gene            complement(532576..533961)
FT                   /locus_tag="CKO_00549"
FT   CDS_pept        complement(532576..533961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eci:UTI89_C2502 3.6e-207 atoC; acetoacetate
FT                   metabolism regulatory protein AtoC K07714; COG: COG2204
FT                   Response regulator containing CheY-like receiver, AAA-type
FT                   ATPase, and DNA-binding domains; Psort location:
FT                   Cytoplasmic, score:9.97"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11705"
FT                   /db_xref="GOA:A8ADZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADZ2"
FT                   /inference="protein motif:BlastProDom:IPR001789"
FT                   /inference="protein motif:Gene3D:IPR012287"
FT                   /inference="protein motif:HMMPfam:IPR001789"
FT                   /inference="protein motif:HMMPfam:IPR002078"
FT                   /inference="protein motif:HMMPfam:IPR002197"
FT                   /inference="protein motif:HMMSmart:IPR001789"
FT                   /inference="protein motif:HMMSmart:IPR003593"
FT                   /inference="protein motif:ScanRegExp:IPR002078"
FT                   /inference="protein motif:superfamily:IPR009057"
FT                   /inference="protein motif:superfamily:IPR011006"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_01698342.1"
FT                   /protein_id="ABV11705.1"
FT                   /translation="MKTRYRILIVDDEDNVRRMLATAFSLQGHETQCASNGQTALQHFA
FT                   DAPPDVVLMDIRMPEMNGIEALKVMRAQHPRVPIILMTAYAEVETAVEALRSGAFDYVI
FT                   KPFDLDELNLLIQRALQLQAMKQEIRSLHQALSTSWQWGHILTNSPGMMDICKDTAKIA
FT                   LSQANVLISGESGTGKELIARAIHYNSRRANGPFIKINCAALPESLLESELFGHEKGAF
FT                   TGAQTRRQGLFERAHQGTLLLDEIGEMPLVLQAKLLRILQEREFERIGGHQTIQVDIRI
FT                   VAATNRNLQEMVKEGTFREDLFYRLNVIHLTLPPLRERREDIPLLANHFLQKFSSENQR
FT                   DIIEIDPSAMSLLTAWPWPGNIRELSNVIERAVVMNTGAVIFAEDLPTQFRQSVSHASG
FT                   IKPAQPGERNLKEEIKREERRIIMEVLEQQEGNRTRTALMLGISRRALMYKLQEYGIDP
FT                   AGL"
FT   gene            complement(533958..535739)
FT                   /locus_tag="CKO_00550"
FT   CDS_pept        complement(533958..535739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eco:b2219 2.3e-251 atoS; sensor protein AtoS
FT                   for response regulator AtoC K07710; COG: COG2202 FOG:
FT                   PAS/PAC domain; Psort location: CytoplasmicMembrane,
FT                   score:9.82"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11706"
FT                   /db_xref="GOA:A8ADZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADZ3"
FT                   /inference="protein motif:Gene3D:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003594"
FT                   /inference="protein motif:HMMPfam:IPR003660"
FT                   /inference="protein motif:HMMPfam:IPR003661"
FT                   /inference="protein motif:HMMPfam:IPR013767"
FT                   /inference="protein motif:HMMSmart:IPR000014"
FT                   /inference="protein motif:HMMSmart:IPR003594"
FT                   /inference="protein motif:HMMSmart:IPR003661"
FT                   /inference="protein motif:HMMTigr:IPR000014"
FT                   /inference="protein motif:superfamily:IPR003594"
FT                   /inference="protein motif:superfamily:IPR009082"
FT                   /inference="similar to AA sequence:REFSEQ:ZP_00706332.1"
FT                   /protein_id="ABV11706.1"
FT                   /translation="MILMAILMVIVPTFSIGYIVETEGRSAVLSEKEKKLSAVVHLLDE
FT                   ALGDSFNQQENLPRDERIRALNAQLSPVTERITRAFPGIGAGYYNKALDAIITYAPSAL
FT                   YQNNVGVTIAPDHPGREVMSTNAPVVFSGRQVRGDILNSMIPIARHGEVIGYIWANELT
FT                   EDIRRQAWKMDVRIIAVLAAGLISSLLLIILFSRRLSANIDIITEGLPTLAQKTPAQLP
FT                   DLPGELGQISRSVNALAQTLRETKTLNDLIIENAADGVIAIDRQGNVTTMNPAAETITG
FT                   YTLHELAGRPYSTLFADPHFSSPVLDTLENGTEHLAQEVSFPARDRTIELSVTTSRIHN
FT                   ADGELIGALVMFSDLTARKEAQRRLAQTERLATLGELMAGVAHEVRNPLTAIRGYVQII
FT                   RQQINLPVHQEYLSVVLKEIDSINKVIQQLLDFSRPRQSQWQQVSINTLIEEALILVQT
FT                   SGVQARINFNTEFNAALPTIVADRELLKQVLLNMLINAVQAIGARGEIRIRTWRYTTTH
FT                   LAIAIEDNGCGIDVALQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIYVTSMPGCG
FT                   ATFTLILPINPQETSSE"
FT   gene            535832..536092
FT                   /locus_tag="CKO_00551"
FT   CDS_pept        535832..536092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CKO_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV11707"
FT                   /db_xref="UniProtKB/TrEMBL:A8ADZ4"
FT                   /protein_id="ABV11707.1"
FT                   /translation="MRRRFLSGISYSRKERALRRRAFTATLTTLYLSPEAELRPFEIPC
FT                   FLSYNPESFALPVQSVGVTDLAADRFCFGVLHRQCAASERV"
FT   gene            535953..538799
FT                   /locus_tag="CKO_00552"
FT   CDS_pept        535953..538799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CKO_00552