(data stored in ACNUC7421 zone)

EMBL: CP000826

ID   CP000826; SV 1; circular; genomic DNA; STD; PRO; 5448853 BP.
XX
AC   CP000826; AAUN01000000-AAUN01000061;
XX
PR   Project:PRJNA17459;
XX
DT   19-SEP-2007 (Rel. 93, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Serratia proteamaculans 568, complete genome.
XX
KW   .
XX
OS   Serratia proteamaculans 568
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Serratia.
XX
RN   [1]
RP   1-5448853
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Taghavi S., Newman L.,
RA   Vangronsveld J., van der Lelie D., Richardson P.;
RT   "Complete sequence of chromosome of Serratia proteamaculans 568";
RL   Unpublished.
XX
RN   [2]
RP   1-5448853
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Taghavi S., Newman L.,
RA   Vangronsveld J., van der Lelie D., Richardson P.;
RT   ;
RL   Submitted (12-SEP-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c86bc1b54985e2b22eab55b81c1f8b91.
DR   BioSample; SAMN02598393.
DR   EnsemblGenomes-Gn; EBG00001098312.
DR   EnsemblGenomes-Gn; EBG00001098313.
DR   EnsemblGenomes-Gn; EBG00001098314.
DR   EnsemblGenomes-Gn; EBG00001098315.
DR   EnsemblGenomes-Gn; EBG00001098316.
DR   EnsemblGenomes-Gn; EBG00001098317.
DR   EnsemblGenomes-Gn; EBG00001098318.
DR   EnsemblGenomes-Gn; EBG00001098319.
DR   EnsemblGenomes-Gn; EBG00001098320.
DR   EnsemblGenomes-Gn; EBG00001098321.
DR   EnsemblGenomes-Gn; EBG00001098322.
DR   EnsemblGenomes-Gn; EBG00001098323.
DR   EnsemblGenomes-Gn; EBG00001098324.
DR   EnsemblGenomes-Gn; EBG00001098325.
DR   EnsemblGenomes-Gn; EBG00001098326.
DR   EnsemblGenomes-Gn; EBG00001098327.
DR   EnsemblGenomes-Gn; EBG00001098328.
DR   EnsemblGenomes-Gn; EBG00001098329.
DR   EnsemblGenomes-Gn; EBG00001098330.
DR   EnsemblGenomes-Gn; EBG00001098331.
DR   EnsemblGenomes-Gn; EBG00001098332.
DR   EnsemblGenomes-Gn; EBG00001098333.
DR   EnsemblGenomes-Gn; EBG00001098334.
DR   EnsemblGenomes-Gn; EBG00001098335.
DR   EnsemblGenomes-Gn; EBG00001098336.
DR   EnsemblGenomes-Gn; EBG00001098337.
DR   EnsemblGenomes-Gn; EBG00001098338.
DR   EnsemblGenomes-Gn; EBG00001098339.
DR   EnsemblGenomes-Gn; EBG00001098340.
DR   EnsemblGenomes-Gn; EBG00001098341.
DR   EnsemblGenomes-Gn; EBG00001098342.
DR   EnsemblGenomes-Gn; EBG00001098343.
DR   EnsemblGenomes-Gn; EBG00001098344.
DR   EnsemblGenomes-Gn; EBG00001098345.
DR   EnsemblGenomes-Gn; EBG00001098346.
DR   EnsemblGenomes-Gn; EBG00001098347.
DR   EnsemblGenomes-Gn; EBG00001098348.
DR   EnsemblGenomes-Gn; EBG00001098349.
DR   EnsemblGenomes-Gn; EBG00001098350.
DR   EnsemblGenomes-Gn; EBG00001098351.
DR   EnsemblGenomes-Gn; EBG00001098352.
DR   EnsemblGenomes-Gn; EBG00001098353.
DR   EnsemblGenomes-Gn; EBG00001098354.
DR   EnsemblGenomes-Gn; EBG00001098355.
DR   EnsemblGenomes-Gn; EBG00001098356.
DR   EnsemblGenomes-Gn; EBG00001098357.
DR   EnsemblGenomes-Gn; EBG00001098358.
DR   EnsemblGenomes-Gn; EBG00001098359.
DR   EnsemblGenomes-Gn; EBG00001098360.
DR   EnsemblGenomes-Gn; EBG00001098361.
DR   EnsemblGenomes-Gn; EBG00001098362.
DR   EnsemblGenomes-Gn; EBG00001098363.
DR   EnsemblGenomes-Gn; EBG00001098364.
DR   EnsemblGenomes-Gn; EBG00001098365.
DR   EnsemblGenomes-Gn; EBG00001098366.
DR   EnsemblGenomes-Gn; EBG00001098367.
DR   EnsemblGenomes-Gn; EBG00001098368.
DR   EnsemblGenomes-Gn; EBG00001098369.
DR   EnsemblGenomes-Gn; EBG00001098370.
DR   EnsemblGenomes-Gn; EBG00001098371.
DR   EnsemblGenomes-Gn; EBG00001098372.
DR   EnsemblGenomes-Gn; EBG00001098373.
DR   EnsemblGenomes-Gn; EBG00001098374.
DR   EnsemblGenomes-Gn; EBG00001098375.
DR   EnsemblGenomes-Gn; EBG00001098376.
DR   EnsemblGenomes-Gn; EBG00001098377.
DR   EnsemblGenomes-Gn; EBG00001098378.
DR   EnsemblGenomes-Gn; EBG00001098379.
DR   EnsemblGenomes-Gn; EBG00001098380.
DR   EnsemblGenomes-Gn; EBG00001098381.
DR   EnsemblGenomes-Gn; EBG00001098382.
DR   EnsemblGenomes-Gn; EBG00001098383.
DR   EnsemblGenomes-Gn; EBG00001098384.
DR   EnsemblGenomes-Gn; EBG00001098385.
DR   EnsemblGenomes-Gn; EBG00001098386.
DR   EnsemblGenomes-Gn; EBG00001098387.
DR   EnsemblGenomes-Gn; EBG00001098388.
DR   EnsemblGenomes-Gn; EBG00001098389.
DR   EnsemblGenomes-Gn; EBG00001098390.
DR   EnsemblGenomes-Gn; EBG00001098391.
DR   EnsemblGenomes-Gn; EBG00001098392.
DR   EnsemblGenomes-Gn; EBG00001098393.
DR   EnsemblGenomes-Gn; EBG00001098394.
DR   EnsemblGenomes-Gn; EBG00001098395.
DR   EnsemblGenomes-Gn; EBG00001098396.
DR   EnsemblGenomes-Gn; EBG00001098397.
DR   EnsemblGenomes-Gn; EBG00001098398.
DR   EnsemblGenomes-Gn; EBG00001098399.
DR   EnsemblGenomes-Gn; EBG00001098400.
DR   EnsemblGenomes-Gn; EBG00001098401.
DR   EnsemblGenomes-Gn; EBG00001098402.
DR   EnsemblGenomes-Gn; EBG00001098403.
DR   EnsemblGenomes-Gn; EBG00001098404.
DR   EnsemblGenomes-Gn; EBG00001098405.
DR   EnsemblGenomes-Gn; EBG00001098406.
DR   EnsemblGenomes-Gn; EBG00001098407.
DR   EnsemblGenomes-Gn; EBG00001098408.
DR   EnsemblGenomes-Gn; EBG00001098409.
DR   EnsemblGenomes-Gn; EBG00001098410.
DR   EnsemblGenomes-Gn; EBG00001098411.
DR   EnsemblGenomes-Gn; EBG00001098412.
DR   EnsemblGenomes-Gn; EBG00001098413.
DR   EnsemblGenomes-Gn; EBG00001098414.
DR   EnsemblGenomes-Gn; EBG00001098415.
DR   EnsemblGenomes-Gn; EBG00001098416.
DR   EnsemblGenomes-Gn; EBG00001098417.
DR   EnsemblGenomes-Gn; EBG00001098418.
DR   EnsemblGenomes-Gn; EBG00001098419.
DR   EnsemblGenomes-Gn; EBG00001098420.
DR   EnsemblGenomes-Gn; EBG00001098421.
DR   EnsemblGenomes-Gn; EBG00001098422.
DR   EnsemblGenomes-Gn; EBG00001098423.
DR   EnsemblGenomes-Gn; EBG00001098424.
DR   EnsemblGenomes-Gn; EBG00001098425.
DR   EnsemblGenomes-Gn; EBG00001098426.
DR   EnsemblGenomes-Gn; EBG00001098427.
DR   EnsemblGenomes-Gn; EBG00001098428.
DR   EnsemblGenomes-Gn; EBG00001098429.
DR   EnsemblGenomes-Gn; EBG00001098430.
DR   EnsemblGenomes-Gn; EBG00001098431.
DR   EnsemblGenomes-Gn; EBG00001098432.
DR   EnsemblGenomes-Gn; EBG00001098433.
DR   EnsemblGenomes-Gn; EBG00001098434.
DR   EnsemblGenomes-Gn; EBG00001098435.
DR   EnsemblGenomes-Gn; EBG00001098436.
DR   EnsemblGenomes-Gn; EBG00001098437.
DR   EnsemblGenomes-Gn; EBG00001098438.
DR   EnsemblGenomes-Gn; EBG00001098439.
DR   EnsemblGenomes-Gn; EBG00001098440.
DR   EnsemblGenomes-Gn; EBG00001098441.
DR   EnsemblGenomes-Gn; EBG00001098442.
DR   EnsemblGenomes-Gn; EBG00001098443.
DR   EnsemblGenomes-Gn; EBG00001098444.
DR   EnsemblGenomes-Gn; EBG00001098445.
DR   EnsemblGenomes-Gn; EBG00001098446.
DR   EnsemblGenomes-Gn; EBG00001098447.
DR   EnsemblGenomes-Gn; EBG00001098448.
DR   EnsemblGenomes-Gn; EBG00001098449.
DR   EnsemblGenomes-Gn; EBG00001098450.
DR   EnsemblGenomes-Gn; EBG00001098451.
DR   EnsemblGenomes-Gn; EBG00001098452.
DR   EnsemblGenomes-Gn; EBG00001098453.
DR   EnsemblGenomes-Gn; EBG00001098454.
DR   EnsemblGenomes-Gn; EBG00001098455.
DR   EnsemblGenomes-Gn; EBG00001098456.
DR   EnsemblGenomes-Gn; EBG00001098457.
DR   EnsemblGenomes-Gn; EBG00001098458.
DR   EnsemblGenomes-Gn; EBG00001098459.
DR   EnsemblGenomes-Gn; EBG00001098460.
DR   EnsemblGenomes-Gn; EBG00001098461.
DR   EnsemblGenomes-Gn; EBG00001098462.
DR   EnsemblGenomes-Gn; EBG00001098463.
DR   EnsemblGenomes-Gn; EBG00001098464.
DR   EnsemblGenomes-Gn; EBG00001098465.
DR   EnsemblGenomes-Gn; EBG00001098466.
DR   EnsemblGenomes-Gn; EBG00001098467.
DR   EnsemblGenomes-Gn; EBG00001098468.
DR   EnsemblGenomes-Gn; EBG00001098469.
DR   EnsemblGenomes-Gn; EBG00001098470.
DR   EnsemblGenomes-Gn; EBG00001098471.
DR   EnsemblGenomes-Gn; EBG00001098472.
DR   EnsemblGenomes-Gn; EBG00001098473.
DR   EnsemblGenomes-Gn; EBG00001098474.
DR   EnsemblGenomes-Gn; EBG00001098475.
DR   EnsemblGenomes-Gn; EBG00001098476.
DR   EnsemblGenomes-Gn; EBG00001098477.
DR   EnsemblGenomes-Gn; EBG00001098478.
DR   EnsemblGenomes-Gn; EBG00001098479.
DR   EnsemblGenomes-Gn; EBG00001098480.
DR   EnsemblGenomes-Gn; EBG00001098481.
DR   EnsemblGenomes-Gn; Spro_R0001.
DR   EnsemblGenomes-Gn; Spro_R0002.
DR   EnsemblGenomes-Gn; Spro_R0003.
DR   EnsemblGenomes-Gn; Spro_R0004.
DR   EnsemblGenomes-Gn; Spro_R0005.
DR   EnsemblGenomes-Gn; Spro_R0006.
DR   EnsemblGenomes-Gn; Spro_R0007.
DR   EnsemblGenomes-Gn; Spro_R0008.
DR   EnsemblGenomes-Gn; Spro_R0009.
DR   EnsemblGenomes-Gn; Spro_R0010.
DR   EnsemblGenomes-Gn; Spro_R0011.
DR   EnsemblGenomes-Gn; Spro_R0012.
DR   EnsemblGenomes-Gn; Spro_R0013.
DR   EnsemblGenomes-Gn; Spro_R0014.
DR   EnsemblGenomes-Gn; Spro_R0015.
DR   EnsemblGenomes-Gn; Spro_R0016.
DR   EnsemblGenomes-Gn; Spro_R0017.
DR   EnsemblGenomes-Gn; Spro_R0018.
DR   EnsemblGenomes-Gn; Spro_R0019.
DR   EnsemblGenomes-Gn; Spro_R0020.
DR   EnsemblGenomes-Gn; Spro_R0021.
DR   EnsemblGenomes-Gn; Spro_R0022.
DR   EnsemblGenomes-Gn; Spro_R0023.
DR   EnsemblGenomes-Gn; Spro_R0024.
DR   EnsemblGenomes-Gn; Spro_R0025.
DR   EnsemblGenomes-Gn; Spro_R0026.
DR   EnsemblGenomes-Gn; Spro_R0027.
DR   EnsemblGenomes-Gn; Spro_R0028.
DR   EnsemblGenomes-Gn; Spro_R0029.
DR   EnsemblGenomes-Gn; Spro_R0030.
DR   EnsemblGenomes-Gn; Spro_R0031.
DR   EnsemblGenomes-Gn; Spro_R0032.
DR   EnsemblGenomes-Gn; Spro_R0033.
DR   EnsemblGenomes-Gn; Spro_R0034.
DR   EnsemblGenomes-Gn; Spro_R0035.
DR   EnsemblGenomes-Gn; Spro_R0036.
DR   EnsemblGenomes-Gn; Spro_R0037.
DR   EnsemblGenomes-Gn; Spro_R0038.
DR   EnsemblGenomes-Gn; Spro_R0039.
DR   EnsemblGenomes-Gn; Spro_R0040.
DR   EnsemblGenomes-Gn; Spro_R0042.
DR   EnsemblGenomes-Gn; Spro_R0043.
DR   EnsemblGenomes-Gn; Spro_R0044.
DR   EnsemblGenomes-Gn; Spro_R0045.
DR   EnsemblGenomes-Gn; Spro_R0046.
DR   EnsemblGenomes-Gn; Spro_R0047.
DR   EnsemblGenomes-Gn; Spro_R0048.
DR   EnsemblGenomes-Gn; Spro_R0049.
DR   EnsemblGenomes-Gn; Spro_R0050.
DR   EnsemblGenomes-Gn; Spro_R0051.
DR   EnsemblGenomes-Gn; Spro_R0052.
DR   EnsemblGenomes-Gn; Spro_R0053.
DR   EnsemblGenomes-Gn; Spro_R0054.
DR   EnsemblGenomes-Gn; Spro_R0055.
DR   EnsemblGenomes-Gn; Spro_R0056.
DR   EnsemblGenomes-Gn; Spro_R0057.
DR   EnsemblGenomes-Gn; Spro_R0058.
DR   EnsemblGenomes-Gn; Spro_R0059.
DR   EnsemblGenomes-Gn; Spro_R0060.
DR   EnsemblGenomes-Gn; Spro_R0061.
DR   EnsemblGenomes-Gn; Spro_R0062.
DR   EnsemblGenomes-Gn; Spro_R0063.
DR   EnsemblGenomes-Gn; Spro_R0064.
DR   EnsemblGenomes-Gn; Spro_R0065.
DR   EnsemblGenomes-Gn; Spro_R0066.
DR   EnsemblGenomes-Gn; Spro_R0067.
DR   EnsemblGenomes-Gn; Spro_R0068.
DR   EnsemblGenomes-Gn; Spro_R0069.
DR   EnsemblGenomes-Gn; Spro_R0070.
DR   EnsemblGenomes-Gn; Spro_R0071.
DR   EnsemblGenomes-Gn; Spro_R0072.
DR   EnsemblGenomes-Gn; Spro_R0073.
DR   EnsemblGenomes-Gn; Spro_R0074.
DR   EnsemblGenomes-Gn; Spro_R0075.
DR   EnsemblGenomes-Gn; Spro_R0076.
DR   EnsemblGenomes-Gn; Spro_R0077.
DR   EnsemblGenomes-Gn; Spro_R0078.
DR   EnsemblGenomes-Gn; Spro_R0079.
DR   EnsemblGenomes-Gn; Spro_R0080.
DR   EnsemblGenomes-Gn; Spro_R0081.
DR   EnsemblGenomes-Gn; Spro_R0082.
DR   EnsemblGenomes-Gn; Spro_R0083.
DR   EnsemblGenomes-Gn; Spro_R0084.
DR   EnsemblGenomes-Gn; Spro_R0085.
DR   EnsemblGenomes-Gn; Spro_R0086.
DR   EnsemblGenomes-Gn; Spro_R0087.
DR   EnsemblGenomes-Gn; Spro_R0088.
DR   EnsemblGenomes-Gn; Spro_R0089.
DR   EnsemblGenomes-Gn; Spro_R0090.
DR   EnsemblGenomes-Gn; Spro_R0091.
DR   EnsemblGenomes-Gn; Spro_R0092.
DR   EnsemblGenomes-Gn; Spro_R0094.
DR   EnsemblGenomes-Gn; Spro_R0095.
DR   EnsemblGenomes-Gn; Spro_R0096.
DR   EnsemblGenomes-Gn; Spro_R0097.
DR   EnsemblGenomes-Gn; Spro_R0098.
DR   EnsemblGenomes-Gn; Spro_R0099.
DR   EnsemblGenomes-Gn; Spro_R0100.
DR   EnsemblGenomes-Gn; Spro_R0101.
DR   EnsemblGenomes-Gn; Spro_R0102.
DR   EnsemblGenomes-Gn; Spro_R0103.
DR   EnsemblGenomes-Gn; Spro_R0104.
DR   EnsemblGenomes-Gn; Spro_R0105.
DR   EnsemblGenomes-Gn; Spro_R0106.
DR   EnsemblGenomes-Gn; Spro_R0107.
DR   EnsemblGenomes-Gn; Spro_R0108.
DR   EnsemblGenomes-Gn; Spro_R0109.
DR   EnsemblGenomes-Tr; EBT00001552690.
DR   EnsemblGenomes-Tr; EBT00001552691.
DR   EnsemblGenomes-Tr; EBT00001552692.
DR   EnsemblGenomes-Tr; EBT00001552693.
DR   EnsemblGenomes-Tr; EBT00001552694.
DR   EnsemblGenomes-Tr; EBT00001552695.
DR   EnsemblGenomes-Tr; EBT00001552696.
DR   EnsemblGenomes-Tr; EBT00001552697.
DR   EnsemblGenomes-Tr; EBT00001552698.
DR   EnsemblGenomes-Tr; EBT00001552699.
DR   EnsemblGenomes-Tr; EBT00001552700.
DR   EnsemblGenomes-Tr; EBT00001552701.
DR   EnsemblGenomes-Tr; EBT00001552702.
DR   EnsemblGenomes-Tr; EBT00001552703.
DR   EnsemblGenomes-Tr; EBT00001552704.
DR   EnsemblGenomes-Tr; EBT00001552705.
DR   EnsemblGenomes-Tr; EBT00001552706.
DR   EnsemblGenomes-Tr; EBT00001552707.
DR   EnsemblGenomes-Tr; EBT00001552708.
DR   EnsemblGenomes-Tr; EBT00001552709.
DR   EnsemblGenomes-Tr; EBT00001552710.
DR   EnsemblGenomes-Tr; EBT00001552711.
DR   EnsemblGenomes-Tr; EBT00001552712.
DR   EnsemblGenomes-Tr; EBT00001552713.
DR   EnsemblGenomes-Tr; EBT00001552714.
DR   EnsemblGenomes-Tr; EBT00001552715.
DR   EnsemblGenomes-Tr; EBT00001552716.
DR   EnsemblGenomes-Tr; EBT00001552717.
DR   EnsemblGenomes-Tr; EBT00001552718.
DR   EnsemblGenomes-Tr; EBT00001552719.
DR   EnsemblGenomes-Tr; EBT00001552720.
DR   EnsemblGenomes-Tr; EBT00001552721.
DR   EnsemblGenomes-Tr; EBT00001552722.
DR   EnsemblGenomes-Tr; EBT00001552724.
DR   EnsemblGenomes-Tr; EBT00001552726.
DR   EnsemblGenomes-Tr; EBT00001552728.
DR   EnsemblGenomes-Tr; EBT00001552729.
DR   EnsemblGenomes-Tr; EBT00001552732.
DR   EnsemblGenomes-Tr; EBT00001552734.
DR   EnsemblGenomes-Tr; EBT00001552736.
DR   EnsemblGenomes-Tr; EBT00001552738.
DR   EnsemblGenomes-Tr; EBT00001552740.
DR   EnsemblGenomes-Tr; EBT00001552742.
DR   EnsemblGenomes-Tr; EBT00001552744.
DR   EnsemblGenomes-Tr; EBT00001552746.
DR   EnsemblGenomes-Tr; EBT00001552748.
DR   EnsemblGenomes-Tr; EBT00001552750.
DR   EnsemblGenomes-Tr; EBT00001552751.
DR   EnsemblGenomes-Tr; EBT00001552753.
DR   EnsemblGenomes-Tr; EBT00001552756.
DR   EnsemblGenomes-Tr; EBT00001552757.
DR   EnsemblGenomes-Tr; EBT00001552759.
DR   EnsemblGenomes-Tr; EBT00001552761.
DR   EnsemblGenomes-Tr; EBT00001552762.
DR   EnsemblGenomes-Tr; EBT00001552764.
DR   EnsemblGenomes-Tr; EBT00001552766.
DR   EnsemblGenomes-Tr; EBT00001552767.
DR   EnsemblGenomes-Tr; EBT00001552768.
DR   EnsemblGenomes-Tr; EBT00001552770.
DR   EnsemblGenomes-Tr; EBT00001552772.
DR   EnsemblGenomes-Tr; EBT00001552774.
DR   EnsemblGenomes-Tr; EBT00001552777.
DR   EnsemblGenomes-Tr; EBT00001552778.
DR   EnsemblGenomes-Tr; EBT00001552781.
DR   EnsemblGenomes-Tr; EBT00001552782.
DR   EnsemblGenomes-Tr; EBT00001552784.
DR   EnsemblGenomes-Tr; EBT00001552786.
DR   EnsemblGenomes-Tr; EBT00001552788.
DR   EnsemblGenomes-Tr; EBT00001552790.
DR   EnsemblGenomes-Tr; EBT00001552793.
DR   EnsemblGenomes-Tr; EBT00001552794.
DR   EnsemblGenomes-Tr; EBT00001552796.
DR   EnsemblGenomes-Tr; EBT00001552799.
DR   EnsemblGenomes-Tr; EBT00001552801.
DR   EnsemblGenomes-Tr; EBT00001552802.
DR   EnsemblGenomes-Tr; EBT00001552803.
DR   EnsemblGenomes-Tr; EBT00001552806.
DR   EnsemblGenomes-Tr; EBT00001552808.
DR   EnsemblGenomes-Tr; EBT00001552809.
DR   EnsemblGenomes-Tr; EBT00001552811.
DR   EnsemblGenomes-Tr; EBT00001552813.
DR   EnsemblGenomes-Tr; EBT00001552815.
DR   EnsemblGenomes-Tr; EBT00001552817.
DR   EnsemblGenomes-Tr; EBT00001552819.
DR   EnsemblGenomes-Tr; EBT00001552821.
DR   EnsemblGenomes-Tr; EBT00001552823.
DR   EnsemblGenomes-Tr; EBT00001552824.
DR   EnsemblGenomes-Tr; EBT00001552825.
DR   EnsemblGenomes-Tr; EBT00001552826.
DR   EnsemblGenomes-Tr; EBT00001552827.
DR   EnsemblGenomes-Tr; EBT00001552828.
DR   EnsemblGenomes-Tr; EBT00001552829.
DR   EnsemblGenomes-Tr; EBT00001552830.
DR   EnsemblGenomes-Tr; EBT00001552831.
DR   EnsemblGenomes-Tr; EBT00001552832.
DR   EnsemblGenomes-Tr; EBT00001552833.
DR   EnsemblGenomes-Tr; EBT00001552834.
DR   EnsemblGenomes-Tr; EBT00001552835.
DR   EnsemblGenomes-Tr; EBT00001552836.
DR   EnsemblGenomes-Tr; EBT00001552837.
DR   EnsemblGenomes-Tr; EBT00001552838.
DR   EnsemblGenomes-Tr; EBT00001552839.
DR   EnsemblGenomes-Tr; EBT00001552840.
DR   EnsemblGenomes-Tr; EBT00001552841.
DR   EnsemblGenomes-Tr; EBT00001552842.
DR   EnsemblGenomes-Tr; EBT00001552843.
DR   EnsemblGenomes-Tr; EBT00001552844.
DR   EnsemblGenomes-Tr; EBT00001552845.
DR   EnsemblGenomes-Tr; EBT00001552846.
DR   EnsemblGenomes-Tr; EBT00001552847.
DR   EnsemblGenomes-Tr; EBT00001552848.
DR   EnsemblGenomes-Tr; EBT00001552849.
DR   EnsemblGenomes-Tr; EBT00001552850.
DR   EnsemblGenomes-Tr; EBT00001552851.
DR   EnsemblGenomes-Tr; EBT00001552852.
DR   EnsemblGenomes-Tr; EBT00001552853.
DR   EnsemblGenomes-Tr; EBT00001552854.
DR   EnsemblGenomes-Tr; EBT00001552855.
DR   EnsemblGenomes-Tr; EBT00001552856.
DR   EnsemblGenomes-Tr; EBT00001552857.
DR   EnsemblGenomes-Tr; EBT00001552858.
DR   EnsemblGenomes-Tr; EBT00001552859.
DR   EnsemblGenomes-Tr; EBT00001552860.
DR   EnsemblGenomes-Tr; EBT00001552861.
DR   EnsemblGenomes-Tr; EBT00001552862.
DR   EnsemblGenomes-Tr; EBT00001552863.
DR   EnsemblGenomes-Tr; EBT00001552864.
DR   EnsemblGenomes-Tr; EBT00001552865.
DR   EnsemblGenomes-Tr; EBT00001552866.
DR   EnsemblGenomes-Tr; EBT00001552867.
DR   EnsemblGenomes-Tr; EBT00001552868.
DR   EnsemblGenomes-Tr; EBT00001552869.
DR   EnsemblGenomes-Tr; EBT00001552870.
DR   EnsemblGenomes-Tr; EBT00001552871.
DR   EnsemblGenomes-Tr; EBT00001552872.
DR   EnsemblGenomes-Tr; EBT00001552873.
DR   EnsemblGenomes-Tr; EBT00001552874.
DR   EnsemblGenomes-Tr; EBT00001552875.
DR   EnsemblGenomes-Tr; EBT00001552876.
DR   EnsemblGenomes-Tr; EBT00001552877.
DR   EnsemblGenomes-Tr; EBT00001552878.
DR   EnsemblGenomes-Tr; EBT00001552879.
DR   EnsemblGenomes-Tr; EBT00001552880.
DR   EnsemblGenomes-Tr; EBT00001552881.
DR   EnsemblGenomes-Tr; EBT00001552882.
DR   EnsemblGenomes-Tr; EBT00001552883.
DR   EnsemblGenomes-Tr; EBT00001552884.
DR   EnsemblGenomes-Tr; EBT00001552885.
DR   EnsemblGenomes-Tr; EBT00001552886.
DR   EnsemblGenomes-Tr; EBT00001552887.
DR   EnsemblGenomes-Tr; EBT00001552888.
DR   EnsemblGenomes-Tr; EBT00001552889.
DR   EnsemblGenomes-Tr; EBT00001552890.
DR   EnsemblGenomes-Tr; EBT00001552891.
DR   EnsemblGenomes-Tr; EBT00001552892.
DR   EnsemblGenomes-Tr; EBT00001552893.
DR   EnsemblGenomes-Tr; EBT00001552894.
DR   EnsemblGenomes-Tr; EBT00001552895.
DR   EnsemblGenomes-Tr; EBT00001552896.
DR   EnsemblGenomes-Tr; EBT00001552897.
DR   EnsemblGenomes-Tr; EBT00001552898.
DR   EnsemblGenomes-Tr; EBT00001552899.
DR   EnsemblGenomes-Tr; EBT00001552900.
DR   EnsemblGenomes-Tr; EBT00001552901.
DR   EnsemblGenomes-Tr; EBT00001552902.
DR   EnsemblGenomes-Tr; EBT00001552903.
DR   EnsemblGenomes-Tr; EBT00001552904.
DR   EnsemblGenomes-Tr; EBT00001552905.
DR   EnsemblGenomes-Tr; EBT00001552906.
DR   EnsemblGenomes-Tr; EBT00001552909.
DR   EnsemblGenomes-Tr; Spro_R0001-1.
DR   EnsemblGenomes-Tr; Spro_R0002-1.
DR   EnsemblGenomes-Tr; Spro_R0003-1.
DR   EnsemblGenomes-Tr; Spro_R0004-1.
DR   EnsemblGenomes-Tr; Spro_R0005-1.
DR   EnsemblGenomes-Tr; Spro_R0006-1.
DR   EnsemblGenomes-Tr; Spro_R0007-1.
DR   EnsemblGenomes-Tr; Spro_R0008-1.
DR   EnsemblGenomes-Tr; Spro_R0009-1.
DR   EnsemblGenomes-Tr; Spro_R0010-1.
DR   EnsemblGenomes-Tr; Spro_R0011-1.
DR   EnsemblGenomes-Tr; Spro_R0012-1.
DR   EnsemblGenomes-Tr; Spro_R0013-1.
DR   EnsemblGenomes-Tr; Spro_R0014-1.
DR   EnsemblGenomes-Tr; Spro_R0015-1.
DR   EnsemblGenomes-Tr; Spro_R0016-1.
DR   EnsemblGenomes-Tr; Spro_R0017-1.
DR   EnsemblGenomes-Tr; Spro_R0018-1.
DR   EnsemblGenomes-Tr; Spro_R0019-1.
DR   EnsemblGenomes-Tr; Spro_R0020-1.
DR   EnsemblGenomes-Tr; Spro_R0021-1.
DR   EnsemblGenomes-Tr; Spro_R0022-1.
DR   EnsemblGenomes-Tr; Spro_R0023-1.
DR   EnsemblGenomes-Tr; Spro_R0024-1.
DR   EnsemblGenomes-Tr; Spro_R0025-1.
DR   EnsemblGenomes-Tr; Spro_R0026-1.
DR   EnsemblGenomes-Tr; Spro_R0027-1.
DR   EnsemblGenomes-Tr; Spro_R0028-1.
DR   EnsemblGenomes-Tr; Spro_R0029-1.
DR   EnsemblGenomes-Tr; Spro_R0030-1.
DR   EnsemblGenomes-Tr; Spro_R0031-1.
DR   EnsemblGenomes-Tr; Spro_R0032-1.
DR   EnsemblGenomes-Tr; Spro_R0033-1.
DR   EnsemblGenomes-Tr; Spro_R0034-1.
DR   EnsemblGenomes-Tr; Spro_R0035-1.
DR   EnsemblGenomes-Tr; Spro_R0036-1.
DR   EnsemblGenomes-Tr; Spro_R0037-1.
DR   EnsemblGenomes-Tr; Spro_R0038-1.
DR   EnsemblGenomes-Tr; Spro_R0039-1.
DR   EnsemblGenomes-Tr; Spro_R0040-1.
DR   EnsemblGenomes-Tr; Spro_R0042-1.
DR   EnsemblGenomes-Tr; Spro_R0043-1.
DR   EnsemblGenomes-Tr; Spro_R0044-1.
DR   EnsemblGenomes-Tr; Spro_R0045-1.
DR   EnsemblGenomes-Tr; Spro_R0046-1.
DR   EnsemblGenomes-Tr; Spro_R0047-1.
DR   EnsemblGenomes-Tr; Spro_R0048-1.
DR   EnsemblGenomes-Tr; Spro_R0049-1.
DR   EnsemblGenomes-Tr; Spro_R0050-1.
DR   EnsemblGenomes-Tr; Spro_R0051-1.
DR   EnsemblGenomes-Tr; Spro_R0052-1.
DR   EnsemblGenomes-Tr; Spro_R0053-1.
DR   EnsemblGenomes-Tr; Spro_R0054-1.
DR   EnsemblGenomes-Tr; Spro_R0055-1.
DR   EnsemblGenomes-Tr; Spro_R0056-1.
DR   EnsemblGenomes-Tr; Spro_R0057-1.
DR   EnsemblGenomes-Tr; Spro_R0058-1.
DR   EnsemblGenomes-Tr; Spro_R0059-1.
DR   EnsemblGenomes-Tr; Spro_R0060-1.
DR   EnsemblGenomes-Tr; Spro_R0061-1.
DR   EnsemblGenomes-Tr; Spro_R0062-1.
DR   EnsemblGenomes-Tr; Spro_R0063-1.
DR   EnsemblGenomes-Tr; Spro_R0064-1.
DR   EnsemblGenomes-Tr; Spro_R0065-1.
DR   EnsemblGenomes-Tr; Spro_R0066-1.
DR   EnsemblGenomes-Tr; Spro_R0067-1.
DR   EnsemblGenomes-Tr; Spro_R0068-1.
DR   EnsemblGenomes-Tr; Spro_R0069-1.
DR   EnsemblGenomes-Tr; Spro_R0070-1.
DR   EnsemblGenomes-Tr; Spro_R0071-1.
DR   EnsemblGenomes-Tr; Spro_R0072-1.
DR   EnsemblGenomes-Tr; Spro_R0073-1.
DR   EnsemblGenomes-Tr; Spro_R0074-1.
DR   EnsemblGenomes-Tr; Spro_R0075-1.
DR   EnsemblGenomes-Tr; Spro_R0076-1.
DR   EnsemblGenomes-Tr; Spro_R0077-1.
DR   EnsemblGenomes-Tr; Spro_R0078-1.
DR   EnsemblGenomes-Tr; Spro_R0079-1.
DR   EnsemblGenomes-Tr; Spro_R0080-1.
DR   EnsemblGenomes-Tr; Spro_R0081-1.
DR   EnsemblGenomes-Tr; Spro_R0082-1.
DR   EnsemblGenomes-Tr; Spro_R0083-1.
DR   EnsemblGenomes-Tr; Spro_R0084-1.
DR   EnsemblGenomes-Tr; Spro_R0085-1.
DR   EnsemblGenomes-Tr; Spro_R0086-1.
DR   EnsemblGenomes-Tr; Spro_R0087-1.
DR   EnsemblGenomes-Tr; Spro_R0088-1.
DR   EnsemblGenomes-Tr; Spro_R0089-1.
DR   EnsemblGenomes-Tr; Spro_R0090-1.
DR   EnsemblGenomes-Tr; Spro_R0091-1.
DR   EnsemblGenomes-Tr; Spro_R0092-1.
DR   EnsemblGenomes-Tr; Spro_R0094-1.
DR   EnsemblGenomes-Tr; Spro_R0095-1.
DR   EnsemblGenomes-Tr; Spro_R0096-1.
DR   EnsemblGenomes-Tr; Spro_R0097-1.
DR   EnsemblGenomes-Tr; Spro_R0098-1.
DR   EnsemblGenomes-Tr; Spro_R0099-1.
DR   EnsemblGenomes-Tr; Spro_R0100-1.
DR   EnsemblGenomes-Tr; Spro_R0101-1.
DR   EnsemblGenomes-Tr; Spro_R0102-1.
DR   EnsemblGenomes-Tr; Spro_R0103-1.
DR   EnsemblGenomes-Tr; Spro_R0104-1.
DR   EnsemblGenomes-Tr; Spro_R0105-1.
DR   EnsemblGenomes-Tr; Spro_R0106-1.
DR   EnsemblGenomes-Tr; Spro_R0107-1.
DR   EnsemblGenomes-Tr; Spro_R0108-1.
DR   EnsemblGenomes-Tr; Spro_R0109-1.
DR   EuropePMC; PMC2767093; 19625389.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3194826; 21976608.
DR   EuropePMC; PMC3368398; 22675598.
DR   EuropePMC; PMC3535389; 23233458.
DR   EuropePMC; PMC3732745; 22983040.
DR   EuropePMC; PMC4022802; 24831138.
DR   EuropePMC; PMC4231636; 25070509.
DR   EuropePMC; PMC4391916; 25856195.
DR   EuropePMC; PMC5561391; 28861046.
DR   EuropePMC; PMC6121990; 30006399.
DR   EuropePMC; PMC6181195; 30107587.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01402; STnc150.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000826.
DR   SILVA-SSU; CP000826.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002719
CC   Source DNA and bacteria available from Daniel van der Lelie
CC   (vdlelied@bnl.gov) and Safiyh Taghavi (taghavis@bnl.gov)
CC   Contacts: Daniel van der Lelie (vdlelied@bnl.gov)
CC             Safiyh Taghavi (taghavis@bnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5448853
FT                   /organism="Serratia proteamaculans 568"
FT                   /strain="568"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:399741"
FT   gene            565..948
FT                   /locus_tag="Spro_0001"
FT   CDS_pept        565..948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0001"
FT                   /product="ATP synthase I chain"
FT                   /note="PFAM: ATP synthase I chain; KEGG:
FT                   ypi:YpsIP31758_4183 ATP synthase F0, I subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39111"
FT                   /db_xref="GOA:A8G7M1"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7M1"
FT                   /protein_id="ABV39111.1"
FT                   /translation="MSVSLYSGKVARKLLFLQLMTFVLISAAFGLKSLEWSGSALAGGL
FT                   AAWLPSTMFMLFALRHQAQTPAPGRVAWSFAIGEGLKVLITIVLLIVALGVFKAAFVPL
FT                   GLTYLAVLVVQIVAPAVINSYRT"
FT   gene            969..1790
FT                   /locus_tag="Spro_0002"
FT   CDS_pept        969..1790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0002"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: yen:YE4212 ATP synthase subunit B protein;
FT                   TIGRFAM: ATP synthase F0, A subunit; PFAM: H+transporting
FT                   two-sector ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39112"
FT                   /db_xref="GOA:A8G7M2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M2"
FT                   /protein_id="ABV39112.1"
FT                   /translation="MSASGENGTAKDYISHHLNNLQLDLRTFQLVEPHSGTPTFWTLNI
FT                   DSLFFSVVLGALFLFIFKKVANTATSGVPGKLQTAVELIMGFVDSSVRDMYHGKSKVIA
FT                   PLALTVFVWVFLMNMMDLLPIDLLPFIGEHVFGLPALRVVPTADVSITLSMALGVFILI
FT                   LFYSIKMKGVGGFVKELTMQPFNHPLFIPINLILEGVSLLSKPVSLGLRLFGNMYAGEL
FT                   IFILIAGLLPWWSQWLLNVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH"
FT   gene            1840..2079
FT                   /locus_tag="Spro_0003"
FT   CDS_pept        1840..2079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0003"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   kpn:KPN_04142 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39113"
FT                   /db_xref="GOA:A8G7M3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M3"
FT                   /protein_id="ABV39113.1"
FT                   /translation="MENLSMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDL
FT                   IPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFAVA"
FT   sig_peptide     1840..1911
FT                   /locus_tag="Spro_0003"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.533 at
FT                   residue 24"
FT   gene            2137..2607
FT                   /locus_tag="Spro_0004"
FT   CDS_pept        2137..2607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0004"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   ent:Ent638_4128 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39114"
FT                   /db_xref="GOA:A8G7M4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M4"
FT                   /protein_id="ABV39114.1"
FT                   /translation="MNLNATILGQAIAFVLFVWFCMKYVWPPIMAAIEKRQGEIADGLA
FT                   SAERAKKDLDLAQANATDQLKTAKAEAQVIIEQANKRKAQIMDEAKAEAEQERNKIVAQ
FT                   AQAEIEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL"
FT   gene            2622..3155
FT                   /locus_tag="Spro_0005"
FT   CDS_pept        2622..3155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0005"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: yen:YE4209 ATP synthase delta subunit protein;
FT                   TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39115"
FT                   /db_xref="GOA:A8G7M5"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M5"
FT                   /protein_id="ABV39115.1"
FT                   /translation="MSEFVTVARPYAKAAFDFAVEHQSLDRWQDMLAFAADVTRNEQIS
FT                   ELLAGAVAPETLSRTFIAVCGEQLDEHGQNFIRVMAENGRLLVLPAVLQQFIELRALLE
FT                   STVEVEVLSASALNDKQLANIAAAMEKRLSRKVKLNCKIDKSVLAGVIIRAGDMVIDGS
FT                   VRGRLERLTDVLQS"
FT   gene            3168..4709
FT                   /locus_tag="Spro_0006"
FT   CDS_pept        3168..4709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0006"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: yen:YE4208 ATP synthase alpha subunit protein;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39116"
FT                   /db_xref="GOA:A8G7M6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M6"
FT                   /protein_id="ABV39116.1"
FT                   /translation="MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLA
FT                   EVMQGEMIALPGNRYAIALNLERDSVGAVVMGPYADLAEGMKVKCTGRILEVPVGRGLL
FT                   GRVVNTLGAPIDGKGPVDNDGFSPVEAIAPGVIERQSVDQPVQTGYKSVDAMIPIGRGQ
FT                   RELVIGDRQTGKTALAIDAIINQRDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTI
FT                   VVVATASESAALQYLAPYAGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNAEYVEAFTKGEVKGQTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQ
FT                   YRELAAFSQFASDLDDATRKQLSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGFLND
FT                   VEVAKVVSFEAALVAYADREHAELLNHINQTGNFNDEIEGKLKGILETFKKTQSW"
FT   gene            4768..5631
FT                   /locus_tag="Spro_0007"
FT   CDS_pept        4768..5631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0007"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: ypi:YpsIP31758_4177 ATP synthase F1, gamma
FT                   subunit; TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39117"
FT                   /db_xref="GOA:A8G7M7"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M7"
FT                   /protein_id="ABV39117.1"
FT                   /translation="MAGAKEIRSKIASVQNTQKITKAMEMVAASKMRKSQERMAASRPY
FT                   AETMRKVIGHLALGNLEYKHPYLDERDVKRVGYLVVSTDRGLCGGLNINLFKRLLAEMK
FT                   GWSEKGVETDLALIGSKAASFFGSVGGNVVAQVTGMGDNPSLSELIGPVKVMLQAYDEG
FT                   RLDKLYIVSNKFINTMSQEPQIVQLLPLPPAEDGELKKKSWDYLYEPDPKVLLDTLLRR
FT                   YVESQVYQGVVENLASEQAARMVAMKAATDNGGSLIKELQLVYNKARQASITQELTEIV
FT                   SGASAV"
FT   gene            5664..7046
FT                   /locus_tag="Spro_0008"
FT   CDS_pept        5664..7046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0008"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: plu:plu0040 ATP synthase beta chain; TIGRFAM:
FT                   ATP synthase F1, beta subunit; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39118"
FT                   /db_xref="GOA:A8G7M8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M8"
FT                   /protein_id="ABV39118.1"
FT                   /translation="MATGKIIQVIGAVVDVEFPQDAVPKVYNALEVENGANKLVLEVQQ
FT                   QLGGGVVRCIAMGTSDGLRRGLKVTDLDHPIEVPVGKATLGRIMNVLGEPIDMKGDIGE
FT                   EERWAIHRPAPSYEDLANSQDLLETGIKVMDLICPFAKGGKVGLFGGAGVGKTVNMMEL
FT                   IRNIAIEHSGYSVFAGVGERTREGNDFYHEMNDSNVLDKVSLVYGQMNEPPGNRLRVAL
FT                   TGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQE
FT                   RITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRNIASLGIYPAVDPLDS
FT                   TSRQLDPLVVGQEHYDVARGVQSILQRYQELKDIIAILGMDELSEEDKLVVSRARKIQR
FT                   FLSQPFFVAEVFTGSPGKFVSLKDTIRGFKGIMDGDYDHLPEQAFYMVGTIEEAVEKAK
FT                   KL"
FT   gene            7067..7486
FT                   /locus_tag="Spro_0009"
FT   CDS_pept        7067..7486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0009"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: yen:YE4205 ATP synthase epsilon subunit protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39119"
FT                   /db_xref="GOA:A8G7M9"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7M9"
FT                   /protein_id="ABV39119.1"
FT                   /translation="MAMTYHLDVVSAEKHMFSGLVQKIQVTGSEGELGIFPGHAPLLTA
FT                   IKPGMVRIVKQHGEEEFIYLSGGILEVQPSVVTVLADTAIRGTDLDEARALEAKRKAEE
FT                   HISSSHGDVDYAQASAELAKAIAKLRVIELTRRSM"
FT   gene            7783..9153
FT                   /locus_tag="Spro_0010"
FT   CDS_pept        7783..9153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0010"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase; KEGG: yen:YE4204
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39120"
FT                   /db_xref="GOA:A8G7N0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7N0"
FT                   /protein_id="ABV39120.1"
FT                   /translation="MSNSAMSVVILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMK
FT                   LGAKNVHLVYGHGGDLLKNTLTDGALNWVLQAEQLGTGHAMQQAAPHFADDEDVLMLYG
FT                   DVPLISVDTLQRLMAAKPQGGIGLLTVKLADPSGYGRIVRENDQVVGIVEHKDANEAQR
FT                   QINEINTGILVANGRDLKRWLGMLNNDNAQGEFYITDIIALAHADGKKIEAVHPSRLSE
FT                   VEGVNNRLQLSRLERIYQAEQSEKLLLAGVMLLDPARFDLRGELVHGRDISIDANVIIE
FT                   GTVKLGDRVKIGAGCVLKNCVIGDDCEISPYSVLEDAVLAAECTVGPFARLRPGAELAV
FT                   GAHVGNFVEMKKARLGKGSKAGHLSYLGDAEIGDDVNIGAGTITCNYDGANKHKTIIGD
FT                   GVFVGSDTQLVAPVSVGKGSTIAAGTTVTRDIGEDELVLSRVKQVHIQGWQRPVKKK"
FT   gene            9365..11194
FT                   /locus_tag="Spro_0011"
FT   CDS_pept        9365..11194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0011"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   yps:YPTB3964 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39121"
FT                   /db_xref="GOA:A8G7N1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N1"
FT                   /protein_id="ABV39121.1"
FT                   /translation="MCGIVGAVAQRDIAEILLEGLRRLEYRGYDSAGLAVVDAEGNVNR
FT                   LRRVGKVNKLTEAAEQHELHGGTGIAHTRWATHGEPTEANAHPHVSDYITVVHNGIIEN
FT                   HEPLRELLIERGYHFSSETDTEVIAHLVHWEQRQGGTLLEVVQRVIPQLRGAYGTVVMD
FT                   SRDPSVLVAARSGSPLVIGRGVGENFLASDQLALLPVTRRFIFLEEGDVVEMTRRTVNI
FT                   FDKQGNAVERPEIESQVQYDAGDKGAYRHYMQKEIYEQPLALKNTLEGRFSQGKINLSE
FT                   LGPRADELLAKVQHVQIIACGTSYHSGMVARYWFESLAGVPCDVEIASEFRYRKSAVRP
FT                   GSLIITLSQSGETADTLAALRLSKELGYLGSLAVCNVAGSSLVRESDLALMTKAGTEIG
FT                   VASTKAFTTQLAVLLMLVARLGRLKGMAESVEHEIVHGLQALPARIEQMLSLDKNIEAL
FT                   AEGFSDKHHALFLGRGDQYPIAMEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPV
FT                   IVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSEGMTIIPLPHVEEIVAPIF
FT                   YTVPLQLLSYHVALIKGTDVDQPRNLAKSVTVE"
FT   gene            11524..12564
FT                   /locus_tag="Spro_0012"
FT   CDS_pept        11524..12564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0012"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: yen:YE4201 putative
FT                   phosphate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39122"
FT                   /db_xref="GOA:A8G7N2"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N2"
FT                   /protein_id="ABV39122.1"
FT                   /translation="MKLMRTTVASIVAATFSLTAVSAFAAASLTGAGATFPAPVYAKWA
FT                   DSYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSDEKLAADGLFQFPTVIGGV
FT                   VLAVNIPGIKSGELTLDGKTLGDIYLGNVKKWNDPAITKLNPGVKLPDQNIAVVRRADG
FT                   SGTSFVFTSYLSKANAQWKEKIGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYA
FT                   YAKQNNLAYTKLISADGKAVSPTEESFSAAAKGVDWSKTFAQDLTDQKGDNAWPITSTT
FT                   FILVHKEQKNPAQGTEVLKFFDWAYKTGAKQANDLDYATLPNEVIEQVRAAWKTNVKDS
FT                   SGKALY"
FT   sig_peptide     11524..11601
FT                   /locus_tag="Spro_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.920 at
FT                   residue 26"
FT   gene            12657..13613
FT                   /locus_tag="Spro_0013"
FT   CDS_pept        12657..13613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0013"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA4476
FT                   phosphate transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39123"
FT                   /db_xref="GOA:A8G7N3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N3"
FT                   /protein_id="ABV39123.1"
FT                   /translation="MAEYKPTMKAPSKNGDVIFSALVKLAALITLLLLGGIIVSLIFAS
FT                   WPSIQKFGFSFLWTKEWDAPAEQFGALVPIYGTVVTSLIALIIAVPVSFGIALFLTELA
FT                   PNWLRRPLGIAIELLAAIPSIVYGMWGLFVFAPLFAEYFQTPVGDVLSGIPIVGELFSG
FT                   PAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPF
FT                   TKNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESG
FT                   VHTAALMELGLILFVITFIVLALSKLMVMRLAKKEGR"
FT   gene            13624..14505
FT                   /locus_tag="Spro_0014"
FT   CDS_pept        13624..14505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0014"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ypi:YpsIP31758_4169
FT                   phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39124"
FT                   /db_xref="GOA:A8G7N4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N4"
FT                   /protein_id="ABV39124.1"
FT                   /translation="MEMQNNLALLESRRKMQAWRRQKNRLALFLSMATMAFGLFWLVWI
FT                   LFSTVTKGIDGMSLALFTEMTPPPNTAGGGLANAIAGSGLLIMWATVFGTPLGIMAGIY
FT                   LAEYGRKSWLAEVIRFINDILLSAPSIVVGLFVYTIVVAKMQHFSGWAGIIALALLQVP
FT                   IVIRTTENMLKLVPDTLREAAYALGTPKWRMISAITLKASVSGIITGVLLAIARIAGET
FT                   APLLFTSLSNQFWSTDLMQPIANLPVTIFKFAMSPFAEWQELAWAGVLLITLCVLVLNI
FT                   LARVVFAKQKHS"
FT   gene            14554..15330
FT                   /locus_tag="Spro_0015"
FT   CDS_pept        14554..15330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0015"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: yen:YE4198 putative phosphate transport
FT                   ATP-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39125"
FT                   /db_xref="GOA:A8G7N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N5"
FT                   /protein_id="ABV39125.1"
FT                   /translation="MSMVNDASSSKIQVRDLNFYYGKFHALKNITLDIAKNKVTAFIGP
FT                   SGCGKSTLLRTFNKMYQLYPEQRAEGGILLDGQNILTDNSDIALLRAKVGMVFQKPTPF
FT                   PMSIYDNIAFGVRLFEKLSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRL
FT                   CIARGIAIRPDVLLLDEPCSALDPISTGKIEELISELKSDYTVVIVTHNMQQAARCSDS
FT                   TAFMYLGELIEFSDTDTLFTAPQKKQTEDYITGRYG"
FT   gene            15342..16076
FT                   /locus_tag="Spro_0016"
FT   CDS_pept        15342..16076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0016"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: eca:ECA4473
FT                   phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39126"
FT                   /db_xref="GOA:A8G7N6"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N6"
FT                   /protein_id="ABV39126.1"
FT                   /translation="MDNLNLNKHISGQFNAELEHIRTQVLTMGGLVEQQLTDAITAMHN
FT                   QDGELAKRVIEGDAKVNMMEVAIDEACVRIIAKRQPTASDLRLVMAIIKTISELERIGD
FT                   VADKICRTALEKFSHQHQPLLVSLESLGRHTVQMLHDVLDAFARMDLDEAIRIYREDRK
FT                   VDQEYEGIVRQLMTYMMEDTRTIPSVLTALFCARSIERIGDRCQNICEFIFYFVKGQDF
FT                   RHIGGDALEKLLSSDGKDEEKE"
FT   gene            16245..17084
FT                   /locus_tag="Spro_0017"
FT   CDS_pept        16245..17084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0017"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: yen:YE4193 putative periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39127"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N7"
FT                   /protein_id="ABV39127.1"
FT                   /translation="MKHRVLALTLLASLTSLATGAAHADKLDDIKKAGVVRIAVFDSNP
FT                   PFGYIDPQSKKLVGYDVDVADAIGKALGVKVELRATNPANRIPLLVSKKVDLIAANFTI
FT                   TDERAKEVNFSVPYFATGQKFIAHKGVLKTPEDIKKLRIGADKGTVQEITLREHYPTAK
FT                   VISYDDTPLAFVALRNGNVQAITQDDAKLVGLLGNLPAAQKADFEISPFSITKEYQGVG
FT                   IPKGEDRLTASVNDTLIKLEKDGEAAKIYDRWFGPETKTAQPRGDFKIAPLDQQPKA"
FT   sig_peptide     16245..16319
FT                   /locus_tag="Spro_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            17162..17875
FT                   /locus_tag="Spro_0018"
FT   CDS_pept        17162..17875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0018"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: yen:YE4191 ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39128"
FT                   /db_xref="GOA:A8G7N8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N8"
FT                   /protein_id="ABV39128.1"
FT                   /translation="MNLDWLLAPEYLSWLWRGFLLTLWLSACASLAATLLGFLLTAMRD
FT                   SRLRALRWLAVGYSSLFRNTPLLVQLFFWYFAAGQILPSAAMQWLNTSHQIGPLEWPSF
FT                   EFLAGFFGLTLYSSAFIAEEIRSGIRGVAGGQKYAANALGLTGWQAMRYVVLPQALKIA
FT                   MPPLLGQYMNVIKNSSLTMAIGVAELSYASRQVETETLRTFQAFGVATVLYIAIIALLE
FT                   GWGMWRQQRKPLRGH"
FT   sig_peptide     17162..17260
FT                   /locus_tag="Spro_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.829 at
FT                   residue 33"
FT   gene            17877..18617
FT                   /locus_tag="Spro_0019"
FT   CDS_pept        17877..18617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0019"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: yen:YE4190 putative
FT                   amino acid transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39129"
FT                   /db_xref="GOA:A8G7N9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7N9"
FT                   /protein_id="ABV39129.1"
FT                   /translation="MDFSVIYDNLGYLLWGTWPDGPLGGAALTLAISLMAGVASAIIGT
FT                   LLGVALAMSRGVAAGLLAALLGFFRAIPVIMLIFWTYFLLPIVFGVDIPEITTVVCALA
FT                   LIASAYLAHAVKAGIAAIGPGQWQAGLSLGLTRWQTLRMIVLPQALRMMVPSFINQWIS
FT                   LIKDTSLAYIVGVGELTFLATQVNNRSMVYPMEVFLFIALVYFVFCLALDLLANAVNRR
FT                   FSPQTRALKRSWRWWRNKPPLPAS"
FT   gene            complement(18610..19275)
FT                   /locus_tag="Spro_0020"
FT   CDS_pept        complement(18610..19275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0020"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: yen:YE4189 putative haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39130"
FT                   /db_xref="GOA:A8G7P0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P0"
FT                   /protein_id="ABV39130.1"
FT                   /translation="MNQIDCILFDCDGTLVDSEVLCSKAYVHMFAHYGIHLSLDEVFRK
FT                   YKGVKLYEIIEQVNAEHGVALPKEELEPLYRQEVARLFDSELQQIAGARELLAQVTVPM
FT                   CTVSNGPVSKMQHSLGLTDMLHYFDDRLFSGYDIQRWKPDPAIVFHAAEKMRVPVERCI
FT                   LVDDSAAGAQAGIAAGIPVFYFCADPHNQPIDHPLVTAFDDLAQLPALWRERGWQLTS"
FT   gene            19501..20838
FT                   /locus_tag="Spro_0021"
FT   CDS_pept        19501..20838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0021"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: yps:YPTB3953 xanthine/uracil permease
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39131"
FT                   /db_xref="GOA:A8G7P1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P1"
FT                   /protein_id="ABV39131.1"
FT                   /translation="MNKQVTGLDVEQGLLGRVFKLKQHGTTARTETIAGITTFLTMVYI
FT                   VFVNPQILGAAGMDTQAVFVTTCLIAAFGSIFMGLLANLPVALAPAMGLNAFFAFVVVG
FT                   AMGISWQVGMGAIFWGAVGLLLLTIFRVRYWMIANIPMSLRVGITSGIGLFIGMMGLKN
FT                   AGIVVANPDTLVTIGSLTSHNVLLGALGFFIIAVLSSRNFHAAVLVSIVVTTLIGWALG
FT                   DVKYGGVFSMPPNITSVVGQVDLAGALNIGLAGVIFSFMLVNLFDSSGTLIGVTDKAGL
FT                   TDATGKFPRMKQALYVDSISSVAGSFVGTSSVTAYIESSAGVSVGGRTGLTAVVTGILF
FT                   LLVIFLSPLAGMVPAYAAAGALIYVGVLMTSSLARVKWDDLTEAVPAFVTAVMMPFSFS
FT                   ITEGIALGFISYCVMKLGTGRWREISPCVVVVALLFVLKIVFVDGH"
FT   gene            complement(21100..22152)
FT                   /locus_tag="Spro_0022"
FT   CDS_pept        complement(21100..22152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_5500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39132"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P2"
FT                   /protein_id="ABV39132.1"
FT                   /translation="MYFFILAILLAFTTRPLLATEMRYPAGEEPIELPVHSPLSTQLPR
FT                   TTQSQEDKKIAAMSLYLTLMREDGRNIWAPYQLAASSAEKGQTELAERYLQLSADRGLW
FT                   YYYNLLEDDAFNNIQHGSTYQSILAATKARYLQHAHWFEGKASYAIPDGPPPPGGWPTV
FT                   VYLHTYGKSAGITPEERLFFSEIGVAYIEINGTQMLSENSFRWSNYSDESTQSAIQRVL
FT                   QPSTEELKLNPQKIYLAARGQGALHAANLLAKYPQLYAGALLIAPNGGIKQAQQSLATH
FT                   KRLVVAYYERQNFSDQALAMHFANLFGENNQVKVLHFAQGESPDGGWRARFKRPLQWML
FT                   HQAPDATPGA"
FT   sig_peptide     complement(22093..22152)
FT                   /locus_tag="Spro_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            complement(22248..22814)
FT                   /locus_tag="Spro_0023"
FT   CDS_pept        complement(22248..22814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0023"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   yen:YE4184 putative NAD(P)H-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39133"
FT                   /db_xref="GOA:A8G7P3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P3"
FT                   /protein_id="ABV39133.1"
FT                   /translation="MSDQALKIVTLLGSLRKGSYNAMVARALPGLAPQGVTIEALPSIR
FT                   DIPLYDADVQQEEGFPASVEAIAEQIRQADGVIIVTPEYNYSVPGGLKNAIDWLSRLPN
FT                   QPLAGKPVAIQTSSMGPIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDAQAEE
FT                   LIDQGTLDFLTGQLSAFSDYIRRLK"
FT   gene            complement(22989..23714)
FT                   /locus_tag="Spro_0024"
FT   CDS_pept        complement(22989..23714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39134"
FT                   /db_xref="GOA:A8G7P4"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P4"
FT                   /protein_id="ABV39134.1"
FT                   /translation="MACHFARWIPTSSALDTRRLSAEVVAATAAFSVKRRQRFLQGRIL
FT                   LAEMMFYLYGLSTLPALATTPTGRPCFVDNHLPDFSLAYASDTVGVLLSQEGKVGLDIE
FT                   VMRARAGQHRELQHQYQTPAENAWISAQYDRLEAETQLWSIRQSVLKLSGLGNSGQSTL
FT                   LLHPFSGHLRSSITPQVHVMSDADEYLSWACAREPNLERLICWQYEAGKGLHKHGEISP
FT                   RAPALSTRFMKLTSLALHR"
FT   gene            complement(23811..25124)
FT                   /locus_tag="Spro_0025"
FT   CDS_pept        complement(23811..25124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0025"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /note="KEGG: sbo:SBO_4340 lysine:N6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39135"
FT                   /db_xref="GOA:A8G7P5"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P5"
FT                   /protein_id="ABV39135.1"
FT                   /translation="MNEPLDLLGVGLGPFNLSLAALAYESGVLNYTFLDRNASFRWHPG
FT                   MLLPSAYMQTYVLQDLVTAVTPRSQFSFINYLVEQKKIYRFLITEQQIISREEFSDYLS
FT                   WACDRLDGLQFSQSVESIDFDDDKQLFEVRTINQTLWAKNICLGTGHDPWLPEEFYPAL
FT                   GENCLHAAEIAIRNPDLTGKRVTVVGGGQSGADIFLNALRGHWGEAAQLDWISRRPNFQ
FT                   PLDESAFTNEYFTPEYVDYFYTLPQEIREREIKAQKLPADGISNHTLRTLYRELYLRFD
FT                   VMHQPRNVRLLPHRTLLAIEPTDKGYQLRTRHGLENRQEGFHADVVILATGYRPSLPSC
FT                   LKPLLSRIPFDNKQRLPLQPDFNLEWQGPEQNRIYAVNAGIHSHGSAEGGLSLMAWRSA
FT                   RILNHLLGKPHFDLTPNASMIQWWSDAPPDNDIAYPDK"
FT   sig_peptide     complement(25053..25124)
FT                   /locus_tag="Spro_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.617) with cleavage site probability 0.603 at
FT                   residue 24"
FT   gene            complement(25247..26047)
FT                   /locus_tag="Spro_0026"
FT   CDS_pept        complement(25247..26047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0026"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sec:SC2881 putative metal-dependent hydrolase of the
FT                   beta-lactamase superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39136"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7P6"
FT                   /protein_id="ABV39136.1"
FT                   /translation="MALTLRVLLENRRATGVDKSLRVKAGLSLLIQDETDSVLFDTGPD
FT                   GSFLDNAALMGIDLSGLTATVLSHGHYDHCGGVPWLPENSRIICHPQIADERYSAVKLL
FT                   GHSRKIKKLSLDIDYSRHRMEYSREPLHISERFMWSGEIAVAEPKAYGVIGGKTEAVDY
FT                   VIDEGVLIYKSDRGLVIITGCGHRGIINIVRHCQKITGVNKIHALIGGFHLRCASPRLI
FT                   WQVRQFLNQQKPDKLMGCHCTGAWGQLWLPEMISPATGDTFVLE"
FT   gene            complement(26077..27441)
FT                   /locus_tag="Spro_0027"
FT   CDS_pept        complement(26077..27441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0027"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="TIGRFAM: tRNA modification GTPase TrmE; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Miro domain protein; KEGG: yps:YPTB3949
FT                   putative thiophene and furan oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39137"
FT                   /db_xref="GOA:A8G7P7"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7P7"
FT                   /protein_id="ABV39137.1"
FT                   /translation="MSTTDTIVAQATPPGRGGVGILRISGRGAKDVAQALLGKLPKPRY
FT                   ADYLPFRDAAGATLDQGIALWFPGPNSFTGEDVLELQGHGGPVILDLLLKRVLALPGMR
FT                   IARPGEFSERAFLNDKLDLAQAEAIADLIDASSEQAARSAMNSLQGAFSTRIHQLVEAL
FT                   THLRIYVEAAIDFPDEEIDFLSDGKIEAQLNGVMADLDSVRAEARQGSLLREGMKVVIA
FT                   GRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREASDEV
FT                   ERIGIERAWNEIEQADRVLFMVDGTTTAATEPAEIWPEFMARLPHRLPITVVRNKADIT
FT                   GETLGMTEVNGHSLIRLSARTGEGIDLLRDHLKQSMGFTSNMEGGFLARRRHLQALEQA
FT                   AQHLVEGKEQLVSAYAGELLAEELRLAQQALSEITGEFTSDDLLGRIFSSFCIGK"
FT   gene            complement(27544..29181)
FT                   /locus_tag="Spro_0028"
FT   CDS_pept        complement(27544..29181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0028"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   yen:YE4177 probable membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39138"
FT                   /db_xref="GOA:A8G7P8"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7P8"
FT                   /protein_id="ABV39138.1"
FT                   /translation="MDSQRNLLLIALLFVSFMIWQAWQTDNAPQPVAQTTQQTSNPATG
FT                   DAASSAVPASGQGKLITVNTDVLSLTINTRGGDIEQAKLLAYPDTLGSSTPFQLLETTP
FT                   AFVYQAQSGLTGRNGPDNPANGERPLFQAAQDSYTLPEGQEELRIPLTFTGKDGAIYTK
FT                   TFVLKRNHYAVAVDYNVDNKSTTPLELTLFGQLKQTTELPKHRDTGSNNFALHTFRGAA
FT                   YSSSDDKYQKYAFDKDENLSVTTQGGWVAMLQQYFATAWVPATQGSNTFYTAKPGDNLS
FT                   TIGFKSTPVVVQPGAQQQLNATLWVGPELQDQMAQLAPHLDLTVDYGWLWFISQPLFKL
FT                   LKFIHGFIGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDKQ
FT                   RMSQEMMALYKSEKVNPLGGCLPLVIQMPIFLALYYMLMGSVELRHAPFALWIHDLSAQ
FT                   DPYYILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVS
FT                   NLVTILQQQLIYRGLEKRGLHSRDKKKT"
FT   sig_peptide     complement(29116..29181)
FT                   /locus_tag="Spro_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.592 at
FT                   residue 22"
FT   gene            complement(29184..29441)
FT                   /locus_tag="Spro_0029"
FT   CDS_pept        complement(29184..29441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0029"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   yps:YPTB3947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39139"
FT                   /db_xref="GOA:A8G7P9"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7P9"
FT                   /protein_id="ABV39139.1"
FT                   /translation="MASPLSPGSRILIGLVRAYQLVISPLLGPRCRFQPTCSHYAIEAL
FT                   SRFGMIKGSWLALKRVLKCHPLNPGGDDPVPPKPDDNREH"
FT   gene            complement(29405..29764)
FT                   /locus_tag="Spro_0030"
FT   CDS_pept        complement(29405..29764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0030"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: ypi:YpsIP31758_4155
FT                   ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39140"
FT                   /db_xref="GOA:A8G7Q0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7Q0"
FT                   /protein_id="ABV39140.1"
FT                   /translation="MVKLAFPRELRLLTPTHFTFVFQQPQRAGTPQITILGRLNQLGHP
FT                   RIGLTVAKKHVKRAHERNRIKRLTRESFRLRQHELPAMDFVVVAKKGIADLDNRALTEA
FT                   LEKLWRRHCRQAPAS"
FT   gene            complement(29783..29923)
FT                   /locus_tag="Spro_0031"
FT   CDS_pept        complement(29783..29923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0031"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG: kpn:KPN_04106 50S
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39141"
FT                   /db_xref="GOA:A8G7Q1"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7Q1"
FT                   /protein_id="ABV39141.1"
FT                   /translation="MKRTFQPSVLKRNRSHGFRARMATKNGRQVLARRRAKGRSRLTVS
FT                   K"
FT   gene            30606..31997
FT                   /locus_tag="Spro_0032"
FT   CDS_pept        30606..31997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0032"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ypk:y4113 DNA biosynthesis protein; TIGRFAM:
FT                   chromosomal replication initiator protein DnaA; PFAM:
FT                   Chromosomal replication initiator DnaA domain; Chromosomal
FT                   replication initiator DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39142"
FT                   /db_xref="GOA:A8G7Q2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7Q2"
FT                   /protein_id="ABV39142.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYLNNINGLLNDFCGTDAPLLRFEVGSKPLSQIISQTVTASVSAPSAPIVR
FT                   VAAPSRPSWDNAAPQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNP
FT                   LFLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYY
FT                   RSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSR
FT                   FGWGLTVAIEPPELETRVAILMKKADENNIRLPGEVAFFIAKRLRSNVRELEGALNRVI
FT                   ANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKIADLLSKRRSRSV
FT                   ARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI
FT                   RTLSS"
FT   gene            32002..33102
FT                   /locus_tag="Spro_0033"
FT   CDS_pept        32002..33102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0033"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: yen:YE4172 DNA polymerase III, beta subunit
FT                   protein; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39143"
FT                   /db_xref="GOA:A8G7Q3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Q3"
FT                   /protein_id="ABV39143.1"
FT                   /translation="MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGCLLLT
FT                   GTDLEMEMVARVALSQPHEAGATTVPARKLFDICRGLPEGAEITVTLEGERMLVRSGRS
FT                   RFSLSTLPAVDFPNLDDWQSEVEFSLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQQLPSHSVIVPRKGVMELVRLLDGGDTLLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGV
FT                   RLYVSQNQLKITANNPEQEEAEEILDVSYDGTEMEIGFNVSYVLDVLNALKCEDVRLLL
FT                   TDSVSSVQIEDGASKSAAYVVMPMRL"
FT   gene            33271..34356
FT                   /locus_tag="Spro_0034"
FT   CDS_pept        33271..34356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0034"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: ypi:YpsIP31758_4151 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39144"
FT                   /db_xref="GOA:A8G7Q4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7Q4"
FT                   /protein_id="ABV39144.1"
FT                   /translation="MALTRLLIKDFRNIEAADLALAPGFNFLVGANGSGKTSVLEAVYT
FT                   LGHGRAFRSLQAGRVIRHDQPEFILHGRIDGAEREISVGLSKSRQGDSKVRIDGSDGHK
FT                   VAELAQLLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFTAWSNLKRLLKQRNA
FT                   ALRQVSRYAQIRAWDQELIPLAERISEWRAAYSDAIAADITATCAQFLPEFALSFSFQR
FT                   GWDKESDYGELLERQFERDRALTYTAVGPHKADFRIRADGTPVEDLLSRGQLKLLMCAL
FT                   RLAQGEFLTRQSGRRCLYLIDDFASELDTGRRRLLADRLKATQAQVFVSAVSAEQVTDM
FT                   AGEKGKMFRVEQGKIEVQPQD"
FT   gene            34375..36789
FT                   /locus_tag="Spro_0035"
FT   CDS_pept        34375..36789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0035"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: ypi:YpsIP31758_4150 DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39145"
FT                   /db_xref="GOA:A8G7Q5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Q5"
FT                   /protein_id="ABV39145.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCSDIQVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAQVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHEQTYAMGEPQAPLKVVGETDQT
FT                   GTTVRFWPSYETFTNNVEFEYDILAKRLRELSFLNSGVSIRLKDKRTDKEDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LVGFRTAMTRTLNSYMDKEGYSKKAKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETLMNEKLVDYLMENPGDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIAMDGATLHTNASAPALA
FT                   GEPLEKLVAEHYSVQKLIGRMERRYPRALLNNLIYQPTLAEGDLSDQAKVKTWIDSLVK
FT                   LLNDKEQHGSSYDSVIFENRERQMFEPVLRIRTHGVDTDYALDFDFIHGGEYRKICVLG
FT                   EKLRGLIEEDAFIERGERRQPVESFEQALEWLVKESRRGLAVQRYKGLGEMNPEQLWET
FT                   TMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   gene            36913..37728
FT                   /locus_tag="Spro_0036"
FT   CDS_pept        36913..37728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0036"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: yen:YE4169 putative haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39146"
FT                   /db_xref="GOA:A8G7Q6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Q6"
FT                   /protein_id="ABV39146.1"
FT                   /translation="MAIELIAIDMDGTLLNPQHQITPAVKQAITEARRKGVHVVLATGR
FT                   PYVGVQDYLRQLDIQGPGDFCITYNGALVLKAVDGACILQETLGFEDYLHFEKMAREFG
FT                   VHFQAFDFDTLYTPNKDIGKYTVHESEMTGIPLKYRSVEEMDPSIRFPKVMMVDEPELL
FT                   DRAIARIPAETRERYTILKSAPYYLEILHQKVDKGAGVKMLADHLGIARENVMTLGDQA
FT                   NDTAMIEYAGLGVAMGNAIPELKAVAQFVTSTNTEDGVARAIEKFVLNA"
FT   gene            complement(37845..38813)
FT                   /locus_tag="Spro_0037"
FT   CDS_pept        complement(37845..38813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0037"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: yen:YE4167 pyridoxal-phosphate dependent
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39147"
FT                   /db_xref="GOA:A8G7Q7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Q7"
FT                   /protein_id="ABV39147.1"
FT                   /translation="MSQLFDAIVSAHQQLRPQVRVTPLERSVLLSQQLGCELYLKCDHL
FT                   QPTGSFKFRGASNKLRLLSDEQRQRGVIAASSGNHGQAMALAGKLTGVSVTVYAPETAA
FT                   AIKLETIRALGSEVVTVPGDALKAEQAGEKAAQEQGKVYVSPYNDEQVIAGQGTCGMEL
FT                   VEQQADLDAVFIAVGGGGYISGIGTVLQQLSPKTQIIACWPENSTSMYSALQAGHIYPV
FT                   EEQDTLSDGTAGGVEPGAITFPLCQQVIDRKILVSETEIKQAMRQIAASDRWIIEGAAG
FT                   VALAAAIKLAPEFQGKKVAVVLCGKNIVLEKYLKAIADENH"
FT   gene            complement(38810..39415)
FT                   /locus_tag="Spro_0038"
FT   CDS_pept        complement(38810..39415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0038"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: bvi:Bcep1808_0785
FT                   transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39148"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Q8"
FT                   /protein_id="ABV39148.1"
FT                   /translation="MLSRYHAIADAITLLFAPYAEVALHDLASQTLVYITNNRSQRELG
FT                   ESSNLSELQDEPDLQVIGPYLKRNWDGSQLRSISAVLRDDNGTPIGLLCINLDITVLES
FT                   AKAALEVFLGGNALQPQPDVLFQDDWQERINTFIYQWLQQRQQTLSALNGAGRRALVEA
FT                   LYHQGAFKGKNAAGYVAKILGIGRATVYNYLKNIKESV"
FT   gene            39690..41006
FT                   /locus_tag="Spro_0039"
FT   CDS_pept        39690..41006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0039"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_3541 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39149"
FT                   /db_xref="GOA:A8G7Q9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Q9"
FT                   /protein_id="ABV39149.1"
FT                   /translation="MDSSTYSTTIKRMNRRIIPFIMLLYLIAYIDRSNISIAALQMNAD
FT                   LALSAEMYGIAAGIFYISYIIFEVPSNILLSRIGAKIWIARIMVTWGIIAAGMSLVQTP
FT                   TQLYVMRFLLGVAEAGFTPGIIYYLSCWYPRSDRARAMSMFYIGAALASVIGLPLSGSI
FT                   LNMHGLFDIAGWRWLFLLEGIPAVLLGIVTYFYLDDAPQQAKWLAPPQRQWLVNKMAGE
FT                   MAETAGGQSHRWSQALTNRRVWALSFMWLLQAFGTIGITLFLPLIVKGVVTEQSSFVVN
FT                   VLSAIPFFFACIFMYFNGRHSDLTGERSLHLGGPLIAAGLLLLAAIYCQNLVLAYGMLV
FT                   LTVALNWAITPIFWAVTTESIAGVAGAASIALINAVANIAGLVFPPVMGRIKDITGNYD
FT                   IALMAIAAALVAGGIIGLRLGRPLSAATGEVALRENNHG"
FT   gene            40999..41946
FT                   /locus_tag="Spro_0040"
FT   CDS_pept        40999..41946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0040"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: pol:Bpro_3531 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39150"
FT                   /db_xref="GOA:A8G7R0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R0"
FT                   /protein_id="ABV39150.1"
FT                   /translation="MAETILQASPLPQRLVVQLRQHFPLVDQRELAPLALAARASEFTV
FT                   LLVDGETAVSAAQIAALPQLKLIAVFGVGYERVDVLAARAQGVRVTHTPGVLTDDVADL
FT                   AIGLLLATARQIGGAQRFIERGDWLQGGYPWTRKVSGARLGILGLGRIGRAIAQRATAF
FT                   NMAVSYHSRQQYDDFSGRFFATPQALAEHCDFLLVCTNGGVATRALVDAKVLAALGANG
FT                   ILINIARGSVVDETALVKAIDQGVIAGAGLDVFECEPQVPAGLMGRDNVVLTPHMASAT
FT                   HSTRRMMADLVFDNIAAYFAGRALPTPVAESPNP"
FT   gene            42130..42888
FT                   /locus_tag="Spro_0041"
FT   CDS_pept        42130..42888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0041"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: eca:ECA4419 galactonate operon
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39151"
FT                   /db_xref="GOA:A8G7R1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R1"
FT                   /protein_id="ABV39151.1"
FT                   /translation="MGDAGKVNPLSQHGERHGEIMNKQQIGKTDRIIIEMGQQIVGGKY
FT                   IPGAALPAETELCEEFETSRNIIREVLRALMSKRLVEVKRYRGAFVTLRSQWNYLDTDV
FT                   LNWVLAQDYDPRLIASMSEVRNLVEPTIARWAAERATSSELAVIEAALNDMKIHHQDRE
FT                   RFNEADIRYHEAVLAAVHNPVLQQLSVAISSLQRAVFERTYMSDENNMPRTLREHQELY
FT                   DAIRHQDPDAAEQAALAMIASSTKRLKDIT"
FT   gene            42885..43778
FT                   /locus_tag="Spro_0042"
FT   CDS_pept        42885..43778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0042"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /note="PFAM: 2-keto-3-deoxy-galactonokinase; KEGG:
FT                   eca:ECA4418 2-dehydro-3-deoxygalactonokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39152"
FT                   /db_xref="GOA:A8G7R2"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R2"
FT                   /protein_id="ABV39152.1"
FT                   /translation="MSDSFIAIDWGSTNLRAWRYEQGVCVDSLQSQAGVTRLDGRTPQQ
FT                   VFSELMARWAEPLPVVMAGMVGSNAGWLQVPYLHCPTRLTEVAQQLTAIEQALPYRAWI
FT                   IPGICIEREDNYNVMRGEETQLIGAYAEQPAAVYIMPGTHSKWVRMEGDTLADFRTVMT
FT                   GELHHLLLSHSLIGVGLSEQRPNPQAFINGLEVGMNESHIVRRLFETRAAHVLGKLEKS
FT                   AVSDWLSGLLIGNEVAEMQREYPLPPDAALTVIGNPQLGERYAQALTMAGIRHQILDGD
FT                   RAFQSGIRSIVHELEY"
FT   gene            43762..44379
FT                   /locus_tag="Spro_0043"
FT   CDS_pept        43762..44379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0043"
FT                   /product="KDPG and KHG aldolase"
FT                   /note="PFAM: KDPG and KHG aldolase; thiamine monophosphate
FT                   synthase; KEGG: kpn:KPN_04096 putative
FT                   keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39153"
FT                   /db_xref="GOA:A8G7R3"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R3"
FT                   /protein_id="ABV39153.1"
FT                   /translation="MSWNTELPLIAILRGITPQEVADHVQTLLEAGFDAIEIPMNSPDW
FT                   QQSIGDTVKKFGDRALIGAGTVLQPAQVEELAALGGQLVVTPNTQPAVIRRAVALGMTV
FT                   CAGCATASEAFNALEAGAQALKIFPSVSFGPDYIKALKAVLPPQIPVFAVGGITPENLH
FT                   LYLAAGCVGAGLGGDLYRAGQSVERTAQQAAAFVRAYKEATQ"
FT   gene            44376..45524
FT                   /locus_tag="Spro_0044"
FT   CDS_pept        44376..45524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0044"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: eca:ECA4416 DgoA protein [includes:
FT                   2-dehydro-3-deoxyphosphogalactonate aldolase; galactonate
FT                   dehydratase]"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39154"
FT                   /db_xref="GOA:A8G7R4"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7R4"
FT                   /protein_id="ABV39154.1"
FT                   /translation="MKITKMTTYRLPPRWMFLKIETDEGIVGWGEPVIEGRARSVEAAV
FT                   HELSEYVVGQDPARINDIWQTLYRGGFYRGGPILMSAIAGIDQALWDIKGKALGVPVYQ
FT                   LLGGLVRDKIKAYSWVGGDRPSDVIAGINKLTEIGFDTFKLNGCEEMGIIDSARKVDAA
FT                   VAVVAQIREAFGNRIEFGLDFHGRVDAPMAKILIKELEPYRPLFIEEPVLAEQAEYYPR
FT                   LAAQTHIPIAAGERMYSRFDFKRVLADGGLAIIQPDLSHAGGITECFKIAAMAETYDVA
FT                   LAPHCPLGPIALAACLHVDFVARNAVFQEQSMGIHYNQGAELLDYVVNKDDFKMTDGHF
FT                   YPLTKPGLGVEINEELVIERSKQATDWRNPVWRYPDGAVAEW"
FT   gene            45743..47035
FT                   /locus_tag="Spro_0045"
FT   CDS_pept        45743..47035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0045"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: phosphoglycerate transporter; d-galactonate
FT                   transporter; PFAM: major facilitator superfamily MFS_1;
FT                   KEGG: eca:ECA4415 putative D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39155"
FT                   /db_xref="GOA:A8G7R5"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R5"
FT                   /protein_id="ABV39155.1"
FT                   /translation="MEITLTSAPKSKRRYLTLFMIFVTVVICYVDRANLAVASAHIQQE
FT                   FGISKAQMGYIFSAFAWTYTLCQIPGGWFLDRVGSKLTYFIAIMGWSIATLLQGFASGL
FT                   VSLIGLRAVTGLFEAPAFPTNNRIVTSWFPEQERASAVGFYTSGQFVGLAFLTPLLIWV
FT                   QEILSWHWVFIITGGVGIVWALVWQRVYQSPRNSKGVNDAELKYIQDGGGMVDGDVASE
FT                   KKNRVALTAADWKLVFHRKLVGVYLGQFAITSTLWFFLTWFPNYLTQEKHIAALTAGFM
FT                   TTVPFLAAFCGVLLSGFVADRLLRSGRSIGFARKTPIICGLLLSTCIMGANYTNDPLWI
FT                   MVLMALAFFGNGFASITWSLVSSLAPTRLIGLTGGVFNFVGGLGGITVPLVVGYLAQDY
FT                   GFAPSLIYIAVVALLGALSYLLLVGDVKRVG"
FT   gene            47082..48362
FT                   /locus_tag="Spro_0046"
FT   CDS_pept        47082..48362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39156"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R6"
FT                   /protein_id="ABV39156.1"
FT                   /translation="MSHREKQLTFDPRGHQLTNINVWTPDSQWLAYDVRPSGASFTGLS
FT                   IERVNVDSGVVEVVYRAQHGAHVGVVTVSPDAPARYAFIHGPEHPDSVWHYDFHHRRGV
FT                   IVSEPDRELAITLDAMDITAPYTPGALRGGTHVHVFSPDGSRLSFTYNDHVMHELDPAL
FT                   DLRNVGVAVPLQGVNPPKQHPREYDGSHYCVLVSETTPQPQPGSDQINRAYEEGWVGQG
FT                   GYTRPDGRQQRWALAFIGDTISSSGEKLPEVFIVDLPQDDADYAKAGARPLQGTPTQIP
FT                   APPLGVRQRRLTFTGQRRFPGVATTPRHWLRSSPDGSMIACLMKDDAGVVQLWVVSPNG
FT                   GDPRQVTQGEQGIQSAFSWHPQGGRIALVCDNSLMLCEVASGRMQRLTQRTALPPSGDA
FT                   VVFSPDGSKVAFMREIDGFSQIFVAEV"
FT   gene            complement(48397..48741)
FT                   /locus_tag="Spro_0047"
FT   CDS_pept        complement(48397..48741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0047"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375; KEGG:
FT                   eca:ECA4404 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39157"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7R7"
FT                   /protein_id="ABV39157.1"
FT                   /translation="MKTIRVIATSCMLLATNGCSSVMSHTGPNQGYYPGTRASMNVLRD
FT                   DNTSWAMMPLVALDLPFSAVMDTVLLPYDYMRSGSDGTADSPRARILRGEEQNLAASGD
FT                   PAHAAAATPQ"
FT   sig_peptide     complement(48667..48741)
FT                   /locus_tag="Spro_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 25"
FT   gene            49046..49459
FT                   /locus_tag="Spro_0048"
FT   CDS_pept        49046..49459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0048"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ypi:YpsIP31758_4143 small heat shock protein IbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39158"
FT                   /db_xref="GOA:A8G7R8"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7R8"
FT                   /protein_id="ABV39158.1"
FT                   /translation="MRNFDLSPLYRSAIGFDRLFNALEAGQSQGNGGYPPYNVELVDEN
FT                   HYRIAIAVAGFAEQELEITTQDNLLIVRGAHNNEPAERTYLYQGIAERNFERKFQLAEH
FT                   IQIKGAKLENGLLYIDMERIVPETLKPRRIEIK"
FT   gene            49568..49996
FT                   /locus_tag="Spro_0049"
FT   CDS_pept        49568..49996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0049"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ypi:YpsIP31758_4142 small heat shock protein IbpB"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39159"
FT                   /db_xref="GOA:A8G7R9"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7R9"
FT                   /protein_id="ABV39159.1"
FT                   /translation="MRNYDLSPLLRQWIGFDKLASSMGGQEPQGFPPYNIEKSDDNHYR
FT                   ISLALAGFKQSELDIEVEGPRLTVRGKPTPSEKQVEYLHQGLVCKEFALTFTLAEHLQV
FT                   SEAQFENGLLHIDLVRQVPEALQPQRIAIGTTPGLEAK"
FT   gene            50164..51822
FT                   /locus_tag="Spro_0050"
FT   CDS_pept        50164..51822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0050"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: TrkA-C domain
FT                   protein; YidE/YbjL duplication domain protein; KEGG:
FT                   ypp:YPDSF_0014 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39160"
FT                   /db_xref="GOA:A8G7S0"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7S0"
FT                   /protein_id="ABV39160.1"
FT                   /translation="MSEIALTVSMLALVAVLGLWMGNWKIYGVGLGIGGVLFGGIIVGH
FT                   FAQSWQLNLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNGFAILLVLVG
FT                   GLVAAVVHKLFAVPLPIILGVFSGAVTNTPALGAGQQILTDLGSDPALVDRMGMGYAMA
FT                   YPFGICGILLVMWLIRLFFRINIEQEAQAFASSLGNQRELLHTMNVAVRNPNLQGMAIK
FT                   NVPLLNGEDIICSRLKRGDLLMVPAPLEKLELGDYLHLVGKRESLENARLVIGEEVDVS
FT                   LSTRGTELQVVRAVVTNEKVLGSKIRDLNLKQKYDVVISRLNRSGVELVAGSNVTLQFG
FT                   DILNLVGRPESIEAVAAIVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLFIPGFPAALR
FT                   LGLAGGPLVAALILGRIGSIGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGNFVDTL
FT                   INGEGLAWIGYGALITAIPLFSVGVLARMVGKMNYLTLSGMLAGSMTDPPALAFANGLH
FT                   PTSGAAALSYATVYPLAMFLRIMSPQLLAVLFWAM"
FT   gene            complement(51859..52239)
FT                   /locus_tag="Spro_0051"
FT   CDS_pept        complement(51859..52239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0051"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ret:RHE_PF00555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39161"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S1"
FT                   /protein_id="ABV39161.1"
FT                   /translation="MTAQLVLFDTNILIDYLNGIPQAREVLTEYHAHPAISAITWMEVM
FT                   VGAKKQSSALELKTRQFLGQFLLLPITDEVAERAVELRHSRGIKLPDAIIWATAQIGFR
FT                   TLISRNPKDFGTSNGVLMPYQL"
FT   gene            complement(52239..52448)
FT                   /locus_tag="Spro_0052"
FT   CDS_pept        complement(52239..52448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecs:ECs4816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39162"
FT                   /db_xref="GOA:A8G7S2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S2"
FT                   /protein_id="ABV39162.1"
FT                   /translation="MIDLPEEDLRQLDNLKNIRHVPRAEIIRQAVSRYLVVNRVDDPSN
FT                   AFGLWSGVLGDGVDYENQLREEWD"
FT   gene            complement(52549..53871)
FT                   /locus_tag="Spro_0053"
FT   CDS_pept        complement(52549..53871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0053"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   yps:YPTB3907 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39163"
FT                   /db_xref="GOA:A8G7S3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S3"
FT                   /protein_id="ABV39163.1"
FT                   /translation="MNRIASEIDRRYGGELPAKNNTAAPMTFSLFGDKFTRYAGITRLM
FT                   DDLNEGLRTPGAIMLGGGNPAQIPEMESYFKQLCQDMLDQGKLTEALCNYDGPQGKDAL
FT                   LKALAKLLRDELGWQISPQNIALTNGSQSAFFYLFNLFAGRYADGSRRRVLFPLAPEYI
FT                   GYADAGLDEGLFVSAKPNIELLPEGQFKYHVDFEHLNIGDDIGMICVSRPTNPTGNVIT
FT                   DEELMKLDRLAQQRNIPLVIDNAYGVPFPGIIFSDATPLWNPNIILCMSLSKLGLPGSR
FT                   CGIVIADEKTISALTNMNGIISLSPGSMGPAMATEMIERGDLLRLSNEVIRPFYKQRVE
FT                   HTIEIIRRYLSPERCLIHKPEGAIFLWLWFKDLPITTELLYQRLKKRGVLMVPGHYFFP
FT                   GLEHEWPHTHQCMRMNYVPDPEKIERGVAILAEEIERAHQE"
FT   gene            complement(53931..55997)
FT                   /locus_tag="Spro_0054"
FT   CDS_pept        complement(53931..55997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0054"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ypi:YpsIP31758_4138
FT                   alpha-amylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39164"
FT                   /db_xref="GOA:A8G7S4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR014635"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S4"
FT                   /protein_id="ABV39164.1"
FT                   /translation="MKRLTLPLLMLLSPAAMASWTLQSFPAFDESASGLFTSHATLAKG
FT                   ELPLKIYQNQQCWQPTTAAKLNQALSLQPCGDNPPVNWRLFRAGEYQVRIDTRSGTPTL
FT                   QLSLKTAPEIAASAVARTCPRWNGLPVTLDVAATFAEGETVRDFYSGQTTNVSQGKVTL
FT                   QPAAGSGGLLLLESASNEKAAPFNWHNATVYFALTDRFENGNPANDHSYGRRSDGMQEI
FT                   GTFHGGDLAGLTKKLDYLQQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYALD
FT                   WTRLDANMGSEQDLRTLVEQAHQRGIRILFDVVVNHVGYATLADMQTFQFGSLYLKGAE
FT                   IEKTLGKNWGDWRPGTGQNWHSFNDYINFSDKAGWDAWWGKNWIRTDIGDYDPPGYDDL
FT                   TMSLAFLPDIKTEASGASGLPLFYRHKPDTAAHEIPGATPRDYLTTWLSQWVRDYGIDG
FT                   FRVDTAKHVEKPTLALLKQRATAALAEWKAAHPQQALDNAPFWMTGEAWGHGVMKSDYY
FT                   QNGFDAMINFDFQDQASQALSCFSSIDTTYQQMADKLQDFNVLSYISSHDTRLFFASDA
FT                   KGSLALQQRAADLLLLAPGAVQIYYGDESGRQLGPSGSDPLQGTRSDMNWSELQGDKAP
FT                   LLAHWQRLGQFRARHPAIGAGKQQSQQTAQYYAFSRRLSDDKVMVVWVGDRSQ"
FT   sig_peptide     complement(55941..55997)
FT                   /locus_tag="Spro_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 19"
FT   gene            56186..56434
FT                   /locus_tag="Spro_0055"
FT   CDS_pept        56186..56434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0055"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: eca:ECA2757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39165"
FT                   /db_xref="GOA:A8G7S5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S5"
FT                   /protein_id="ABV39165.1"
FT                   /translation="MSVMSVRLSEDLSEQLEALAKATGRTKSFLAGQAIRDFINREAWQ
FT                   IAETQQAIIEADQGDFVSDDEMEARFKKMGVIVNDEN"
FT   gene            56424..56711
FT                   /locus_tag="Spro_0056"
FT   CDS_pept        56424..56711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0056"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   eca:ECA2758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39166"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S6"
FT                   /protein_id="ABV39166.1"
FT                   /translation="MKIKWLRKAASNFDDAYDWFYQESPQVATQFAREVFRLVNLLATN
FT                   PALGRAGRVMGTREIVMKTFPYLIPYRIKNNEIHILRVFHMRRHPPKKSW"
FT   gene            complement(56756..57733)
FT                   /locus_tag="Spro_0057"
FT   CDS_pept        complement(56756..57733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0057"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: yen:YE4159 putative
FT                   D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39167"
FT                   /db_xref="GOA:A8G7S7"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7S7"
FT                   /protein_id="ABV39167.1"
FT                   /translation="MKPSIVLYKNIPADLRERLEQHFTVHAFDGLTPDNHDELRQALQQ
FT                   AEGIIGSGGKIDEAFLQQTPKLRAASTISVGYDNFDVDALNAHNVLLMHTPTVLTETVA
FT                   DTIMSLVLATARRVVEVAERVKAGEWQGSIGADWFGVDVHHKTIGILGMGRIGLALAQR
FT                   AHFGFGMPVLYNARRTHEEAEQRFNARRCDLDTLLAESDFICITLPLTDETFHMISRDQ
FT                   LAKMKKSGILINAGRGPVVDEAALIEALQNGTIHAAGLDVFEKEPLPVSSPLLTLPNVV
FT                   ALPHIGSATHETRYGMAECAVDNLIAALTGTVKENCVNPQLLKK"
FT   gene            complement(57838..59106)
FT                   /locus_tag="Spro_0058"
FT   CDS_pept        complement(57838..59106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0058"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: ent:Ent638_0168 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39168"
FT                   /db_xref="GOA:A8G7S8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S8"
FT                   /protein_id="ABV39168.1"
FT                   /translation="MNKATIAAKRWWYIMPIVFITYSLAYLDRANFSFASAAGINDDLG
FT                   ITKGMSSLLGALFFLGYFFFQIPGAIYAERRSVKKLIFWCLILWGACASLTGMVSNIPM
FT                   LAAIRFILGVVEAAVMPAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGYLIH
FT                   AYGWREMFIFEGIPAVIWAFCWWVLAKDKPAQAKWLSDGEKLALQQQLEEEQKGIKAVR
FT                   NYGEAFRSRNVILLCAQYFAWSIGVYGFVLWLPSILRSGMQMGMVEAGWLSAVPYLAAT
FT                   IAMILVSWASDKMQNRKLFVWPLLLIGALAFFGSYAVGANHFWVSYTLLVIAGAAMYAP
FT                   YGPFFAIIPEMLPKNVAGGAMALINSMGALGSFFGSWFVGYLNGATGSPAASYMFMAIA
FT                   LLAAVVLTLVVKPARNEAQPQLA"
FT   gene            complement(59204..60163)
FT                   /locus_tag="Spro_0059"
FT   CDS_pept        complement(59204..60163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0059"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: kpn:KPN_03913
FT                   putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39169"
FT                   /db_xref="GOA:A8G7S9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7S9"
FT                   /protein_id="ABV39169.1"
FT                   /translation="MTTLTAAHSAPLDVVTLGEAMAMFVASQTGDMAEVETFTKRIAGA
FT                   ELNVAIGLARLGLNVGWVSRVGNDSFGRFALQQLKKEGINAQQVTVDGNYPTGFQIKSK
FT                   TTDGTDPKVEYFRKGSAASHLSVDDFNREYFGSARHLHLSGVAAALSGQSLALCHHAAR
FT                   EMRAMGKTISFDPNLRPVLWSSQQVMIEQLNKLAFAADWVLPGLKEGQILTGQSTPEGI
FT                   ADFYLERGVQAVIIKTGPDGAWFKTAAGDQAAVAAIKVDNVVDTVGAGDGFAVGTLSAL
FT                   LEGKTLKQAVQRGNKIGSLAIQAIGDSEGLPTRAALAE"
FT   gene            complement(60170..60922)
FT                   /locus_tag="Spro_0060"
FT   CDS_pept        complement(60170..60922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0060"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: kpn:KPN_03912 putative sugar phosphate
FT                   isomerase/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39170"
FT                   /db_xref="GOA:A8G7T0"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T0"
FT                   /protein_id="ABV39170.1"
FT                   /translation="MTREIIIVTGAYGTDTVQQLGGQAALLPIIAGAGADGVEIRRELF
FT                   SAQELQALPALAQAIEQQQLFAVYSAPEALFTPQHTLNPNLPALLAEAQTLNARQLKLS
FT                   LGHYQPGFDFTELKVALEQHPVNLVVENDQTPDCGILSLLNAFFHAAEDNRLPVSMTFD
FT                   MANWHWVGQDAFAAAERLARHVSYVHVKAATHSLKGWRAVALDDSDGKWRELLTRLPQD
FT                   VPRGIEFPLQGDSLEDVTRYYVNLLRAE"
FT   gene            complement(61106..62140)
FT                   /locus_tag="Spro_0061"
FT   CDS_pept        complement(61106..62140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0061"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: kpn:KPN_03911
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39171"
FT                   /db_xref="GOA:A8G7T1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T1"
FT                   /protein_id="ABV39171.1"
FT                   /translation="MSSVKAIRASGRATISDVAKTAKTGKTSVSRYLNGEQHLLSDDLK
FT                   QRIEQAIHQLDYRPSQMARSLKGGQTRLIGLIIADITNPYSVDVMRGIEAACRQHGFTL
FT                   LVCNTNNEVNQEQHYLQLLSSYRVEGIVVNAVGMREEALSTLQQSMLPMVLIDRKISDF
FT                   ACDVVGLNNHEAATVATEHLLQQGFEAILFLSEPIGTVNTRLERLHAFNQTMAQHAGLL
FT                   AEQAETPLNDVKQLEGVIRDFNARHRGMRKAVISANGALTLQVARAMRRLGIQWGSDIG
FT                   LLGFDELEWAELAGVGITTLKQPTYQMGHAALEQLVQRIQGLNTPISEQMFPGELIVRG
FT                   STTR"
FT   gene            complement(62260..62922)
FT                   /locus_tag="Spro_0062"
FT   CDS_pept        complement(62260..62922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0062"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; 17 kDa surface
FT                   antigen; KEGG: yen:YE4156 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39172"
FT                   /db_xref="GOA:A8G7T2"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T2"
FT                   /protein_id="ABV39172.1"
FT                   /translation="MNKRIAIIAGAVSIALTLSACTTNPYTGESEAGKSGIGAGIGAAL
FT                   GAGVGMLSSSKKDRGKGALIGAAAGAALGGGAGYYMDVQEAKLRDKMKGTGVSVTRQGD
FT                   NIVLNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNIIGYTDSTGSRALNMT
FT                   LSQQRADGVGSALITQGVAANRVRTSGAGPDNPIASNSTTEGKAQNRRVEITLSPLQ"
FT   sig_peptide     complement(62860..62922)
FT                   /locus_tag="Spro_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 21"
FT   gene            complement(63191..63649)
FT                   /locus_tag="Spro_0063"
FT   CDS_pept        complement(63191..63649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0063"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA0081 putative GNAT-family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39173"
FT                   /db_xref="GOA:A8G7T3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T3"
FT                   /protein_id="ABV39173.1"
FT                   /translation="MPLLPKAVAIHPCGPADLPRLMALWLPSTIAAHPFVKESYWRESA
FT                   TLVRENYLPRAHSWAYWHEGEIVGFISVLDQRFIGALFVEQAFHGRGVGQALMAHVQQR
FT                   YPQLSLEVYQENLRACAFYHKQGFQVTQRLLNEETQAHTLLMNWAASV"
FT   gene            complement(63625..64188)
FT                   /locus_tag="Spro_0064"
FT   CDS_pept        complement(63625..64188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0064"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: yen:YE4152 DNA-3-methyladenine glycosylase;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39174"
FT                   /db_xref="GOA:A8G7T4"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T4"
FT                   /protein_id="ABV39174.1"
FT                   /translation="MINERCGWVTADPLYLEYHDKEWGAPTTDARELFEMLCLEGQQAG
FT                   LSWITVLKKRENYRRAFHNFDPQRVAAISEQEVETLLQDSGIIRHRGKIEAIIANARAY
FT                   LAMEAAGEDFVSFIWTFVDGKPLLNRWQQLSEVPAKTERSDAMSKALKKRGFKFIGSTT
FT                   CYAFMQASGLVNDHLTGCLCYPKP"
FT   gene            64387..66375
FT                   /locus_tag="Spro_0065"
FT   CDS_pept        64387..66375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0065"
FT                   /product="outer membrane autotransporter barrel domain"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: spt:SPA2157 outer membrane esterase; TIGRFAM:
FT                   outer membrane autotransporter barrel domain; PFAM:
FT                   lipolytic protein G-D-S-L family; Autotransporter beta-
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39175"
FT                   /db_xref="GOA:A8G7T5"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T5"
FT                   /protein_id="ABV39175.1"
FT                   /translation="MPLKITRMPRPAVLAVAILCSMTTSALAYDQLYVFGDSLSDTGNN
FT                   GRFTYDSNKHLLYDEVLAQRIGAALVASDNGGDNYAAGGGVAVPALNPADNTQDQVQSY
FT                   LNRVNGRADGDGLYIHWIGGNDLAAAALNPTTAPGVAYNSAAAAAAQVHSLLNAGAGTV
FT                   IVPTVPNIGSTPQLMELIIQQALTPVQNAAVQAAYATLNSLATPDNDSRTQAIHQALTA
FT                   AAAQGSTIPQVQQAIAAQLIAAFDSLSAQAGQLTDFYNQNEDRLLALGSGNIVRVDVNK
FT                   LFSEAIANPAQFGFTNTAGMACPPGVSSAVCSSAMPGFDSSQSYLFADHFHPSPQAHQL
FT                   IADYIQAVLDGPAQVVALNQATAAMARDSRATLDSRFQQLRNGGNPQGALGVFGGYAGQ
FT                   HYDYSANLAAGDGNATTHNLTVGVDYQLTDGWLIGALISGSNDDQQPSSRYDYKARGLL
FT                   FSAFTALDVFEHGWVNADLHYATMDYDDIRRSMQLGSLTRTETGSTDGKQWGARVTAGY
FT                   DFPVTSYLTTGPMAQFAWDYSNVSGYSEDGNDSTAMRFNDQTYHSQIGALGWRLDSNFG
FT                   LFNLYAEVSYQHQFGDDVYRAGGGLKSTQTSFTRDSANQDKNWLDVTLGANMPLTDQVA
FT                   AFATVSQTGGLSSGEQFMYNVGVSARF"
FT   sig_peptide     64387..64473
FT                   /locus_tag="Spro_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            67169..67915
FT                   /locus_tag="Spro_0066"
FT   CDS_pept        67169..67915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0066"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: yen:YE1026 LuxR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39176"
FT                   /db_xref="GOA:A8G7T6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T6"
FT                   /protein_id="ABV39176.1"
FT                   /translation="MSNSFFNDETINTTIKNDLEGKLSEYSNVKYAYAIMNKRNPANFA
FT                   IISNGTEWFEFYTENNYQFIDPVLITASRRITPFSWDENIMIDPGLKLPRIFDMAKNYN
FT                   VVNGYTFVLHDHNHNLVVLSIMIDKNCDYNIEERIIANQDKLQMLLITTHDKLTAFYKE
FT                   INSPTYFDKMNNKGIFSKRENEIIYWASMGKSYQEIALILGIKLTTIKYHIGNAVKKLG
FT                   VTNAKHAIRLGVELQLIRPVLPDTEG"
FT   gene            complement(67874..68548)
FT                   /locus_tag="Spro_0067"
FT   CDS_pept        complement(67874..68548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0067"
FT                   /product="autoinducer synthesis protein"
FT                   /note="PFAM: autoinducer synthesis protein; KEGG:
FT                   eca:ECA0105 N-acylhomoserine lactone synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39177"
FT                   /db_xref="GOA:A8G7T7"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T7"
FT                   /protein_id="ABV39177.1"
FT                   /translation="MEDVEMIEIFDVDYNLLSDNRSKELFSLRKRTFKDRLNWIVNCEN
FT                   NMEFDEYDNNHTTYLFGMYENMVVCSLRFIETKYNNMITGTFKSYFNKIELPEGNFVEA
FT                   SRLFIDKGRVQAMKLQNEPISSLLFLSMINYARNYDYQGIYAIISHPMLIIFQRSGWEI
FT                   TVVEQGQSEKNQRIYLIYMPVDDRNQQILVDRINLAHPGLTPDRDAWPLTFRVRKHGSD
FT                   QL"
FT   gene            complement(68897..70240)
FT                   /locus_tag="Spro_0068"
FT   CDS_pept        complement(68897..70240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0068"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bmb:BruAb1_1939 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39178"
FT                   /db_xref="GOA:A8G7T8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7T8"
FT                   /protein_id="ABV39178.1"
FT                   /translation="MTTALTDSRYRYRIFAMVFFIALINYVDRGALSFAANDISREFNF
FT                   NKAQLGAVLGYFGFGYLFGSLCGGFLADRVGTKKVWLIAGALWSLLEIATAWAGELGVA
FT                   LFGGSAIMGFAALRIMFGFAEGPAYALMNKTIANWAPRKERGFSLGIGLLSTQVGSLLT
FT                   APLAVGLLLLTDDWRSMFMLLGLFSLIAILLFARFFTDTPEEHPEVNAVELAAISADQD
FT                   ADSQQPRLPWWAFFTNRTLVFNALGYFSFLYVTFVLVTWGPKYLQDTFNYDLHSLWYVA
FT                   MIPWSGACFTVLLGGRIADALLRRFGNLRLARNLFAAITLLLTATCFLLIPFMSTPTEI
FT                   ILLMTLGNALNALVNNVYWSVVIDVTPKASVGAYSGMTLAIANIASITAPMLSGWLAQH
FT                   HGYGAMFFATAVVSFCSMLCMTLLQPERKMGADSSLVSHSGIQHAAQR"
FT   gene            70502..71416
FT                   /locus_tag="Spro_0069"
FT   CDS_pept        70502..71416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0069"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ypi:YpsIP31758_4131 glycyl-tRNA synthetase,
FT                   alpha subunit; TIGRFAM: glycyl-tRNA synthetase, alpha
FT                   subunit; PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39179"
FT                   /db_xref="GOA:A8G7T9"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7T9"
FT                   /protein_id="ABV39179.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKE
FT                   LGLDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGMECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGVTTYGDVFHQNEVEQSTYNFEYADVDFLFSC
FT                   FEQYEKEAQSLLALEKPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCKKNKS"
FT   gene            71426..73495
FT                   /locus_tag="Spro_0070"
FT   CDS_pept        71426..73495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0070"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: ypi:YpsIP31758_4130 glycyl-tRNA synthetase,
FT                   beta subunit; TIGRFAM: glycyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39180"
FT                   /db_xref="GOA:A8G7U0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7U0"
FT                   /protein_id="ABV39180.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAEAFAANFTAELDSANLEHGEV
FT                   SWFAAPRRLALKVANLSAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQ
FT                   AERLVTDKGEWLLYRAHVKGQSAQALLAGMVSNSLAKLPIPKLMRWGDSDVQFVRPVHT
FT                   VTMLLGAELIPGTVLGIDSARTVRGHRFMGEAEFTIDNADQYPQILLERGKVIADYETR
FT                   KAMIKRDAELAASTIGGKADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDAAGKLLPNFIFVANIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKK
FT                   RLEDNLPRLETVLFQQQLGTLRDKTDRIQALAGWVAGQIGADVNHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDALPESLVACSLAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLTLDLQTLTEEAVRLYGSKLTN
FT                   AKVVDEVVEFMLGRFRAWYQEEGHAVDTIQAVLARRPTKPADFDARVKAVTHFRTLEAA
FT                   AALAAANKRVSNILAKSTDTLNDRVHASVLKEAAEIQLATHLVVLRDKLEPYFAAGNYQ
FT                   DALVELADLREPVDAFFDNVMVMAEDEAVRVNRLTLLSKLRELFLQVADISVLQ"
FT   gene            73841..74560
FT                   /locus_tag="Spro_0071"
FT   CDS_pept        73841..74560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39181"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U1"
FT                   /protein_id="ABV39181.1"
FT                   /translation="MAVGIQSRNFARWLAPVLALLVVMQLTACGDKEPEQRKAFIDYIQ
FT                   NTVMRSGAKIPTLSEDQKQKFGNYAGDYAILVGFSQQLSKSLDASLTPALDQINQIRTA
FT                   QDYMSKRDSLQQSVGALNLLGQQIQSAKSQADTARATLKQPDDLKAVYNQAYDKIVTGP
FT                   ANALMPVIPATASFVQDLVQVGDFLRTQGNQVSFNNNGVQFRTSQQATQYNTMMSNLVA
FT                   KQQDLLNAQKTVSSVTQ"
FT   sig_peptide     73841..73927
FT                   /locus_tag="Spro_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.634) with cleavage site probability 0.389 at
FT                   residue 29"
FT   gene            75110..77029
FT                   /locus_tag="Spro_0072"
FT   CDS_pept        75110..77029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0072"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; phosphotransferase system
FT                   EIIC; phosphotransferase system lactose/cellobiose-specific
FT                   IIB subunit; KEGG: yen:YE4148 PTS system, mannitol-specific
FT                   IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39182"
FT                   /db_xref="GOA:A8G7U2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U2"
FT                   /protein_id="ABV39182.1"
FT                   /translation="MFSPDIKVKVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLP
FT                   NETLAKLVGPMITYLLPLLIGFTGGRLVGGDRGGVVGAITTMGVIVGADMPMFLGAMIA
FT                   GPLGGWAIKHFDRWVDGKIKSGFEMLVNNFSAGIIGMLLAILSFMAIGPLVEGLSHILA
FT                   TGVNIMVTNNLLPLASIFVEPAKILFLNNAINHGIFSPLGIQQATETGKSIFFLIEANP
FT                   GPGLGVLMAYMFFGRGSAKQSAGGAAIIHFFGGIHEIYFPYVLMNPRLLLAVILGGMTG
FT                   VFTLTMLNGGLVSPASPGSILAVLAMTPKGAYFANLAAIGAAFVVSFVVAGFLLKTSKV
FT                   KEEDDLEEATRRMQEMKSQSKGGAAAHAAVDGDLTTVRKIIVACDAGMGSSAMGAGVLR
FT                   KKVADAGLKNISVTNSAINSLPDDVDLVITHRDLTERAMRHAPQAQHISLTNFLDSKLY
FT                   SDLTERLVAANKTTDNQQKVISTLDDSFEASEQNLFRLSESNVFLNLQASDKEQAIRFA
FT                   GEQLVKGGYVEPEYVPAMLEREKLTSTYLGESIAVPHGTIEAKDRVLRTGVVFCQYPQG
FT                   VRFGDEEDEVARLVIGIAARNNEHIQVITSLTNALDDDGVIERLANTSSVQEVLDLLGG
FT                   KKRG"
FT   gene            77088..78239
FT                   /locus_tag="Spro_0073"
FT   CDS_pept        77088..78239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0073"
FT                   /product="Mannitol dehydrogenase domain"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: yen:YE4147
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39183"
FT                   /db_xref="GOA:A8G7U3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7U3"
FT                   /protein_id="ABV39183.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADAQAELTFADVNQTVLDLLNSRKS
FT                   YQVHVVGEQARVEQVNNVSAVNSGSEEAVALIAEADIVTTAVGPQILAKIAGTIAKGLS
FT                   KRHQQGNSQPLNIIACENMVRGTSQLKQHVFDVLPQEDQAWALQHVGFVDSAVDRIVPP
FT                   AEAGSSDPLEVTVETFSEWIVDQTQFKGQPPAIAGMELTDNLMAFVERKLFTLNTGHAI
FT                   TAYLGQQAGLQTIRDAILDPKIRQVVKGAMEESGAVLIKRYGFDAAKHAAYIDKILSRF
FT                   ENPYLHDDVERVGRQPLRKLSAGDRLIKPLLGTLEYGLPHANLIQGIAAAMSYRSEQDP
FT                   QAKELVELLAKLGPKAALAQISGLPAESEVVEQAVAVYNAMQK"
FT   gene            78334..78885
FT                   /locus_tag="Spro_0074"
FT   CDS_pept        78334..78885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0074"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: yen:YE4146 mannitol
FT                   operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39184"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U4"
FT                   /protein_id="ABV39184.1"
FT                   /translation="MEEAQAFENKVLERLNAGKTVRSFLIAAVELLAEALNVLVVQVFR
FT                   KDDYAVKYAVEPLLSGAGPLGELSVRLKLMYGLGVISRHEYEDAELLMAMREELNHDGA
FT                   EYRFVDDEILGPFGELHCVAALPPVPTFLQPGEAEESLIAMQRQRYQQVLRSTMVLSVT
FT                   DLIAGIGAKQPSRLSPLGRN"
FT   gene            complement(78882..79490)
FT                   /locus_tag="Spro_0075"
FT   CDS_pept        complement(78882..79490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0075"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   yen:YE4145 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39185"
FT                   /db_xref="GOA:A8G7U5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U5"
FT                   /protein_id="ABV39185.1"
FT                   /translation="MLDSAFISYVTVMSITPGPNNLLLASSGVNFGLRRTLPMVFGISV
FT                   GCAVQLALTTTLLALILSSAAMIRFPLAVIGCTYLLWLSWKLFRAASPDGKQQAQPMRL
FT                   ISGALFQAVNPKAWLMAINVAILFTPREGASLGHTLMIIAGFTALNIPCVLVWAILGDR
FT                   LRDALRVTWKLRLFNGVMAGLMAATALWLLFDEWRAAFA"
FT   gene            79630..81096
FT                   /locus_tag="Spro_0076"
FT   CDS_pept        79630..81096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0076"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: yen:YE4144 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39186"
FT                   /db_xref="GOA:A8G7U6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U6"
FT                   /protein_id="ABV39186.1"
FT                   /translation="MTLLDEMPETRYQQLADTLAEAIRRGTLLPGSRLPSVRRCAQSHS
FT                   VSINTVVAAYRTLEDRGLIEARPQSGFYVCNTLPALKAASPTSSRIEPPADDVLALIDT
FT                   VFAAQQNPAFTNLSLACPQTSDFYPGGKLGRMLSSQLRRQPNLIGQYALPPGSLRLRQQ
FT                   ITRRSMALGMLLEPGDITLTHGCMEALQLALRVTTKPGDCIGLESPTYFYLLPLLASLG
FT                   LKALEIPTDPQHGLSLDALELLLNEKRLNAVIAMPTVQNPLGCTMPLAAKKRLARLMND
FT                   HQVPLIEDGLYAELQFGNALSPAVKSFDRDGWVLFCSSFTKTLAPDFRIGWISGGRFNE
FT                   ALRKLKAVSSMSESQLLSETLAMFLETGGYDHHLRNLRKRYAAQVDEARALIARHFPRG
FT                   TRATQPAGGFVFWVEFPVGVDSVALFHQMLEEQICLTPGTLYSPSGRYRNALRLSCCYP
FT                   FNARYSQALARVGAKACEMSGLPPGIAQDE"
FT   gene            81118..81531
FT                   /locus_tag="Spro_0077"
FT   CDS_pept        81118..81531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39187"
FT                   /db_xref="InterPro:IPR021230"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U7"
FT                   /protein_id="ABV39187.1"
FT                   /translation="MWTSLISVPYRHNRPETMKEIEKAEIKRLSDLLDALKHKDTLIIQ
FT                   QGNLDLIAQHTKEKEKMAAEIERLKGVRVEKLSAEAQKLSQLPFNREITKKEQADMGTL
FT                   KKNVRGLIVVHPMTALGREMGLKVVTGYARKAF"
FT   gene            complement(81566..82345)
FT                   /locus_tag="Spro_0078"
FT   CDS_pept        complement(81566..82345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0078"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pfo:Pfl_2883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39188"
FT                   /db_xref="GOA:A8G7U8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U8"
FT                   /protein_id="ABV39188.1"
FT                   /translation="MNTPSHSIHHAAAEGYQANADRYVKGRPDYPPEITTWLRDTIGLH
FT                   AGMTVIDLGAGTGKFTPRLLETGAQVIAVEPVAQMLEKLSAALPQVKTLAGTAESIPLP
FT                   DESVDAVVCAQSFHWFATPRALAEIQRILKPGGKLGLVWNMRDARVSWVRKLNQIVDRH
FT                   EGDAPRFYTGEWRKLFPTKGLEPLQEQVFMLGHQGAVEDVIYNRVRSTSFIAALPLEQQ
FT                   EQVIEQIRQLVAEEGELQGKDTVTVPYQTKAYFTTKL"
FT   gene            complement(82460..83131)
FT                   /locus_tag="Spro_0079"
FT   CDS_pept        complement(82460..83131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0079"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha domain protein; MOSC domain containing
FT                   protein; KEGG: yen:YE4140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39189"
FT                   /db_xref="GOA:A8G7U9"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7U9"
FT                   /protein_id="ABV39189.1"
FT                   /translation="MHHPEVYIGTIQPYEGGRPSGIAKRLVDGIVKLTPLGLEGDEQAE
FT                   KSYHGGPDRALCHYPREHYEHWREQFPAQAEQFCAPAFGENISTLGLTEHNVFMGDIFR
FT                   WGEALIQVTQPRSPCFKLNYHFDIDDISVLMQQSGRCGWLYRVVSAGKVSGDRPLELAT
FT                   RNSDVSVAEAIGIAWHMPFDEEQYRRLLAVAGLSASWSKTMLTRISEGRIEDFNRRLLG
FT                   R"
FT   gene            complement(83225..85153)
FT                   /locus_tag="Spro_0080"
FT   CDS_pept        complement(83225..85153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0080"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: yen:YE4139
FT                   methyl-accepting chemotaxis protein II"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39190"
FT                   /db_xref="GOA:A8G7V0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V0"
FT                   /protein_id="ABV39190.1"
FT                   /translation="MAALKTLAGKFVHLTVGKKLGLGFGLMLLLTAIIAGTGAQYLNII
FT                   ESRANRIDFSNRLNDEINQAKYNRALFGQTYKPEYLKNNRTNIENAVKLINQGQELNWD
FT                   TQSRKDLQRLVGLIGQYQQQQNAFEKAVAAKDAVRQSWNMSEVQDSLNQVERQITNADL
FT                   QLAFIQLNQKLTLVRYGARGLLLSLSAESEAPLVAAIDDARSAANALSRRLSDAQRPLL
FT                   QPLLTALDDYKNRIEAYLPAYQQEQAVSQLLGNSAQEVGTLVNAFMQDELTQTHNDINS
FT                   AQLQMGITTLIAIIAGLLVAWRITLQITRPLQSTLALAERIASGDLRQAQTSTRRDELG
FT                   QLLNAVAAMSQNLRDMIEKIQMGVSQVSTAAAEIAAGNTDLSSRTEQQAAAVEETAASM
FT                   EQLTATVKQNAENAHHANQLATDASQTAQQGGKLVESVVSTMRDISSSSQRIAEITTLI
FT                   NGIAFQTNILALNAAVEAARAGEQGRGFSVVASEVRNLAQRSAQAAKEIEGLIAESVNR
FT                   VQTGTTLVENTGNTMEQIVLSVTHVRDIMAEIAAASDEQTRGIAQIGQAIVEMDHTTQQ
FT                   NAALVEESAAAADSLEEQAEMLLQSVSVFRLAEHSVPAAAKTVAVKAPIGKQPATQTAE
FT                   QDNWTTF"
FT   gene            complement(85281..85901)
FT                   /locus_tag="Spro_0081"
FT   CDS_pept        complement(85281..85901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0081"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   yen:YE4138 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39191"
FT                   /db_xref="GOA:A8G7V1"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V1"
FT                   /protein_id="ABV39191.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEA
FT                   YPELAQYSVEDLIQDLDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGGDLKAAIE
FT                   RDFGSVEKFQEEFEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFP
FT                   IVGLDVWEHAYYLKYQNKRPDYIKAFWNVVNWDEAAARFAAKK"
FT   gene            complement(86032..86868)
FT                   /locus_tag="Spro_0082"
FT   CDS_pept        complement(86032..86868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0082"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: yps:YPTB3926 putative formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39192"
FT                   /db_xref="GOA:A8G7V2"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V2"
FT                   /protein_id="ABV39192.1"
FT                   /translation="MNNINPDQHINDINETLLTGVTRSQVYQRGQLATAQQDWLAEEVP
FT                   VALVYNGISHVVMMCTPKDLEAFALGFSLSEGIIESPRDIYSIEINQTCNGLEVQIELS
FT                   SRRFAGLKERRRAMAGRTGCGVCGIEQLADIFRPLPALPFTQTFSLTNLDSALKQLREV
FT                   QKVGQLTGCTHAAAWLSPQGELLGGCEDVGRHVALDKLLGVRAKQGWQQGAVLTSSRAS
FT                   YEMVQKSAMCGVEILFVVSAATSLAVEIAERSNLTLVGFSKPGRATVFTHPQRIVD"
FT   gene            87013..87600
FT                   /locus_tag="Spro_0083"
FT   CDS_pept        87013..87600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0083"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: ypi:YpsIP31758_4119 aerobic formate dehydrogenase,
FT                   alpha subunit, proteobacterial-type"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39193"
FT                   /db_xref="GOA:A8G7V3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V3"
FT                   /protein_id="ABV39193.1"
FT                   /translation="MQVSRRQFFKICAGGMAGTTVAALGFAPEVALAETRQYKLLRARE
FT                   TRNTCTYCSVGCGLLMYSLGDGAKNAKESIFHIEGDPDHPVNRGALCPKGAGLVDFIHS
FT                   ASRLQYPEYRAPGSDKWQRLSWDDAFTRIAKLMKEDRDANFVKTNEQGVTVNRWLSTGM
FT                   LCASASSNETGYLTQKFSRALGMLAVDNQARV"
FT   sig_peptide     87013..87114
FT                   /locus_tag="Spro_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.940 at
FT                   residue 34"
FT   gene            87649..90060
FT                   /locus_tag="Spro_0084"
FT   CDS_pept        87649..90060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0084"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="KEGG: yen:YE4135 formate dehydrogenase-o, major
FT                   subunit; TIGRFAM: formate dehydrogenase, alpha subunit;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39194"
FT                   /db_xref="GOA:A8G7V4"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V4"
FT                   /protein_id="ABV39194.1"
FT                   /translation="MTNHWVDIKNANLIIVMGGNAAEAHPVGFRWAMEAKIHNKAKLIV
FT                   IDPRFTRTASVADFYTPIRSGTDIAFLSGVLLYLMTNDKINREYVHAYTNASLLVREDF
FT                   TFEDGLFSGYDAENRKYDKTTWNYQFDENGFAKRDLTLQDPRCVWNLLKQHVSRYTPEV
FT                   VNNICGTPTEDFIKVCEYIAETCVADKTASFLYALGWTQHSVGSQNIRTMAMIQLLLGN
FT                   MGMAGGGVNALRGHSNIQGLTDLGLLSQSLPGYMTLPSEKQTDIDTYLKANTPKALLPG
FT                   QVNYWSNYPKFFVSMMKSFYGDKAQKENGWGFDWLPKWDKGYDVLQYFELMSQGKVNGY
FT                   FCQGFNPVASFPNKNKVVASLSKLKFLVTIDPLNTETSNFWQNHGEFNDVDPSKIQTEV
FT                   FRLPSSCFAEENGSIVNSGRWLQWHWKGADAPGEAKHDGEILAGIFIRLREMYARDGGA
FT                   VPEQVLNMTWDYLTPEDPASEEVAMESNGKALADVLDADGKVLAKKGEQLSTFAHLRDD
FT                   GTTASGCWIFAGSWTQAGNQMARRDNADPSGLGNTLGWAWAWPLNRRILYNRASADPQG
FT                   KPWDPKRQLLEWDGTKWGGVDIPDYSAAAPGSDVGPFIMQPEGMGRLFATDKMAEGPFP
FT                   EHYEPFETPLGTNPLHPNVVSNPAARVFKDDLAAMGTSDKFPYVGTTYRLTEHFHYWTK
FT                   HAILNAIAQPEQFVEIGEKLAAKKGIQHGDTVKVSSNRGFIKAKAVVTKRIRTLQVNGQ
FT                   DVDTIGIPIHWGYEGVAKKGFIANTLTPFVGDANTQTPEFKAFLVNVEKV"
FT   gene            90073..90972
FT                   /locus_tag="Spro_0085"
FT   CDS_pept        90073..90972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0085"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   ypi:YpsIP31758_4118 putative aerobic formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39195"
FT                   /db_xref="GOA:A8G7V5"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V5"
FT                   /protein_id="ABV39195.1"
FT                   /translation="MAMQSQDIIRKSATNGFTPAPRARDHQEEVAKLIDVTTCIGCKAC
FT                   QVACSEWNDIRDEIGSNVGVYDNPADLTAKSWTVMRFSEVEENGKLEWLIRKDGCMHCA
FT                   DPGCLKACPSEGAIIQYANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCTLC
FT                   VDRVDVGQEPACVKTCPTGAIHFGTKDAMKEIAAERVSELNTRGYQNAGLYDPAGVGGT
FT                   HVMYVLHHADKPQLYHGLPDNPTISPAITFWKGVWKPLAAIGFAATFAASVFHYVGVGP
FT                   NRVEEEDHDELHDEETRK"
FT   gene            90969..91604
FT                   /locus_tag="Spro_0086"
FT   CDS_pept        90969..91604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0086"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; PFAM:
FT                   cytochrome B561; KEGG: yen:YE4133 formate dehydrogenase,
FT                   cytochrome b556 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39196"
FT                   /db_xref="GOA:A8G7V6"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V6"
FT                   /protein_id="ABV39196.1"
FT                   /translation="MKKEKRIQRYSAPERINHWIVAFCFVFAAISGLGFFFPSFNWLMN
FT                   ILGTPQLARILHPFVGVIMFAAFLLMFLRYWKHNLINREDIVWAKNIQKIVMNEEVGDT
FT                   GRYNFGQKCVFWAAIISLVLLLASGVVIWRPYFAPSFPIPLIRIALLVHSLAAVGLIIV
FT                   IMVHIYAALWVKGTITAMVEGWVPAAWAKKHHPRWYREVREKQQEDKP"
FT   sig_peptide     90969..91094
FT                   /locus_tag="Spro_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.471 at
FT                   residue 42"
FT   gene            91604..92533
FT                   /locus_tag="Spro_0087"
FT   CDS_pept        91604..92533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0087"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   ypi:YpsIP31758_4116 formate dehydrogenase accessory protein
FT                   FdhE"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39197"
FT                   /db_xref="GOA:A8G7V7"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7V7"
FT                   /protein_id="ABV39197.1"
FT                   /translation="MSIRIVPKEQLGAQREKSTTAETIPPLLFANLKSLYSRRAERLRK
FT                   LATDNPLGDYLNFAAQLAEAQHHALHDNPLTLDLTEELQQGAASGKPPLDLSVFPRSEH
FT                   WHKLLVSLIAELRPQAPEHILAVLDNLEKASSHELELLADALLNQDFGKIGSEKAPFIW
FT                   AALSLYWAQMAGLIPGKARAEYGEHRQFCPVCGSIPVSSVVHIGTVSGLRYLHCNLCES
FT                   EWHVVRIKCSNCEQTRDLNYWSLDSELAAVKAESCGDCGTYLKILYQEKDPQVEAVADD
FT                   LATLVLDAKMEDEGFARSSINPFLFPGS"
FT   gene            92673..93320
FT                   /locus_tag="Spro_0088"
FT   CDS_pept        92673..93320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_0230 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39198"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V8"
FT                   /protein_id="ABV39198.1"
FT                   /translation="MLKTIAKFTAVAVLAIGLAACDNKDDTKPEVPKPDTKPVVTQPAP
FT                   TPPVVETKPAPPPGLKVSMQKGKITFELPSGFSDQTENSGIINDSKSTIQRFLDGKSRQ
FT                   STVSSEVIPPDDMKLNSSDKMLKDLTQSMITELADRYQNIQTTKEENFTVGKQKFRRVD
FT                   TEQSINGQKVVSTIMLTVLNKRVVTLQMLSPAKTPEAHQALVQQIIDTLTVN"
FT   sig_peptide     92673..92735
FT                   /locus_tag="Spro_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.385 at
FT                   residue 21"
FT   gene            93355..93960
FT                   /locus_tag="Spro_0089"
FT   CDS_pept        93355..93960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0089"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ent:Ent638_0139 glutathione S-transferase, C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39199"
FT                   /db_xref="GOA:A8G7V9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7V9"
FT                   /protein_id="ABV39199.1"
FT                   /translation="MKLIGSYTSPFVRKISVMLLEKGIAFEFVNDPPYEPGSRVVELNP
FT                   LAKVPVLVADDGGVFYDSRVIAEYLELLPAAPAFLPADRAAALSIRQVEALADGVTEAA
FT                   ATLYRESQRASDKQDENWILRQRAKLTHGLDALEKLAQEKTLLNTEALTLADIATGCAL
FT                   GYLNFRRIMPNWCVERPALIKLAERLFARESFARTSPP"
FT   gene            94027..95418
FT                   /locus_tag="Spro_0090"
FT   CDS_pept        94027..95418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0090"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   ypp:YPDSF_0039 L-seryl-tRNA selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39200"
FT                   /db_xref="GOA:A8G7W0"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7W0"
FT                   /protein_id="ABV39200.1"
FT                   /translation="MSTESQHLYSQLPAIDRLLRDPAIEPLVAQHGQTLISELLRQLQL
FT                   QARETIKQHQRLPDWCADWPQALGARLAQQQRPSLAPVFNLSGTVLHTNLGRALLAQPA
FT                   IEAVTRSMGAAVTLEYDLDGAGRGHRDRAVADLLCQLTGAEDACIVNNNAAAVLLMLAA
FT                   IAPGKQVVVSRGELVEIGGAFRIPDVMRQAGCQLVEVGTTNRTHLKDYRNAINDQTGLL
FT                   MKVHTSNYSIQGFTAAVDEAELAQLGAEHGLPTATDLGSGSLIDMAQYGLPAEPMPQRL
FT                   LAAGVDLVTFSGDKLLGGPQAGIIVGKKALIARLQQHPLKRALRVGKLTLAALEATLRL
FT                   YQQPELLGQQLPTLRLLTRPQQAMQAAAERLLQVLTPQFTGHFQLRAEPCWSQIGSGSL
FT                   PVDRLPSYALTFTPQDGRGATLEALAERWRALPQPVIGRINDGRLWLDLRCLEQEDALI
FT                   EALSA"
FT   gene            95415..97262
FT                   /locus_tag="Spro_0091"
FT   CDS_pept        95415..97262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0091"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3; KEGG: yen:YE4130
FT                   selenocysteinyl-tRNA-specific translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39201"
FT                   /db_xref="GOA:A8G7W1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W1"
FT                   /protein_id="ABV39201.1"
FT                   /translation="MIIATAGHVDHGKTTLLQAITGINADRLPEEKRRGMTLDLGYAYW
FT                   PQPDGRVLGFIDVPGHEKFLANMLAGVGGIDHALLVVACDDGVMAQTREHLAILRLSGQ
FT                   PALTVALTKADRVDEARIEEVRRQLSDELAHQGWHQVPMFVTATLQARGIDALRAHLLA
FT                   LQPDEHALTRRFRLAVDRAFSVKGAGLVVTGTALGGQVAVGDQLWLTGADTPVRVRGLH
FT                   AQNQPVEQAQAGQRIALNISGDVSKEQVARGDWLLAQKPLAAAERILVALDADQPIKHW
FT                   QPLHLHHAASHITGRVSLLNEGLAELILDRPLWLAENDRLVLRDIGARQTLGGARVLSL
FT                   ATPKRGKRQPEYLAWLAALAKADDDRQVLALHLPNGALDLAAFAWARQLTAGELAALLV
FT                   GRELLIAGDMALAQENVQQGQQRLLQVLADYHQQHSDQLGLGRARLRRMALPQLAEPLV
FT                   FMMIDRLLAEGLINNTRGWLHLPEHGLAFSAEELALWEIIEPRFGDEAWWVRDLATELG
FT                   EDEARIRATLRKAAQLGHVTAVVVDRYYLSQRIEQFAALIRELDVEQGSTNAADFRDRL
FT                   GVGRKLAIQVLEFFDRSGFTRRKGNQHLLRDSGLYTRHT"
FT   gene            complement(97654..98901)
FT                   /locus_tag="Spro_0092"
FT   CDS_pept        complement(97654..98901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0092"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ypi:YpsIP31758_4110 multidrug translocase MdfA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39202"
FT                   /db_xref="GOA:A8G7W2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W2"
FT                   /protein_id="ABV39202.1"
FT                   /translation="MKTTLPPAARLGRQALLFPLCLVLFEFATYIANDMIQPGMLAVVA
FT                   DFNAGEEWVPTSMTAYLAGGIFLQWLLGPLSDRRGRRPVMLAGVAFFIVACLAILLVTS
FT                   IEQFIFMRFLQGIGLCFIGAVGYATIQESFEESVCIKITALMANVALIAPLLGPLAGAA
FT                   LIHVAPWQSMFVLFAALAAFAFYGLWKAMPETASLQGEKLSAANLWRDYRQVLSNRRFV
FT                   CGALAIGFASLPLLAWIAQSPVILISGESLSTLDYGLLQIPVFGALILGNLTLARLTGK
FT                   NSVQRLIKLGAGPMMLGLLIAALATLFSTHAYLWMTAGLSLYAYGIGLANAGLYRLTLF
FT                   SSSVSKGTVSATMGMLSMMVFTVGIELAKVAYVWGGSGLFNLFNLISGLCWLALVALFL
FT                   SKRRSGDATPTPNAAL"
FT   gene            99120..100112
FT                   /locus_tag="Spro_0093"
FT   CDS_pept        99120..100112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39203"
FT                   /db_xref="GOA:A8G7W3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR032905"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W3"
FT                   /protein_id="ABV39203.1"
FT                   /translation="MSNKIGWIDNLRAVACMMVVMIHATTYYVTSGVAVGEHNWDIANV
FT                   LNSLSRVSVPLFFMISGYLFFGEKSAGKKHFIRIGCCILFYSTIALIYIAAFTKIGFWP
FT                   SLRGMLLKPVFYHLWFFYAIAVIYLLSPLVSVKPVSRRYLAGVLVILAVIANPNTSSLT
FT                   LGNTHLLPVNLYIYGDTFYYLLYALAGRAIGMMDTQGRGVSGLAALGFVASVALIIHGT
FT                   KSQMFINGNFADTYYIYCGPLVFIAAVSLVIWFKNCLPEPIGWLGVFSRHSLAIYGFHA
FT                   IIVNFMRNRHLELTTHPLLDIFWVFGVALALSLLLSIGLQKIDTRRLVS"
FT   gene            complement(100107..101030)
FT                   /locus_tag="Spro_0094"
FT   CDS_pept        complement(100107..101030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0094"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: yen:YE4125
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39204"
FT                   /db_xref="GOA:A8G7W4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W4"
FT                   /protein_id="ABV39204.1"
FT                   /translation="MPQAVYFLMLPQVLSLDVSGPAETLRLAGQFGLHYISPVPQVTCS
FT                   VGMTLSQLQPLPDRLEDGAILVVPGVSDSQHFFANGPAEQARRWLAALQPDLQQQRITL
FT                   VCVCSGALLAAQAGLLDGYQCTTHHDVIERMRQQAPAAQVKENRIFVEDRSVYTSAGIT
FT                   AGIDLALHLINRQCGASRAMEIAREMVVYFRRSGDDPQLSPWLRYRNHLHPAVHRAQDV
FT                   MAAEPEAEWSVPQVAEKAHVSSRHLARLFRSHVGISVREYHEQLRLAVAQQRLQQGYGL
FT                   EKAALAAGFSSGRQLRRAQQRGSIGL"
FT   gene            complement(101033..101584)
FT                   /locus_tag="Spro_0095"
FT   CDS_pept        complement(101033..101584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0095"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: yen:YE4124
FT                   putative member of isochorismatase hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39205"
FT                   /db_xref="GOA:A8G7W5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W5"
FT                   /protein_id="ABV39205.1"
FT                   /translation="MSHSALLIIDVQQSFQHRPFWQEQDLPAFQQALTRLIEGCRQQGV
FT                   ALVDVFHVSPEGPFSLASGWVKRLPFLDHQADVTVHKQVHNALTESGLDAWLLERHIKH
FT                   LIICGIRTEQCCETTTRVAADLGYQVTFVTEATLTFPMQHPDGEVFTTEQLKRHTETVL
FT                   VDRFARIASVDEALAQLSQE"
FT   gene            complement(101685..103079)
FT                   /locus_tag="Spro_0096"
FT   CDS_pept        complement(101685..103079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0096"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: pde:Pden_1057
FT                   N-isopropylammelide isopropylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39206"
FT                   /db_xref="GOA:A8G7W6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W6"
FT                   /protein_id="ABV39206.1"
FT                   /translation="MEKNQQQSRRAFLSQTGKITTACAVIGLTGGVAQAAVPTGSPCLP
FT                   EAQPMTLTDSHYWLSDVRLEEGFEYDGDTVIGTRTALYQLEIKDGKIAAIHPKDAAAPA
FT                   GVPRYQAQGQLLLPAFRDMHIHLDKTFYSGPWQAPRPRQGKTIMDMIALEQTLIPKLLP
FT                   TSQQRAENLIALLQSKGSTVARSHCNIDPVSGLKSLEHLQRALENHRADFSCEIVAFPQ
FT                   HGLLHSKVDGLMREAMQMGVQYVGGLDPTNVDGAMEQSLDAMFQIALDTGKGVDIHLHE
FT                   TSPAGVAAINYMITTVEKNPSLRGKVTISHAFALTALNPNELEETATRLAAQQITIAST
FT                   VPIGGLMMPLPQLSEKGVFVMTGTDSVIDHWSPFGTGDILEKANLYAQLYRGSDEFHLS
FT                   RAMAISTGGVLPLNDKGQRVWPKAGDSAEFVLIDASCSAEAVARLPTRRTTFHQGRLVA
FT                   GQVGKA"
FT   sig_peptide     complement(102972..103079)
FT                   /locus_tag="Spro_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 36"
FT   gene            complement(103226..104677)
FT                   /locus_tag="Spro_0097"
FT   CDS_pept        complement(103226..104677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0097"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: yen:YE4123 xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39207"
FT                   /db_xref="GOA:A8G7W7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W7"
FT                   /protein_id="ABV39207.1"
FT                   /translation="MYIGIDLGTSGVKVILLSEQGQLLASHGESLPISRPHPLWSEQAP
FT                   QDWWHATDRAMLALGKQHSLQQVKAIGLSGQMHGATLLDARQQVLRPAILWNDGRSGAQ
FT                   CLALEQAVPQSRQITGNLMMPGFTAPKLLWVQQHEPQVFERIDKVLLPKDYLRWCLTGD
FT                   FASDMSDAAGTGWLNVAQRDWSAEMLAACGLTRRQMPQLFEGNQVTGQTHTELARRWGM
FT                   SPVPVVAGGGDNAAGAIGVGLYQAGQAMLSLGTSGVYFAVSDGFLSNPASAVHSFCHAL
FT                   PDTWHLMSVTLSAASCLDWVCKLTNVEDVATLLRNVEQAPPAAAPLWFLPYLSGERTPH
FT                   NNPNAKGAFWGLTHQHGPNDLARAVLEGVGFALAEGMDVLHASGLQPTSITLIGGGARS
FT                   PFWRQMLADISGQRLEYRTGGDVGPALGAARLAQIALNPQRPLGELLPELPLEQVHTPN
FT                   AERHQQYAEQRSTFRELYTRLLPLM"
FT   gene            complement(104720..106039)
FT                   /locus_tag="Spro_0098"
FT   CDS_pept        complement(104720..106039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0098"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: ypi:YpsIP31758_4102 xylose isomerase; TIGRFAM:
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39208"
FT                   /db_xref="GOA:A8G7W8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G7W8"
FT                   /protein_id="ABV39208.1"
FT                   /translation="MQSYFDQLEQVHYEGPTSNNPLAFHHYNPDELVLGKRMAEHLRFA
FT                   ACYWHTFCWNGADMFGVGSFDRPWQQPGDALTLAKRKADVAFEFFHKLNVPYYCFHDVD
FT                   VSPEGASLKEYLHNFAVMTDVLEEKQHSSGVKLLWGTANCFTHPRYGAGAATNPDPEVF
FT                   SWAATQVFTAMNATQRLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHK
FT                   TGFQGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHH
FT                   EIATAIALGIFGSVDANRGDPQLGWDTDQFPISVEENALVMFEILKAGGFTTGGLNFDA
FT                   KVRRQSTDKYDLFYGHIGAMDTMALALKVAAKMVTDGQLHQQVSKRYAGWNGELGQQIL
FT                   QGKLSLEALAQYAEGHALAPQHVSGRQEQLENLMNRYLFG"
FT   gene            106406..107401
FT                   /locus_tag="Spro_0099"
FT   CDS_pept        106406..107401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0099"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /EC_number="3.6.3.17"
FT                   /note="KEGG: yps:YPTB3890 ABC transporter, periplasmic
FT                   xylose binding protein; TIGRFAM: D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; PFAM: periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39209"
FT                   /db_xref="GOA:A8G7W9"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7W9"
FT                   /protein_id="ABV39209.1"
FT                   /translation="MKFKPVFLSVCALLALASQPAQSKEVKIGMAIDDLRLERWQKDRD
FT                   IFVSKAKALGADVFVQSANGNEETQMAQIENMINRGVDVLVIIPYNGKVLSNVISEAKR
FT                   EGIKVLAYDRMINNADIDFYISFDNEKVGELQAQSLVQRVPQGNYFLMGGSPVDNNAKL
FT                   FRQGQMKVLQPLIDGGKIKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDAT
FT                   AGGAIQALAAQGLAGKVAISGQDADLAAVKRIVAGTQTMTVYKPISKLADEAAGIAVQL
FT                   GKGEQPKANATLNNGSKDVPSWLLTPIPVDKSNIDSTIVADGFHKKAEIN"
FT   sig_peptide     106406..106477
FT                   /locus_tag="Spro_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            107431..108972
FT                   /locus_tag="Spro_0100"
FT   CDS_pept        107431..108972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0100"
FT                   /product="D-xylose ABC transporter, ATPase subunit"
FT                   /note="KEGG: ypi:YpsIP31758_4100 D-xylose transport
FT                   ATP-binding protein XylG; TIGRFAM: D-xylose ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39210"
FT                   /db_xref="GOA:A8G7X0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X0"
FT                   /protein_id="ABV39210.1"
FT                   /translation="MPSLLEMKNITMQFGAVKAVDNVSLKLEAGQVLSLCGENGSGKST
FT                   LMKVLCGIYPHGSYQGDIYFSDDLLAAKNIRDTEQKGIAIIHQELALVKQMTVLENMFL
FT                   GNEWRRYGVMDYDAMYLRCRRMLAQVKLAVDPNTPIGELGLGQQQLVEIAKALNKQVRL
FT                   LVLDEPTASLTESETATLLAIIEDLRDHGIACIYISHKLNEVKAISDLICVIRDGKHIG
FT                   TRPAAEMSEDDIIAMMVGRELTELYPQQQHDIGEVILQVDNLTAWHPVNRHVRRVDDVS
FT                   FTLRRGEILGVAGLVGSGRTETMQCLFGVYPGRWQGSISLNGQPAVINNCRQAMRYGIA
FT                   MVPEDRKRDGIVPVMGVGANMTLAALSDFSGVLTVLDDAREQATIRQSLAQLKVKTSSP
FT                   ELAIARLSGGNQQKAILAKCLLLKPKILILDEPTRGIDIGAKHEIYKLINQLVQQGISV
FT                   IVVSSELPEVLGLSDRVLVMHQGRIKASLVNQGLTQEQVMEAALRSETDVEKHAV"
FT   gene            108950..110134
FT                   /locus_tag="Spro_0101"
FT   CDS_pept        108950..110134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0101"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG: yen:YE4119
FT                   sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39211"
FT                   /db_xref="GOA:A8G7X1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X1"
FT                   /protein_id="ABV39211.1"
FT                   /translation="MSKNTQYEAIVPAMVEKNPIVKLKSINLQVFVMLAAIVVIMLFFT
FT                   FTTEGAYLSARNISNLLRQTAITGILAVGMVFVIVSAEIDLSVGSMMGLLGGAAAIFDV
FT                   WLGWPLPLTIVVTLLAGLLLGAWNGWWVAYRKVPSFIVTLAGMLAFRGILIGITNGTTV
FT                   APTSGAMSQIGQSYLPNGLGFGIGAVGLMLFVAWQWRRRSRRAQLGLPVATAGGDVTRQ
FT                   SILALLVLGAIYLLNDYRGVPTPVLILTALMLAGIFMATRTAFGRRIYAIGGNIDAARL
FT                   SGVNVERTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAG
FT                   GIGSVAGAVMGAFIMASLDNGMSMLDVPTFWQYIVKGAILLLAVWMDSATKRRA"
FT   gene            110239..111417
FT                   /locus_tag="Spro_0102"
FT   CDS_pept        110239..111417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0102"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: ypi:YpsIP31758_4098 xylose operon
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39212"
FT                   /db_xref="GOA:A8G7X2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X2"
FT                   /protein_id="ABV39212.1"
FT                   /translation="MFEKRFRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDF
FT                   RCRIDNIKDWLGDGVIADFDDGAIEQLLHNVRVPIVGVGGSYHRDEDYPPVHYIATDNQ
FT                   ALVEAAFSHLKEKGINRFAFYGLPSEGGKRWAQEREHAFRQRVALEQYQGVVYQGMATA
FT                   PDNWQYAQNRLADWVQTLPQQTGIIAVTDARARHLLQVCEHLDIAVPEKLCVIGIDNEE
FT                   LTRYLSRVALSSVAQGTRQMGYRAAKLLHQLLDRRELPLQRILVPPVKVIERRSTDFRS
FT                   LRDPAVIQAMHYIRHHACKGIKVEQVLDAIGLSRSNLEKRFRDETGETIHHMIHQEKLD
FT                   RARNLLTATSLTINEISQMCGYPSLQYFYSVFKKGYDMTPKDYSGRYGEVGY"
FT   gene            111485..112105
FT                   /locus_tag="Spro_0103"
FT   CDS_pept        111485..112105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0103"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: lpp:plpp0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39213"
FT                   /db_xref="GOA:A8G7X3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X3"
FT                   /protein_id="ABV39213.1"
FT                   /translation="MYDPLLALLFSEYRRKVLTLLLNKPERAFHVREIARQTATQAGTL
FT                   HKELNKLAQGGILLRQQQGNQICYRANPDCLIFPELVAIFRKTSGMVERLRQALVELNA
FT                   EFELAFIFGSIASGKAKDDSDIDVLIVGNLSFSEVINAFYPLQQELGREINPKLYSPVE
FT                   WQAALAENSAFIQDIMSKPQLGILGDKDDVRQPDRPWPGGNKA"
FT   gene            112056..112496
FT                   /locus_tag="Spro_0104"
FT   CDS_pept        112056..112496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpp:plpp0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39214"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X4"
FT                   /protein_id="ABV39214.1"
FT                   /translation="MTLDNLIGLGLEAIKPDAGAIRKLLSAAARNRHDASITLLSNETR
FT                   FDTAYKAVMQIANAALQAEGFRTSSHKPGHHQLMIQSLPLTLGISREAMICLDALRKQR
FT                   NIADYSGDLVTDAAVSACLEQAGALWLAVNDWLQLKHPQFLE"
FT   gene            complement(112502..113356)
FT                   /locus_tag="Spro_0105"
FT   CDS_pept        complement(112502..113356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0105"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pap:PSPA7_2742 probable
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39215"
FT                   /db_xref="GOA:A8G7X5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X5"
FT                   /protein_id="ABV39215.1"
FT                   /translation="MNRYPMFNPQLLLSFVAVCDSNSFTRAAERVFLSQSTVSQQVRRL
FT                   EEMLGKPLFERSSHQVLLTEEGVKLLSYARRIIALNEEAHDALTGIWRDGVLRLGMPED
FT                   FAAPTTELLAEFSRAHPHLRLDVTSGLSADLHSAYAREELDLILVKQRRSQPPRAARPE
FT                   PLLWLDSLAFPAIEQSPVPLAVFPLNGLYRDDLCQALDNLGKRWRIGYSSASLAALTAA
FT                   SAAGLGVTLLPAGCRLPSHRVLGSAEGLPPIDNIELALYYRDGAPAATPALAERLKAFC
FT                   GLA"
FT   gene            113483..114682
FT                   /locus_tag="Spro_0106"
FT   CDS_pept        113483..114682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0106"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ecj:JW0332 predicted cyanate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39216"
FT                   /db_xref="GOA:A8G7X6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X6"
FT                   /protein_id="ABV39216.1"
FT                   /translation="MLNQFVAPPFLRRWFNPLLWALVLIGLNMRPLLTSIGPLLPTLRQ
FT                   ATGLSFGGAALLTTLPVLMMGLMALAGGAINRLFDERTSVVLSLLAIGLGAAWRELAPG
FT                   STQLLLSAVLGGLGIGVIQAVMPGIIKHHFLKQMALVAGLWSAALMGGGGLGAAMTPWL
FT                   MSVGHDWHRALAWWAVPALVALIAWWPVSRGLARLTPSGTSSGPSLWFSRRAWLLGAYF
FT                   GLINGGYTSLIAWLPPYYMQLGWQPQASGSLLALMTFGQVVGALLLPALARSLDRRPLL
FT                   LLALVMQLIGFIGLIYLPQTLPWLWVLVSGLGLGGAFPLCLVLALDHIPHPAAAGRLVA
FT                   FMQGIGFLLAGATPYISGLLRDYSGGFVLDWQIHALLVVVLIAITWCFHPHSYRRAFAE
FT                   "
FT   gene            114759..116105
FT                   /locus_tag="Spro_0107"
FT   CDS_pept        114759..116105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39217"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X7"
FT                   /protein_id="ABV39217.1"
FT                   /translation="MHITKTRLALLAGCMALSTNLWAQAQPVPATLAGHALLAVKSNVA
FT                   APQDAPADLQQSGKYTSGKRVTELGSVAGKSADRMTGIGLPINGQPLQGHSGIKHMPDG
FT                   TYWVLTDNGFGSKANSPDAMLYLNHYKIDFDNGTVTPLKTVFLHDPDKNVPFHIINEST
FT                   DKRYLTGSDFDPESFQFADNALWIGDEFGPYLIKADLNGKVLAVFDTKVDGKVVKSPDN
FT                   PTLTLPGAPDGKQNFQVARSKGFEGMAVSPDGSKLYPLLEGALWDGEKFENIDGKRYLR
FT                   VLEFDVKQQAWTGRSWQYVLEDNQNAIGDFNMIDATHGLVIERDNNEGTADQACAAGAP
FT                   TDNCFSQVAKFKRIYKIAFSDDNVGKPVDKLAYIDLMNIQDPNKLARKPLNNGVLTFPF
FT                   FTIENVDVVDGSHIIVGNDNNFPFSSSRQPNVADDNEFILLDVKELLKP"
FT   sig_peptide     114759..114830
FT                   /locus_tag="Spro_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 24"
FT   gene            116207..116297
FT                   /locus_tag="Spro_R0001"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            116207..116297
FT                   /locus_tag="Spro_R0001"
FT                   /product="tRNA-Sec"
FT   gene            116464..117633
FT                   /locus_tag="Spro_0108"
FT   CDS_pept        116464..117633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0108"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: ypp:YPDSF_3775
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39218"
FT                   /db_xref="GOA:A8G7X8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X8"
FT                   /protein_id="ABV39218.1"
FT                   /translation="MLLTDIQIRRSKPQEKPYTLNDGQGLSLLINTDGSKGWRFRYRYA
FT                   GKAKLMSFGTYPLVTLAEAREKRGEARKQVANGIDPVADKKAQKLAQKLSFENSFEAIS
FT                   REWHTNKADRWTLAYREEIMRTFEQDVFPHIGQRPIAEIKPLELLEVLRRIEKRGALEK
FT                   TRKIRQRCGEVFRYAIITGRAEYNPAPDLASALAVPKQKHHPFLSAEELPYFVKDLEGY
FT                   TGSIITKNAAKIVMLTGVRTQEMRFATWEEIDFERAIWEIPAARMKMRRLHIVPLSTQV
FT                   VELFKQLQPITGHYPYIFIGRNNRRKPISKESVNQVIELLGYKGRATGHGFRHTMSTIL
FT                   HEQGFDSAWIEMQLAHVDKNGIRGTYNHAQYFAQRQSMMQWYSDNILVL"
FT   gene            117630..119648
FT                   /locus_tag="Spro_0109"
FT   CDS_pept        117630..119648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fps:FP1554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39219"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7X9"
FT                   /protein_id="ABV39219.1"
FT                   /translation="MRRAFVAKEKIEVNDKGIRNRLKAIKPFNAMSEYIWNGFDAKASQ
FT                   VCIDYKVDVLGSVTEITISDDGSGINCTELNRKFKPFLSSEKRIDSENSLMSLVHGKNG
FT                   LGRLTFFKFARKAIWYTTYKEKNEYYSSEITVSDESLDNFSNTDIIKSKVKSCGTSVGF
FT                   YNVFDISGFYMESTLEPFLEREFSWFLYLTKNKNFSLSMNGKDILYNNLIKDSDTIKFN
FT                   FEGIEFTIEYVRWSCKLNNQASRMYFLTPDSDFKYSITTLLNNKSDSFHHSVYVHSSFF
FT                   ENFVASKDSNQNDFFSNDTNSEVFKELVKKINSFLRIKRKPFLIEFSKELVSSYEAKGV
FT                   FPEYNHRNRWEIMKAEDLREAVQQLYQIEPKFFKSLNKPQQKILVRMLSFIIDGGEVDS
FT                   LFDIVDSVISLSSEERDRFSEQLKVTHLSSILKTIELITDRYKSVQEFKKLVFDPSMYA
FT                   GEVPHLQKMMEKNYWLLGEQYQILTAEEPDFNEALRRHTYILRGEKSVEPIDHEFANRE
FT                   MDLFMVRQRYDNNTIEHIVVELKHPTNVRLGKKQIDQIYDYYQTIKSIDQFNASNMKWK
FT                   FYLIGNKFDSSHYIEDLINNLKGKGDYGLAHKGEYEIYVRTWSEVFADFDLKHNFLNEK
FT                   LNVEKEKIQVDIYSSADDIVANTRSSDGAPQIIVPST"
FT   gene            complement(120134..120886)
FT                   /locus_tag="Spro_0110"
FT   CDS_pept        complement(120134..120886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_2422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39220"
FT                   /db_xref="InterPro:IPR029492"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y0"
FT                   /protein_id="ABV39220.1"
FT                   /translation="MSSSKVRPTIDELFALLKNTNIPTVLVEGKDDIVFYRRIESDLDE
FT                   IGIDMLPAGNKWAVLELRDRIKKEPISAPVAFVVDKDLWVYFGGHADLTDVITTDGYSI
FT                   ENDIFIDGELLDLMSKDEIEQFNIELLKFSRWYALTVTRSQQGTEVSYRETPFKVINDN
FT                   EFYNAAIKLSEEEQYPEDFFNMIHNHYGRLLRGKSLFALLVRQLSSSNRRTKFSVNQLM
FT                   EVGASRKGERYLMIREKIRQAITVSETL"
FT   gene            complement(120891..121997)
FT                   /locus_tag="Spro_0111"
FT   CDS_pept        complement(120891..121997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_2423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39221"
FT                   /db_xref="GOA:A8G7Y1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y1"
FT                   /protein_id="ABV39221.1"
FT                   /translation="MKLESITVTGLFGKSEVVHYEFHHDLNIITGRNGSGKTTILKLAW
FT                   LIMSGNIYWALKEINFKICKLVTNEYTCVVTKTANMYCRIELHTSNGENHLFEDDGPNG
FT                   ENEWIESSENQAAPYLISSGSSIFFPTFRRIEGGFSLDVTSRIKNRASNRPGGDIDEAL
FT                   TSLSKKMSNEEHLFVAAISSQDINSILLKKFASLSEQINIFQAEVSRRVIDKIKHHQKL
FT                   SSHASDADTILTETRIEIEKIETFRAESMRPLDAVRMLVEKLFQHAGISFDRRFSFGDA
FT                   AEAVTSDVLSAGEKQMLSFICYNAFHQNAIIFIDEPELSLHVDWQRQLYRILKKQNPTN
FT                   QFIFATHSPFIYGKYPDKEVAVGVDRGE"
FT   gene            complement(122132..123586)
FT                   /locus_tag="Spro_0112"
FT   CDS_pept        complement(122132..123586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0112"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: syf:Synpcc7942_1725 regulatory
FT                   protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39222"
FT                   /db_xref="GOA:A8G7Y2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y2"
FT                   /protein_id="ABV39222.1"
FT                   /translation="MPMEQTEAGRQGSLYRQIAEQIKQAIHAGFLPANTRLPSVRTLAT
FT                   QYNISLTTALKTLRTLEDEHYAVAKPKSGFFVAPRRHSLQKDAVIVEQPREIAPLDEQT
FT                   ELHMAMVGEDCRVRLDLANGDSSLYPIKKLSLIMRQLGYSKPFLLGDTVKGSGYAPLKT
FT                   EIARRAIDYGCNINPDNILVTNGCVEALSLSLMATVKPGDAVAVESPCYFVLLQMLRHL
FT                   KLRVIEVETGNEGYVDSEKLVALFQRKAVKVFVTLANVNNPLGKTIPNEKKAHIARQAD
FT                   ENGVIIIEDDTFGDISFGVQRPFPMRAFSPNVILCSGFSKTVAPGMRVGWVHSNHYMRK
FT                   ITSLKYTSTMGSPILPQATIAELLSNGGYDAHLRKLRQKLANLVNKIRQVVLRAFPPGT
FT                   KVSEPEGGYVLWVEMPKNALNVRSLFIKARNAGIGIAPGHIFATDNRYDHCFRLNAGFG
FT                   YNDEVEQAIAQLGQWCTQSLVGHEGG"
FT   gene            123861..124433
FT                   /locus_tag="Spro_0113"
FT   CDS_pept        123861..124433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0113"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="KEGG: sun:SUN_0924 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39223"
FT                   /db_xref="GOA:A8G7Y3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y3"
FT                   /protein_id="ABV39223.1"
FT                   /translation="MELSVANVADIEQVTELLKRYQVATISEEDKKDGFVTTLLSYEQM
FT                   VALIEQEQGLFVARQEGKIVAFVMAASWQFWAPWPLFEHMIGRLGECEFAGQVLTVENS
FT                   YQYGPICVDVSVRGSGVLEALFAFALKQMSSRFDVLVTFVNKINPRSYAAHTRKLGLQV
FT                   LNEFTFNNNHYYWMVCATRQSGNGSSA"
FT   gene            124594..124917
FT                   /locus_tag="Spro_0114"
FT   CDS_pept        124594..124917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecs:ECs4463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39224"
FT                   /db_xref="GOA:A8G7Y4"
FT                   /db_xref="InterPro:IPR011223"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y4"
FT                   /protein_id="ABV39224.1"
FT                   /translation="MFLNYFALGVLILVFLIIFYGIIILHDIPYLIAKARNHPHADAIH
FT                   VAGWVSLFTLHVIWPFLWIWATLYRPERGWGMQGQEASFAQLQQRVAELELKLAGNKTP
FT                   PSE"
FT   gene            124923..126059
FT                   /locus_tag="Spro_0115"
FT   CDS_pept        124923..126059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0115"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   ent:Ent638_0138 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39225"
FT                   /db_xref="GOA:A8G7Y5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y5"
FT                   /protein_id="ABV39225.1"
FT                   /translation="MDLLIILTYVAFAWSIFKIFKIPVNKWTVPTAALGGVFLIGALIL
FT                   LMNYNHPYTYLAQKAVISIPITPQVTGVVSEVTEKQNVLIKKGEVLFKLDPARYQARVN
FT                   RLQADLVTEINNTQVLKGQLDEAIANTSRVSAERDRLYKDYQRYVRGSQAKVNPFSESD
FT                   IDNARQNYLAQDALVKGSVAEQAQIKSQLDSVINGEQSQIVSLRAQLAEAKYNLDQTVI
FT                   RAPSDGYVTQVLIRPGTYAAAIPLRPVMVFIPEQKRQIIAQFRQNSLLRLKAGDEAEVV
FT                   FNAFPGQVFPGKLIRILPVVPGGSYQAQGTLQSLSVAAGSDGVLAVIELAPNSEIDELP
FT                   DGIFSQVAVYSDHFTHVAVMRKVLLRMTSWMHYLYLDH"
FT   gene            126205..126522
FT                   /locus_tag="Spro_0116"
FT   CDS_pept        126205..126522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0116"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG:
FT                   ypi:YpsIP31758_0720 transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39226"
FT                   /db_xref="GOA:A8G7Y6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y6"
FT                   /protein_id="ABV39226.1"
FT                   /translation="MNSLALLSVILGGSGEEDLEKRISSNWRKHHADTEKPIFTPRKSE
FT                   VLYWASMGKTYGEIAAIASISPSTVKFHMRNIVVKLGVSNARQAIRLGVELGLMTPSAA
FT                   R"
FT   gene            complement(126588..127175)
FT                   /locus_tag="Spro_0117"
FT   CDS_pept        complement(126588..127175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39227"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y7"
FT                   /protein_id="ABV39227.1"
FT                   /translation="MFNKTGNKILGGLAALLLFSQSALAQETLIFVRHGEKPANNSGQL
FT                   TCKGLNRALALPDVLLKRYGKPDYIFAAGPKENKLGSSLRALSTIMPTAVRVGLPIGLQ
FT                   FHADDITGLQQELLSEQYQNSRIFIAWEHKNLDKAVKAIVAARGGDANLVPKWPGSDFD
FT                   SIFVVTLDQDKVSFRQESEGLTQLAETCPAAG"
FT   sig_peptide     complement(127098..127175)
FT                   /locus_tag="Spro_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            127320..127556
FT                   /locus_tag="Spro_0118"
FT   CDS_pept        127320..127556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_3324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39228"
FT                   /db_xref="GOA:A8G7Y8"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y8"
FT                   /protein_id="ABV39228.1"
FT                   /translation="MKNIFFFDAMLTPKIITGVYWLCLLSIIVGGIGAMFYGEFFRGLF
FT                   AIIIGGVFTRVCFEMIIIAFKNNEYLRKISEKP"
FT   gene            complement(127593..128015)
FT                   /locus_tag="Spro_0119"
FT   CDS_pept        complement(127593..128015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0119"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   har:HEAR2858 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39229"
FT                   /db_xref="GOA:A8G7Y9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Y9"
FT                   /protein_id="ABV39229.1"
FT                   /translation="MNNESCVYCHPTDEIVLWQNPLCRAIFIADSPFPGWCRVVWHEHI
FT                   AELSDLRDDQRNSIMAVVAQVEAQLRQLLTPAKINIASLGTALPHLHWHIIPRYLDDSH
FT                   FPEPVWSAALRAPTTKTLPENFIELMQERLAITLGA"
FT   gene            complement(128119..129174)
FT                   /locus_tag="Spro_0120"
FT   CDS_pept        complement(128119..129174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0120"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: pol:Bpro_4573
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39230"
FT                   /db_xref="GOA:A8G7Z0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z0"
FT                   /protein_id="ABV39230.1"
FT                   /translation="MQNGNVMANIRDVARHAGVSVSTVSNVLNGRVDQMRKDTLARIEQ
FT                   AMAALQYQPNRAAQQLKTGQVKMLGLLVPSIVNPSFAALVREIELAAKQNYGYQVLLGD
FT                   THRQQEEEIRFLDDLLALGIRGVVVASTFYDRPHFREALKRGLVMINYDERALTAPGET
FT                   ALPIDSVSMDNGAAGNMAARHLIAQGCRRIAFATASGMTSSRANKIAGYRQALEAAGLP
FT                   VRVIEGKAQFAYGDAEMAELGKTLAEQICQSEPRPDGVVALNDMLAIGMISAFQRLGVR
FT                   VPEDISVVGIDNMFLSELFNPTLSSVAPPLREMAVKIVDRLIGRLENPELPVEEFLFAP
FT                   SLVCRQSVINA"
FT   gene            complement(129225..129986)
FT                   /locus_tag="Spro_0121"
FT   CDS_pept        complement(129225..129986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0121"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   csa:Csal_1758 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39231"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z1"
FT                   /protein_id="ABV39231.1"
FT                   /translation="MFSDLTNKRVLITGSTAGIGLATAALFAQHGARVGINGMRSEPPA
FT                   EIAAFPGECAFFSADLSRSAGCEALVEAFVARFGGIDILINNAGGLGGRNGLEAIDDEF
FT                   FDRVMDLNCRSALMVTKFAIPHLRASARESGATASVISTGSIAAREGGGIGAGLYASAK
FT                   AWLHNIHRNWVKEFTQDNIRFNIVSPGSIDTAFHQGKSEEVLGKMCASIPMGRFGRSEE
FT                   VAPTYLFLASHNCSGYITGQIIDVNGGQIAP"
FT   sig_peptide     complement(129900..129986)
FT                   /locus_tag="Spro_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.673 at
FT                   residue 29"
FT   gene            complement(130011..131882)
FT                   /locus_tag="Spro_0122"
FT   CDS_pept        complement(130011..131882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0122"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; TRAP C4-dicarboxylate transport
FT                   system permease DctM subunit; KEGG: bte:BTH_II0984 TRAP
FT                   transporter, DctM subunit subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39232"
FT                   /db_xref="GOA:A8G7Z2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z2"
FT                   /protein_id="ABV39232.1"
FT                   /translation="MTLPVTLEMSVKKVAILTQLSRGLTRFTAWGGALALLINVVVVFA
FT                   SVIWRYALHSPIEWAEEVARALMVTLVFFGVATSTGRGRHIGVDLFLRWLPAVARPYVV
FT                   HASRWVLVLVALGLTVSSFSLVGISLPQTTEHGLPQAIFVVPVFIGAAVMLVSALDHAC
FT                   QAPLKVVLISAAAVALLGGAGYLSLHAPLGFSSLPAALMLACFILGIISGVPIAFTLGM
FT                   SAMVFFLSDPSLPFVFFAQQVTAGVDHFVLLAIPFFLLAGAVMEVNGMSSRLVELIVRG
FT                   MGRYRGGLNMTTIVSMAFFSGISGSKLADVATVGGVLMPAVRRARQPAAESAGVFAASA
FT                   IMAETIPPCVNLIVMGFIANISIGALFIAGLIPALCLLVLLLIAAVIFGKRINVDDAYP
FT                   VRMPTRQLLIGAAVGLVMILMIGKGVVAGIATSTEISAFAVVYAIVVGRLAFGELTLKA
FT                   TVKLFVDTAALSGMLLFIVACATSLSFALTIEMIPQQCAQLLVAIGADYGPWLFLLLSI
FT                   VILIIFGAVLEGAPALIIFAPILVPIATQLGFNPLHYAIVMILAMGFGLFSPPIGLGLY
FT                   TTCAICGVPMQDVIKPMAKYLLIILLGIIVIALFPALTTWLPTRLGY"
FT   gene            complement(131907..132920)
FT                   /locus_tag="Spro_0123"
FT   CDS_pept        complement(131907..132920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0123"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: bte:BTH_II0985 bacterial extracellular
FT                   solute-binding protein, family 7 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39233"
FT                   /db_xref="GOA:A8G7Z3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z3"
FT                   /protein_id="ABV39233.1"
FT                   /translation="MKSLTCRLTPRLFITLLFMLFILPLRANAAEVSLRVYSSLPDDGY
FT                   SAHAIWFHRFKQNLDQRLPGKIALNYFPNGMLGKEADAVQQVRIGAIDMTISGTSIWGT
FT                   LVPEIGVLDLGYLFDDNQQLGQALDGQAGQLLSALLAKQSNIKVLGYGFSLGARNIYSK
FT                   KPLQSPQDLNRMKVRVLPAPNFIATLKSMGATAIPMPGGEVYSALQMGVIDGVEHDAAT
FT                   VYTSKYYEIAKYATLTRHIYNPIVATISQAAFQRIPQPLQADFLAAASEATVYERKIAA
FT                   EKEIQAMDKLKAAGVIFTETDRDYFRRQTLPLQAAFSGKYPQAKAVLDAIHATAQP"
FT   sig_peptide     complement(132831..132920)
FT                   /locus_tag="Spro_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            133243..134691
FT                   /locus_tag="Spro_0124"
FT   CDS_pept        133243..134691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39234"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z4"
FT                   /protein_id="ABV39234.1"
FT                   /translation="MPSRAIIKWTKRLTIVAVTVLLTLFAVRVYDTQSGPALEPWHTFV
FT                   PHELSAAEMDNTDWQGYLAAESRVFDEVKVNVTDKLSASERIPLNRYFDGSPVYPEHFT
FT                   RDWNRSYELMPEGEPRGAVVLLHGLTDSPYSLRHIAENYRQHGYVAVGIRLPAHGTVPG
FT                   ALTDIEWQDWLAATRLAVREARSKAGGDKPLHIVGFSNGGALAMKYALDALDDPQLAAP
FT                   QRLILISPMIGVTSFARFAGIAGWPAVFPAFAKAAWLGVLPEFNPFKYNSFPVNGARQS
FT                   YLLSNGLQQQIARAARDGRLDKLAPVLTFQSVMDSTVSTRAVIRALYNELPANGSELVL
FT                   FDVNRTVNFGPLLRPNAAAAVSQLLPAPPRRYQTTVIANASPDSSEAIASVTPAGATTV
FT                   SEQPLGMTYPADIYSLSHVALPFPVSDSLYGRFPVQRGEFGISLGTLAARGERSVLVVD
FT                   LDSLMRIASNPFFPYLLQRIDSKL"
FT   sig_peptide     133243..133332
FT                   /locus_tag="Spro_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.750 at
FT                   residue 30"
FT   gene            complement(134688..135437)
FT                   /locus_tag="Spro_0125"
FT   CDS_pept        complement(134688..135437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0125"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: pfl:PFL_4587
FT                   TDP-glucose-4,6-dehydratase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39235"
FT                   /db_xref="GOA:A8G7Z5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z5"
FT                   /protein_id="ABV39235.1"
FT                   /translation="MTLRTEFGRILITGAGGRVATAFRQSVGNRYQLRLAEKDLGLLTN
FT                   LQPNDEIISFDIADIAACRAACAGIDTVLHLAADPSPDADFCNSLMDNNILGTFNIFRA
FT                   AKDAGCKRVVFASSAQAVEGYALDYQIRPQDAPKPKNLYGVSKAFGEGIAAYFAHQEGL
FT                   SALSVRIANFTTLEPGEQLSARDMSAFLSHRDAADLLERCLRIEGVHHAVVHGVSNNRY
FT                   KRLSLEETSQLLGYYPQDDAFSILGFG"
FT   gene            complement(135531..136394)
FT                   /locus_tag="Spro_0126"
FT   CDS_pept        complement(135531..136394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0126"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bbt:BBta_7356 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39236"
FT                   /db_xref="GOA:A8G7Z6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z6"
FT                   /protein_id="ABV39236.1"
FT                   /translation="MFDWQDLKHFVVLARTGSLSAAARELGCDHATVGRRVAGLEKALG
FT                   LPLILRLPRSTPLTQDGKVIAGLATDIENQSHAIVRHARSIGETPQTQVRISAPPSIAA
FT                   RVIAPQIAQFHQTFPHITLILSGESAIAELDRGDAEVAVRMVRPQQPDLLVQRIGMMRY
FT                   ALYATPQHAALPEAARAFIGYDHHYQNQPHQQWLQQLLQGRPVVFQASDLFSLQEAARS
FT                   GLGAVVLPTFVADGDPDMVTLPTAIAAPTRELWLVTYPDLARSTAVRAVMNFLAEIIGE
FT                   KCPLTR"
FT   gene            136509..137267
FT                   /locus_tag="Spro_0127"
FT   CDS_pept        136509..137267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0127"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B2157 putative short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39237"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z7"
FT                   /protein_id="ABV39237.1"
FT                   /translation="MNLHLQGRIALVTGASEGIGAGMVRVLAAQGVTVVATARREDRLQ
FT                   TLADEVEQAGGIRPYVIAADITQTQALDSMLALALQQFGTIDIVINAVGGARPTSLSEG
FT                   DAGWEEAFALNFTPARRITHALLPRMLAQGWGRVINISGSMEPRSLNAATAAKGALHLW
FT                   AKGLAGNVAAQGVTVNTLQPGRINSEQVREKLHPTEAARQAFIEQNIPIGYFGEPEDMA
FT                   YLAAFLCSPQARYITGAVIPVDGGMHYFAH"
FT   gene            complement(137280..137879)
FT                   /locus_tag="Spro_0128"
FT   CDS_pept        complement(137280..137879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0128"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: hch:HCH_02572 guanosine polyphosphate
FT                   pyrophosphohydrolase/synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39238"
FT                   /db_xref="GOA:A8G7Z8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z8"
FT                   /protein_id="ABV39238.1"
FT                   /translation="MTDTLAERARRYATKAHAAIDQRRKYTNDPYIVHPQAVMEIVSSV
FT                   PHSEEMLAAAWLHDTVEDTPTTLGDIESHFGPQVASLVAMLTNVSGTGDGNRFERKNRD
FT                   RRHSAKASPQAKTIKLADLIDNTRSLLDYDSHFARTYLIEKQRLLEVLTEGDPTLWQQA
FT                   HHIVEKGLERLQLPPHNVPASWFEHARRRYRESDAA"
FT   gene            137991..138455
FT                   /locus_tag="Spro_0129"
FT   CDS_pept        137991..138455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0129"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sgl:SG0020
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39239"
FT                   /db_xref="GOA:A8G7Z9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G7Z9"
FT                   /protein_id="ABV39239.1"
FT                   /translation="MKIENTEQPATKNLLLLDQQLCFALYSANLALNKVYRKLLSRLEL
FT                   TYPQYLVMLVLWERDEIRVTDIGERLFLDSATLTPLLKRLETAGLLARYRATTDERQVI
FT                   IALTDAGRALREKAQSVPEAVMCATDCSLDEIVNIKQQLEKLRGKLINQL"
FT   gene            138612..139037
FT                   /locus_tag="Spro_0130"
FT   CDS_pept        138612..139037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0130"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: yen:YE4091 putative
FT                   osmotic/stress related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39240"
FT                   /db_xref="GOA:A8G800"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A8G800"
FT                   /protein_id="ABV39240.1"
FT                   /translation="MSIEKVVYRAHATATGGRDGRATSSDGVLDVKLGVPKEMGGAGGE
FT                   VTNPEQLFAAGYSACFLGALKFVAAKEKVKIPAEAKIDGTVGIGEIPNGFGIEVQLDIS
FT                   LPGIERSVAEDLVKKAHVVCPYSNATRGNIDVTLNVK"
FT   gene            139262..140956
FT                   /locus_tag="Spro_0131"
FT   CDS_pept        139262..140956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0131"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: ypi:YpsIP31758_4081
FT                   phosphoethanolamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39241"
FT                   /db_xref="GOA:A8G801"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A8G801"
FT                   /protein_id="ABV39241.1"
FT                   /translation="MNKVKSLSQQNLSLLLAIYIGIFLNLSVFYRRFDSFSHGIQGIKV
FT                   ISAVTEVIAIVLFTFFIMRLVSLGGRLFYRIIASLLVLISVAASYYMTFFNVVIGYGIV
FT                   VSVMTTDIDLSKEVVGMHFVLWMVVLSALPLLCIWKNNLRYTLIEQLKTPGHRIKPLVV
FT                   LVAVVALVWVPLRMLDNEQSAQEKITNVDLPSYGGVVAHSYLPSNWLSALGLFAYTRYD
FT                   ESQDQANLFDPAKNFTYVAPADIDDTYVVFIIGETTRWDHMGILGYDRDTTPRLSKEKN
FT                   LVAFRGTSCDTATKLSLRCMFVREGGTADNPQRTLKEQNVFAVMKDLGFTSELFAMQSE
FT                   VWFYNNTEVNNYSFREMIASEKRNDGKSVDDMLLVDEMKESLARYPKGKHLVILHTKGS
FT                   HYLYSQRYPRSYARYQPECIGVDDFCSKDQLVNAFDNSVLYTDSFIANVIDQVREKKAI
FT                   VFYSSDHGESIGENSHLHGTPREMAPVEQFRVPMMVWASDKFLEDPQHRGAFEQLQAQQ
FT                   RVGKTHRHVELFDTILGCLGYTSPNGGIVAKNNWCDIPQEKASPSEL"
FT   gene            141077..141667
FT                   /locus_tag="Spro_0132"
FT   CDS_pept        141077..141667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0132"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: ypi:YpsIP31758_4080 transcriptional
FT                   regulatory protein UhpA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39242"
FT                   /db_xref="GOA:A8G802"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A8G802"
FT                   /protein_id="ABV39242.1"
FT                   /translation="MTLRVAFIDDHDIVRSGFVQLLSLEPDIQVVGEFSSAAQARAGLP
FT                   GLEAEICICDISMPDGSGLDLLADIPSGIRVVMLSMHDNPALVELALERGACGFLSKRC
FT                   KPEDLITAVRTVASGGVYLMPEIAQQLARVKVDPLTRREREIALLLAQGQEVREIAVAL
FT                   GLSPKTVHVHRANLFAKLGINNNVELAKRMLNL"
FT   gene            141667..143208
FT                   /locus_tag="Spro_0133"
FT   CDS_pept        141667..143208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0133"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   MASE1 domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: ypi:YpsIP31758_4079 sensor
FT                   histidine kinase UhpB"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39243"
FT                   /db_xref="GOA:A8G803"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8G803"
FT                   /protein_id="ABV39243.1"
FT                   /translation="MQRLITQLALFFIYATSAFCLWGIGTALIDPPWQALLLFPFGLRM
FT                   GILLQSPYRFWPGILLADLLLMVVLADQFGYGPALWASVVVLLLTVLLSLVASPWLLRH
FT                   QESDSEWQWPLMQGAVVAVAALLQALVWQLVNGEGARALLLGLAGGFTIAPTCLLLWHY
FT                   LARQIWVPLEPGLIHKPVTLRLRHLASYLLLFALSIWLQQQVNAAELRRFAPFCLAIPI
FT                   VFMSYRYGWQGALLATLLNGVVLVANEPPQPESHRDLLLSLLAQSLTGLLLGAGIQRQR
FT                   ELNQQLRLRLTENRQLARALVTAEEQTRREVARELHDEVGQTITVIRTQASIIKRLAPQ
FT                   PQVMGCAEAIDTLALRVYDGVHDVLTQLWPAALNNLPLSAAVAAMLRESLPQDTSLVSV
FT                   MQWQVPDELLDETLKITLYRVCQEGVTNVCRHATASRIELDARLRQRKGRLPQVLLTIR
FT                   DNGVGIDLAHHEPGYGLRGMQERISALGGRLRLTSENGTCLNVILPTVSPAEGPN"
FT   gene            143303..144634
FT                   /locus_tag="Spro_0134"
FT   CDS_pept        143303..144634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0134"
FT                   /product="phosphoglycerate transporter"
FT                   /note="TIGRFAM: phosphoglycerate transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: yen:YE4087 putative
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39244"
FT                   /db_xref="GOA:A8G804"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G804"
FT                   /protein_id="ABV39244.1"
FT                   /translation="MWSFLKSRDDVPPVTDQKQIDASYKYWRIQLMWTMYIGYAAFYFT
FT                   RKSFNFIMPAMLSDLGLTMSDVGILGTLFYITYGCSKFISGMISDRSNPRYFMGLGLIM
FT                   TGILNIFFGLSSSLLMLGTLWILNAFFQGWGWPPCSKILTSWYSRSERGSWWAIWNTSH
FT                   NFGGALIPLLVGFISLHFSWRYGMIIPGIIGVVLGLLMCWRLRDKPSTMGLPSVGKWRN
FT                   DAMELVQESEGQGLTNREIIKRYVLTNKYIWLLAVSYVLVYIVRTAINDWGNLYLTQEK
FT                   GYSLMTANSAISLFEVGGFIGSLVAGWGSDKLFRGNRGPMNLIFAIGIFLSVAALWIMP
FT                   GVTFLLQAACFFAIGFFIFGPQMLIGMAAAECSHKDAAGAATGFVGLFAYLGAALSGYP
FT                   IARIMEIWHWNGFFVVISIAACLSALFLLPFLRAQSPALKTAKA"
FT   gene            144755..144831
FT                   /locus_tag="Spro_R0002"
FT                   /note="tRNA-Pro1"
FT   tRNA            144755..144831
FT                   /locus_tag="Spro_R0002"
FT                   /product="tRNA-Pro"
FT   gene            complement(145151..145483)
FT                   /locus_tag="Spro_0135"
FT   CDS_pept        complement(145151..145483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_0613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39245"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G805"
FT                   /protein_id="ABV39245.1"
FT                   /translation="MPVQQAIDGLKTDFSKALSGADMGSRLIFPDVKTLTYVLLNNNRM
FT                   ALLEEMTGAEAMSIRELSRRVNRDFKAVHTDVQALLNAGVLDKKGTKIIFSYDEIHFDF
FT                   VTGKAA"
FT   gene            complement(145495..145791)
FT                   /locus_tag="Spro_0136"
FT   CDS_pept        complement(145495..145791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39246"
FT                   /db_xref="UniProtKB/TrEMBL:A8G806"
FT                   /protein_id="ABV39246.1"
FT                   /translation="MPATLVMKRRIWLDTNSLLSLVVWDVTPSIRGSNHKYKYRLAYVV
FT                   KDECLLRYDNEAGKGDHKHLGIAEIPIEFIDINKLVDDFVTEVNQLRRPKCAL"
FT   gene            146170..147861
FT                   /locus_tag="Spro_0137"
FT   CDS_pept        146170..147861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0137"
FT                   /product="Chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="KEGG: sbl:Sbal_3083 chitinase; PFAM: glycoside
FT                   hydrolase family 18; Chitinase A domain protein; SMART: PKD
FT                   domain containing protein; chitinase II"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39247"
FT                   /db_xref="GOA:A8G807"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR013540"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:A8G807"
FT                   /protein_id="ABV39247.1"
FT                   /translation="MRKFNKPLLALLIGSTLCSAAQAAVPGKPTLAWGNTKFAIVEVDQ
FT                   AATAYNNLVKVKNAADVSVSWNLWNGDTGTTAKVLLNGKEVWSGASTGASGTANFKVNK
FT                   GGRYQMQVALCNADGCTASDATEIVVADTDGSHLAPLKEPLLEKNKPYKQDSGKVVGSY
FT                   FVEWGVYGRNFTVDKLPAQNLTHLLYGFIPICGGDGINDSLKEIEGSFQALQRSCQGRE
FT                   DFKVSIHDPFAALQKGQKGVTAWDDPYKGNFGQLMALKQARPDLKILPSIGGWTLSDPF
FT                   FFMGDKAKRDRFVGSVKEFLQTWKFFDGVDIDWEFPGGQGANPKLGSAQDGATYVQLMK
FT                   ELRAMLDQLSAETGRKYELTSAISAGKDKIDKVDYNTAQNSMDHIFLMSYDFYGAFDLK
FT                   NLGHQTALKAPSWKPDTAYTTVNGVNALLTQGVKPGKIVVGTAMYGRGWTGVNGYQNNI
FT                   PFTGTATGPVKGTWENGIVDYRQIANEFMSGEWQYSYDATAEAPYVFKPSTGDLITFDD
FT                   ARSVQAKGKYVLDKQLGGLFSWEIDADNGDILNNMNSSLGNSAGTQ"
FT   sig_peptide     146170..146241
FT                   /locus_tag="Spro_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            148465..150072
FT                   /locus_tag="Spro_0138"
FT   CDS_pept        148465..150072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0138"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: yen:YE4083 periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39248"
FT                   /db_xref="GOA:A8G808"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8G808"
FT                   /protein_id="ABV39248.1"
FT                   /translation="MTSSLGKTGILKFGIGLIALTVAASVQAKTLVYCSEGSPEGFNPQ
FT                   LFTSGTTYDASSVPIYNRLVEFKIGTTELQPGLAEKWDVSEDGKIYTFHLRKGVKWQSS
FT                   KDFKPTRDFNADDVVFSFERQLDAKNAYHKVSGGSYEYFEGMDMPKLIAKIEKVDDYTV
FT                   RFVLTRPEAPFVADLGMDFASILSAEYADVMMKAGTPEKIDLNPIGTGPFQLLQYQKDS
FT                   KILYKAFDGFWGTKPKIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADIARMKQDKT
FT                   INLMEQPGLNVGYLSFNVEKKPLDNLKVRQALTLAVNKQAIIDAVYQGAGQAAKNLIPP
FT                   TMWGYNDAVKDYTYDPVKAKELLKEAGMADGFSIDLWAMPVQRPYNPNARRMAEMIQSD
FT                   WAKIGVKAKIVTYEWGEYLKRAKAGEHQTVMMGWTGDNGDPDNFFATLFSCAAAKDGSN
FT                   YSRWCYKPFEDLIQPARAESNHDKRIELYKQAQVVMHDQAPALIVAHSTVYEPVRKEVK
FT                   GYVVDPLGKHHFENVSLD"
FT   sig_peptide     148465..148551
FT                   /locus_tag="Spro_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            150179..151234
FT                   /locus_tag="Spro_0139"
FT   CDS_pept        150179..151234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0139"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: yen:YE4082 dipeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39249"
FT                   /db_xref="GOA:A8G809"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G809"
FT                   /protein_id="ABV39249.1"
FT                   /translation="MSCRALIQRVRDMLQFILRRLGLVIPTFIGITLLTFAFVHMIPGD
FT                   PVTIMAGERGISAERHAHLMAEMGLDKPLYQQYFTYVSNVLHGDLGTSLKSRISVWEEF
FT                   VPRFKATLELGLCAMIFAVLVGIPVGVLAAVRRGSIFDHTAVGISLTGYSMPIFWWGMM
FT                   LIMLVSVQLNLTPVSGRVSDTVFLDDSLPLTGFMLIDTLIWGEPGDFADAVMHMILPAI
FT                   VLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGVSRMRVIVVHALRNALLPVVTVIGL
FT                   QVGTMLAGAILTETIFSWPGLGRWLMDALQRRDYPVVQGGVLLVACMIILVNLLVDVLY
FT                   GVVNPRIRHKK"
FT   gene            151246..152148
FT                   /locus_tag="Spro_0140"
FT   CDS_pept        151246..152148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0140"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: yen:YE4081 dipeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39250"
FT                   /db_xref="GOA:A8G810"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G810"
FT                   /protein_id="ABV39250.1"
FT                   /translation="MSQVTESVVKGAPKPMSPFQEFWHYFKRNKGAVVGLVYIVLMFVI
FT                   AIGAGVLAPHAPADQFRDALLKPPVWQEGGSWQYLLGTDDVGRDVLSRLMYGARLSLLV
FT                   GCLVVVLSLIMGVVLGLLAGYFGGVVDAIIMRIVDIMLALPSLLLALVLVAIFGPSIVN
FT                   ASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGAMRQMFINILPNCLAPLIVQ
FT                   ASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGVAILLTVL
FT                   AFNLMGDGLRDALDPKLKQ"
FT   gene            152163..153143
FT                   /locus_tag="Spro_0141"
FT   CDS_pept        152163..153143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0141"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: yen:YE4080 dipeptide transport ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39251"
FT                   /db_xref="GOA:A8G811"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G811"
FT                   /protein_id="ABV39251.1"
FT                   /translation="MALLNVDKLSVHFGDEGTPFRAVDRISYSVEQGQVVGIVGESGSG
FT                   KSVSSLAIMGLIDFPGKVMAEKLEFNGQDLRKISEKERRQLVGSEVAMIFQDPMTSLNP
FT                   CYTVGFQIMEALKVHQGGNRRTRRQRAIDLLTQVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQRENMALLLITHDLALVSEAAH
FT                   HIIVMYAGQVVESGKASEIFRAPRHPYTQALLRALPEFAVDKARLASLPGVVPGKYDRP
FT                   SGCLLNPRCPYANERCRVEEPELRTIPGRQVKCHTPLDDAGRPTV"
FT   gene            153140..154129
FT                   /locus_tag="Spro_0142"
FT   CDS_pept        153140..154129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0142"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ypi:YpsIP31758_4071 dipeptide ABC transporter,
FT                   ATP-binding protein DppF; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter
FT                   related; Oligopeptide/dipeptide ABC transporter domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39252"
FT                   /db_xref="GOA:A8G812"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G812"
FT                   /protein_id="ABV39252.1"
FT                   /translation="MSQNQPLLQAIDLKKHYPVKKGIFAPERLVKALDGVSFTLERGKT
FT                   LAVVGESGCGKSTLGRLLTMIEVPTGGELYYQGQDLLKPDVTAEKLRRQKIQIVFQNPY
FT                   GSLNPRKKVGQILEEPLQINTGLNSAQRREKALEMMAKVGLKTEHYDRYPHMFSGGQRQ
FT                   RIAIARGLMLNPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFISHDLSVVEH
FT                   IADEVMVMYLGRCVEKGSKDAIFNNPRHPYTQALLSATPRLNPDMRRERIKLTGELPSP
FT                   MNPPPGCAFNARCRRAFGPCTQLQPQLKQYGEQMVACFAVDQDENPAA"
FT   gene            complement(154409..156061)
FT                   /locus_tag="Spro_0143"
FT   CDS_pept        complement(154409..156061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0143"
FT                   /product="putative inner membrane protein possibly involved
FT                   in cellulose synthesis"
FT                   /note="KEGG: yen:YE4078 putative inner membrane protein
FT                   possibly involved in cellulose synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39253"
FT                   /db_xref="GOA:A8G813"
FT                   /db_xref="InterPro:IPR017744"
FT                   /db_xref="UniProtKB/TrEMBL:A8G813"
FT                   /protein_id="ABV39253.1"
FT                   /translation="MKPTNNPQSDNSLWRYWRGLGGWNYYFLAKFALLWFGYLNFHALP
FT                   NLVFMAFLLMPIPALRVHRWRHYLAIPIGFALFYHDTWLPGINSIMSQGSQLTGFSAQY
FT                   LLELTNRFINWQMIGAAFVMLIAYLFLSQWIRVTVFTVAALVWLNLVNIAGPAVSLLPA
FT                   SSTASTSGTPAATAPAAGGDSAPADSAPPTSANLTAYLNQFYDKEKARATAFPASLPAD
FT                   AQPFDLLVINICSLAWADMDAVKLENHPLWSKMDIMFDNFNSATAYSGPAAIRLLRASC
FT                   GQPSHHDLYQPVNQQCYLFDNLAKLGFKEQLMLDHSGVFGNFLKELREQGDIQAPLMSQ
FT                   AGIGNELASFDGEPIYNDLELLTRWLSQQQKAGDTRSATFFNVIPLHDGNRFVGSNKSA
FT                   DYQPRAQKLFDQLNTFLDQLEKSGRKVMVVIVPEHGAALVGDKMQMSGLRDIPSPNITH
FT                   TPVGIKLVGMKAPHQGSPLQVKTPSSYLALSELVSRLVDGKAFTAPSVDWQALTQNLPQ
FT                   TAVISENDNAIVMQYQGKPYIRLNGGDWVPYPQ"
FT   gene            complement(156045..156257)
FT                   /locus_tag="Spro_0144"
FT   CDS_pept        complement(156045..156257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39254"
FT                   /db_xref="GOA:A8G814"
FT                   /db_xref="InterPro:IPR019995"
FT                   /db_xref="UniProtKB/TrEMBL:A8G814"
FT                   /protein_id="ABV39254.1"
FT                   /translation="MNLSDIVQLIILCAIIFIPLGYAFHRRFPHWRQYWQNLLLSPRYL
FT                   KSAGLWVREGSSSQIKRKNSHEANK"
FT   gene            complement(156247..157815)
FT                   /locus_tag="Spro_0145"
FT   CDS_pept        complement(156247..157815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39255"
FT                   /db_xref="GOA:A8G815"
FT                   /db_xref="InterPro:IPR017745"
FT                   /db_xref="UniProtKB/TrEMBL:A8G815"
FT                   /protein_id="ABV39255.1"
FT                   /translation="MAQSFSLGIRQVWEELSVMQAPGLYWVNIDRQTDANLLCQQTLAA
FT                   QAATSQVALICSGDKPDRLLAELASPALKKIPLYQLPEKKAALTHFSDDLMRALKPQNR
FT                   LLILLAHASLWQTFTSEELRDWTRTTGAWLRRQGCTLLILSHGGGVNKLKGQLSAQHRI
FT                   LNGLSSLQWQQDSAQYLVNWWSTENGINANQLLTLYAGENGWQGDDDNNKPSPTSIRSD
FT                   EGLYLAQQSILEGAPPLSANWQLLESNALLAQHGMLTLSATLIFALYQSDEIDALAHQI
FT                   HSLRRQRGNGLKIVVREMSASLRYSDERLLLACGANLIVPHVAPLSRFLTMLEGIQGQR
FT                   FSRHVPADIDALLAGLRPLQLKGYMRPDDFSQAVISLMGNTLLPEDGKGVMVALRPAPG
FT                   LRAEQAMTLCFLRRFGDVMTVVQGRLVLFLSTCRINDLDTALKFIFRLPVDEAFSNRVV
FT                   WHQDVDIISEIKRLAHNAPVPLGAATAAVAPRQTAAEAASPQERRQPVAFTLTTTAQEN
FT                   KHVEP"
FT   gene            158014..158205
FT                   /locus_tag="Spro_0146"
FT   CDS_pept        158014..158205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE4076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39256"
FT                   /db_xref="InterPro:IPR024487"
FT                   /db_xref="UniProtKB/TrEMBL:A8G816"
FT                   /protein_id="ABV39256.1"
FT                   /translation="MNNQLTRFHAVVAPETQDDLLALSHAFSLPKLSYIDISRQERLTQ
FT                   MMTRWPLLAELVQNTGSH"
FT   gene            158209..158946
FT                   /locus_tag="Spro_0147"
FT   CDS_pept        158209..158946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0147"
FT                   /product="YhjQ family protein"
FT                   /note="PFAM: YhjQ family protein; KEGG: yen:YE4075
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39257"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G817"
FT                   /protein_id="ABV39257.1"
FT                   /translation="MPVIALQGLRGGMGATSVTAALAWALQQLGESVLAVDFAPDNLLR
FT                   LHFNTPFELPRGWARAEQDGGEWQQGAMRYCENLDFLPFGQLTAAERLNLQQYCRQHPT
FT                   RWQENLAQLSASAQYNWILLDLPADDPLLAAQALPLADCVFMLIAPDANCQVRLHQQAL
FT                   PEGCRFLINHYFAASQLQQDLHQLWLQTLGGLLPVVIHRDEAMAEALAVKQPLGEYRPE
FT                   SLAADEVLTLANWCLINLKDTAP"
FT   sig_peptide     158209..158286
FT                   /locus_tag="Spro_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.698) with cleavage site probability 0.384 at
FT                   residue 26"
FT   gene            158943..161546
FT                   /locus_tag="Spro_0148"
FT   CDS_pept        158943..161546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0148"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase family 2; type IV pilus
FT                   assembly PilZ; KEGG: yen:YE4074 UDP-forming cellulose
FT                   synthase 1 catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39258"
FT                   /db_xref="GOA:A8G818"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8G818"
FT                   /protein_id="ABV39258.1"
FT                   /translation="MSRVMSLLLVPPVQQAVQTRYRAYRRHGSSAFTAFFTTLLVALGW
FT                   IFLRFESPGWQRLRAGRAYWFPHLSSSRPRPADVLRYLVQGLWLLVFRTDREPMDHQRF
FT                   AGWQRLQLRYANWLKTIPQRLENAGLEQRSVARLSRMNQRVRRVLFIIVGVLAAILAIL
FT                   CISQPFDLPAQFVFVLLLWGIAMVVRRVPGRLPALMLIVLSLTVSCRYLWWRYTATLNW
FT                   DDPLSLTCGLLLLVAETYAWVVLVLGYFQTVWPLNRQPVPMPADSSTWPTIDLLVPTYN
FT                   EDLGVVKPTIYAALGIDWPKEKVTIYILDDGNRPEFKAFAEEVGVKYIARPTHEHAKAG
FT                   NINNALKQATGEFVAIFDCDHVPTRSFLQLTMGWFFKDKKLAMLQTPHHFFSPDPFERN
FT                   LGRFRQTPNEGTLFYGLVQDGNDMWDATFFCGSCAILRRSALDEIGGIAVETVTEDAHT
FT                   SLRLHRRGHTSAYIRIPQAAGLATESLSAHIGQRIRWARGMVQIFRLDNPLFGKGLKLA
FT                   QRLCYANAMLHFLSGIPRLIFLTAPLAFLLLHAYIIFAPALAIALYVLPHMIHASLTNS
FT                   RIQGKYRHSFWSEIYETVLAWYIARPTTVALFNPHKGKFNVTAKGGLVEEEHVDWVITR
FT                   PYMFLVILNLAGLFFGVWRLGYGPADEVMTVIISLVWVLYNMTILGGAVAVAVEAKQVR
FT                   QAHRVEIAMPAAIARADGHLFPCTLRDYSDGGVGIEMRVADALKDGDKASLLLKRGQQE
FT                   YSFPCVVTRAFGSKVGIRMVGLSTREHIDFIQCTFARADTWALWQDGFPEDKPIESLRD
FT                   VLALGFRGYIRMADYAPPMVRRLLVGTTTLIGWIVSFIPHGVGRAPAFSQKETVV"
FT   gene            161602..163911
FT                   /locus_tag="Spro_0149"
FT   CDS_pept        161602..163911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0149"
FT                   /product="cellulose synthase subunit B"
FT                   /note="PFAM: cellulose synthase subunit B; KEGG:
FT                   eca:ECA4372 cyclic di-GMP binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39259"
FT                   /db_xref="GOA:A8G819"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:A8G819"
FT                   /protein_id="ABV39259.1"
FT                   /translation="MTRKITWFTALALGISTLSQAETATAPTVAAQPPLAVPADAAVTT
FT                   PMGSVAPQDPNAPVRDVQLPFAKIAPPPGTFTLRGTRPDGQVEFGVRSDEVVSQAMLDL
FT                   EFTPSPSLIPVESHVKVYLNDELMGVTTLAKEQLGKPNRIQMAIDPRYITDFNRVRLVF
FT                   VGHYQNICENPASTTLWLEVSKSSSLNLRYQTLPVKNELSHFPEPFFDSRDNRPLTLPM
FT                   VFAGQPDITQQRAAGILASWFGSKAQWRGQSFPTLYNKLPEQHAIVFATNKQRPDFLRD
FT                   YPPVNGPTVEMISHPDNPYIKLLLVQGRDDNDLITAVKGIAQGNILFRGQNVTVDKVEQ
FT                   LAPRQPYDAPNWVRTDRPMTFAELQQYAEQLQTSGIEPGPISLTMNLPPDLFLIRSTGI
FT                   DMHLKYHYTAPRIQDGSRLSVSLNNQFVQAYSLVPEHEQGAQLLRLPLTQGLIDSDKSV
FT                   NIPALRLGATNQLRFDFDYTTLLASGAEGRCETYSFTANHAVIDGSSTIDFSGYRHFMA
FT                   MPDLRAFANAGFPFSRLADLSQTLVLVNKQPQPSQVSALLNAMGVIGAQTGYPALAVTV
FT                   SDDWSQAKERDADILMIGTIPPELRDDKKINLLVDATQSWVKQPTRQLPLPTMDVLAED
FT                   TKADSKTTISSEGAMSAIVGVQSPFNDQRSIVALLADSPRGYDLLNNALLDSGKRAAVF
FT                   GSVAVIRESGVNSLRVGDVYYVGHLPWWERIWHALSTHPVLLAVIAVVVVVILALLLWR
FT                   GLKAFSRRRLSPEDRD"
FT   sig_peptide     161602..161667
FT                   /locus_tag="Spro_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 22"
FT   gene            163917..165029
FT                   /locus_tag="Spro_0150"
FT   CDS_pept        163917..165029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0150"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   yen:YE4072A endoglucanase precursor
FT                   (endo-1,4-beta-glucanase involved in cellulose
FT                   degradation)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39260"
FT                   /db_xref="GOA:A8G820"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A8G820"
FT                   /protein_id="ABV39260.1"
FT                   /translation="MPAALKRLTFGMLLLCSFSAVATCEWPAWQQYKQFYISEQGRVID
FT                   PSSPNRITTSEGQSYGLFFALVANDRPAFDQLLTWTENNLAAGDLSAHLPAWLWGEDDK
FT                   KQWTVLDSNSASDSDLWIAYNLLEAGRLWKSRRYQTLGTLLLQRIAREEVADIPGLGLM
FT                   LLPGKVGFVAEDRWRLNPSYLPPQLLARFAALNGPWRAMQQTNQRLWLETAPYGFLPDW
FT                   VVWQVGKGWQPDTVKPNIGSYDAIRAYLWAGMLADDDQHKAALLKQLQPMAQLTVQQGV
FT                   PPEKTDTASGKTMGNGPVGFSASMLPMLANQPEALQVQRQRIKQNPPGDNAYFSASLAL
FT                   FGQGWDQQRYRFNRQGELQPSWGGQCVTSE"
FT   sig_peptide     163917..163985
FT                   /locus_tag="Spro_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.747 at
FT                   residue 23"
FT   gene            165011..168484
FT                   /locus_tag="Spro_0151"
FT   CDS_pept        165011..168484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0151"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: TPR repeat-containing protein; cellulose
FT                   synthase operon C domain protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: yen:YE4072 probable
FT                   BcsC protein involved in cellulose synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39261"
FT                   /db_xref="GOA:A8G821"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8G821"
FT                   /protein_id="ABV39261.1"
FT                   /translation="MRNFRINWLGLVPLSLAMLPQAQGAETVAPEQWLLEQVRVGEAGN
FT                   KDELVRQSLYRLELMDPNNPEVISARMRLALRQGNQALAQQQLDKLKKIAPQSSAYRQA
FT                   EMNMLLTQPETRQKLQQARLMATAGRLPEAKAQYDALFHGDPPTLELAVEYWRLVARLP
FT                   GQEAAALKQLQTLDQQYSGNVPLRMSLARMLFSQDRDAQAYDLLQKVAADPAGRGDAAD
FT                   LWLEKVKAMPVSPQSVAALNRFLGVFETGDQAVSARQELARQQALLSDPAYLARVRGLA
FT                   QVDKGGSRAAIPELKKALAASPNDAEVLGALGQAYSRAGNRPQALSLFRQALQADKSGY
FT                   GSSKWQSLIKSNSYWLAVDEGDKALKAGNLALAQQKYQQARQFDNTDSSAVIGLGDVAV
FT                   ARKDDAAAERFYQQALRLDPGSGSAVRGLVNIYQRQSPEKALAYLNSLPRSQQNKMRST
FT                   LEGLQLDMLKQQAEQLAQQKQWHQAAEKYRRAQQMDPDDVWLTYHYAQTLRQAGQPEQA
FT                   DALFSRLAQKQRGNPQLTYAYALYLSGSDRDQQALAQLNTLPSAQWNDNMRELAQRLKM
FT                   QATLEHAERLRAAGDEPGAVAYLHRQPADTRIDLQLADWALARGDYDAALADYQRVRVR
FT                   EPNNPDARLGEIEAYVAQGKLNEARQRLQTKAPEPTPSGNSERREANAWYAVGEPQKAT
FT                   DIFTRLKTAAQSEPASQSKALIYRDAARLERDQLQPSLAQQDYKQAMVASGITPSVPQD
FT                   NDSYTYLTRNNPSDDWLKRGIRSDAADLYRQQDVNVTLDHDYWGSSGTGGISDYKAHDT
FT                   MLQVDMPLYDGRAFFRSDTVQLDAGSFSTDGSGKYYETFGTCNTQGCSGDEHQKTTGTS
FT                   VAVGWKNDRWAGDIGTTPMGFDVVDWVGGLAYSSDWNHIGWTLAASRRPISSSLLAFGG
FT                   TKDPNTGTTWGGVRATGVSLSGSYDRGEAHGVWADLSAHQLTGKNVEDNQRERFMAGYY
FT                   YKLINEDNRRVTVGLNTMLWHYQKDLSGYSLGQGGYYSPQQYMSLAVPVNYRQRTENWS
FT                   WELGGSVSLSHSKTNSQQRYPLQGLIPDSLPDKFAVEDGSSSSGVGYTLRAIVERRLSS
FT                   HWTLGAGLDIQQAKDYTPSHALIYLRYSMAGWQGDLDLPPQPLTPYADFK"
FT   sig_peptide     165011..165085
FT                   /locus_tag="Spro_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 25"
FT   gene            168775..170781
FT                   /locus_tag="Spro_0152"
FT   CDS_pept        168775..170781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0152"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: ypp:YPDSF_3363 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39262"
FT                   /db_xref="GOA:A8G822"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A8G822"
FT                   /protein_id="ABV39262.1"
FT                   /translation="MRVRRSLTIKQMATVSGVALVTICIFIVIQLFHFVQQRRDDYAQQ
FT                   LENIAHSVRQPLAEAVLRMDVPETKRVLNTLLPVGILSRADIVLPNEFQALHANFPPER
FT                   PVPTLIARLFELPIQISVPLYSLERVPANPQPLAYLVLQADSFRMYQFILSMLSTMLST
FT                   YLLLALILSVSISWCMNRLMVHPLRAMAKELENISQEEAPYHQLMLPALHQDDELGLLV
FT                   RNYNRNQQRLAKAYAEMSRMSTHHPVTELPNQALFTALLEQHIASSLRPERFNLLVISI
FT                   ETLHEASGVLNPAMREVLLLTLVKKLRECIDENGVLAQLSKTEFAILAKGVERPFHAMQ
FT                   LARRIMAQINAPLSLQEMPLRPSASIGIAHYLNPGESAEQLLRSATSAMMSAHREGKNQ
FT                   VLFFEPSLTERTQKRLTQESEILHAIEQRRFTLFLQPQVDMQSNSVIGAEALLRWQQYD
FT                   GSFTLPADVIPLAEELGVIVPLGNWVLEEACLILADWQARGITLPLAVNVSPIQMKHED
FT                   FIPHLKSLLAQYQIDPRKLLLEITETVRIDDLDRALALLRELHDLGLSIALDDFGMGYS
FT                   SLNYLNRLKCLPIDLIKIDKSFIQGLPTDDAMVRIVSSISEVLALPVMAEGVENAEQRD
FT                   WLLQQGIHSGQGFLFARPLPRSEFEAEFCRPPA"
FT   gene            171075..172364
FT                   /locus_tag="Spro_0153"
FT   CDS_pept        171075..172364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0153"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   yen:YE4067 C4-dicarboxylate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39263"
FT                   /db_xref="GOA:A8G823"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G823"
FT                   /protein_id="ABV39263.1"
FT                   /translation="MKLTIFKSLYFQVLTAITLGVLLGHFYPDIGAQMKPLGDGFVKLI
FT                   KMIIAPVIFCTVVTGIAGMESMKAVGRTGAIALLYFEIVSTIALLIGLLIVNLVQPGAG
FT                   MNIDPGTLDAKAVAVYAEQAQQQGIVPFLLDIIPGSVIGAFASGNILQVLLFAVLFGFA
FT                   LHRLGDKGQLIFNVIESFSRVIFGIINMIMRLAPLGAFGAMAFTIGKYGVGSLLQLGQL
FT                   IACFYLTCILFVVVVLGSIARANGFSIFKFVRYIKEELLIVLGTSSSESVLPRMLDKME
FT                   KLGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTHMDVIHQVTLLVVLLLSS
FT                   KGAAGVTGSGFIVLAATISAVGHLPLAGLALILGIDRFMSEARALTNLVGNGVATVVVA
FT                   KWCKQLDEKQLHDTLSNKPGSGADKTLPSA"
FT   gene            172647..174140
FT                   /locus_tag="Spro_0154"
FT   CDS_pept        172647..174140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0154"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG: yen:YE4066
FT                   putative insulinase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39264"
FT                   /db_xref="GOA:A8G824"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A8G824"
FT                   /protein_id="ABV39264.1"
FT                   /translation="MQGTRIHLIAGGLLLAAANSSAQAEALQPDPAWQQGALANGFSWQ
FT                   ILDTPQRPSDRVELRLMVNTGSLVESSQQIGFAHLLPRLSLARSESFTPPQLRSLWQQS
FT                   VDSDRPLPPAISSYDFTIYNLSLPNNRPDLLKEALTWLSDTTGKLAIDEHTVHAVVNSS
FT                   IDPVGTFPPNPKDAWWRYRLKGSTMLAHDPAQPPKRPVNVDQLKKFYQQWYTPDAMTLY
FT                   VVGKVDSRSLSEQINKAFSPLQGKRETPALMPTLTSLPPQPVSLISEQVKQDTLSIMWD
FT                   APWHPIRDSQNLSRYWRGDMAREALFWHLQQVLDKSDQKNLHLGFDCRVQYQRAQCAIH
FT                   LDTPNNNLNNSLGFIARELANVRNNGLSQDEFNALLAQKNDQLSKLFATYARTDTDVLM
FT                   SQRLRSQQSGVVDIAPEQYQKLRQEFLSGLTLEALNQELKLQLSQDATLVLMQPKGEPE
FT                   MSMKQLQETYNGIMSPAPAVVSEEVKPTDTAPAPETSAQ"
FT   sig_peptide     172647..172721
FT                   /locus_tag="Spro_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 25"
FT   gene            complement(174168..174503)
FT                   /locus_tag="Spro_0155"
FT   CDS_pept        complement(174168..174503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0155"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: kpn:KPN_04275 peptidyl-prolyl cis-trans isomerase C
FT                   (rotamase C)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39265"
FT                   /db_xref="GOA:A8G825"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G825"
FT                   /protein_id="ABV39265.1"
FT                   /translation="MRFNGYNQRNFCIDKGNTMAKTACALHILVDNEKLADELLAKLKR
FT                   GVSFDTLARKYSTCPSKRNGGSLGEFNKGTMVAAFDKAVFSIPLLKPYGPVKTQFGYHI
FT                   IKVLYRS"
FT   gene            174559..176583
FT                   /locus_tag="Spro_0156"
FT   CDS_pept        174559..176583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0156"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: eca:ECA4215 ATP-dependent DNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39266"
FT                   /db_xref="GOA:A8G826"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8G826"
FT                   /protein_id="ABV39266.1"
FT                   /translation="MRLNPSQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIHNCGY
FT                   QARHIAAVTFTNKAAREMKERVAQTMGRKEARGLMISTFHTLGLEIIKREYVALGMKSN
FT                   FSLFDDQDQLALLKELTEKWLENDKTLVAQLISTISNWKNDLVDPQKAMELARSERDKL
FT                   FAHCYGLYHAHMRACNVLDFDDLILLPTLLLQRNEEVRERWQNRIRYLLVDEYQDTNTS
FT                   QYELVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLVLLKEDFPALQVIKLEQNYRSSE
FT                   RILKAANILIANNPHVFEKRLFSELGYGEELKVVTANNEDHEAERVVGELIAHHFVKKT
FT                   NYGDYAILYRGNHQSRLFEKMLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNQDDD
FT                   SAFLRIVNTPKREIGPATLQKLGEWANQRNKSLFRASFDLGLSQHLTGRGLESLQRFTH
FT                   WLDGIAQLAEREPIAAVRDLIRGVDYESWLFETSPSPKAAEMRMKNVNTLFGWMTEMLE
FT                   GSELDEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFPYVFLVGMEEG
FT                   LLPHQSSIDEDNVDEERRLAYVGITRAQKELIFTLCRERRQYGELVRPEPSRFLLELPQ
FT                   DDLAWESERKVVSPQERMQKGQSHLANIRAQLAKAKGGS"
FT   gene            complement(176766..178262)
FT                   /locus_tag="Spro_0157"
FT   CDS_pept        complement(176766..178262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0157"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: yen:YE0165
FT                   guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39267"
FT                   /db_xref="GOA:A8G827"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G827"
FT                   /protein_id="ABV39267.1"
FT                   /translation="MLSSSALYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLAAG
FT                   LDQNNLLSHEAMQRGWQCLKLFSERLQDIPRAQIRVVATATLRLASNADEFLQTAEQIL
FT                   GCPIQVISGEEEARLIYHGVAHTTGGPDQRLVVDIGGGSTELVTGTGAQAAQLYSLSMG
FT                   CVTWLERFFSDRNLGQENFERAEQAAREMVRPIAPQLRQHGWQVCVGASGTVQALQEIM
FT                   VAQGMDERITLSKLRQLKQRAIQCGKLEELEIEGLTLERALVFPSGLSILLAIFQELGI
FT                   ESMMLAGGALREGLVYGMLHLPVEQDIRSRTIRNLQRRYLLDTEQAERVSQLAANFSQQ
FT                   VSNEWQLDARCRELLHSACLIHEIGLSVDFKQAPQHAAYLIRHLDLPGFTPAQKKLLAT
FT                   LLQNQSNTIDLPLLSQQNALPPRTAQRLCRILRLAIIFASRRRDDTLPAVRLRANNDDE
FT                   LTVILPPGWLEQHPLRAEALDQESHWQSYVHWPLILEEQR"
FT   gene            complement(178269..179555)
FT                   /locus_tag="Spro_0158"
FT   CDS_pept        complement(178269..179555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0158"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   ypi:YpsIP31758_0178 ATP-dependent RNA helicase RhlB"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39268"
FT                   /db_xref="GOA:A8G828"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G828"
FT                   /protein_id="ABV39268.1"
FT                   /translation="MSKTHLTEQKFSDFALHPLVLEALEKKGFQHCTPIQALALPLTLS
FT                   GRDVAGQAQTGTGKTLAFLTSTFHYLLSHPAKQDRKINQPRALIMAPTRELAVQIHSDA
FT                   EALSQSTGLKMGLAYGGDGYDKQLKVLESGVDILVGTTGRLIDYAKQNYIDLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPAVDQRLNMLFSATLSYRVRELAFEQMNNAEYVEVE
FT                   PEQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEDVWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILDDFTKGNLDILVATDVAARGLHIPLVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLSDLPAPKRL
FT                   ARPRGGNGPRRNSAPRRGGAPRNNRKRSG"
FT   gene            179673..179999
FT                   /locus_tag="Spro_0159"
FT   CDS_pept        179673..179999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0159"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: sdy:SDY_3968 thioredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39269"
FT                   /db_xref="GOA:A8G829"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A8G829"
FT                   /protein_id="ABV39269.1"
FT                   /translation="MSDKIIHLTDGSFDTDVLKAEGPILVDFWAEWCGPCKMIAPILDE
FT                   IAEEFEGKLTITKLNIDQNPATAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKDFL
FT                   NANL"
FT   gene            180578..181837
FT                   /locus_tag="Spro_0160"
FT   CDS_pept        180578..181837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0160"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: eca:ECA4211 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; Ribonuclease B OB region
FT                   domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39270"
FT                   /db_xref="GOA:A8G830"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A8G830"
FT                   /protein_id="ABV39270.1"
FT                   /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSGDSSYLAGPDDIYVSPSQIRRFNLRTGDSVSGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLARKIAEKRVFPAIDYNRSGTRKEELLTTSEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            182166..183248
FT                   /locus_tag="Spro_0161"
FT   CDS_pept        182166..183248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0161"
FT                   /product="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphatetransferase"
FT                   /note="TIGRFAM: undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyl 1-phosphatetransferase; PFAM:
FT                   glycosyl transferase family 4; KEGG: ypi:YpsIP31758_0182
FT                   undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphatetransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39271"
FT                   /db_xref="GOA:A8G831"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:A8G831"
FT                   /protein_id="ABV39271.1"
FT                   /translation="MSTEILFVFLFSLAFLFVARKAAKRIGLVDKPNYRKRHQGLIPLV
FT                   GGISVYAGLCFAFLISDQTIAHGKLYLACAGILVFVGALDDRFDISVKIRALVQALVGI
FT                   AMMVFAGLYLRSLGHVLGDWEMLLGPFGYLVTLFAVWAAINAFNMVDGIDGLLGGLSCV
FT                   SFGALGVLLYLSGHSDLAFWCFAMIAAIVPYILLNLGILGRRYKVFMGDAGSTLIGFTA
FT                   IWLLVQSSQGKAHSINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIHHLIMR
FT                   AGFTPRQAFVLITLAAALLAAIGVLGERLTFIPEWVMLALFLLAFFLYGYCIKRAWRVA
FT                   RYIKRIKRRLRRSNGNKQVS"
FT   sig_peptide     182166..182231
FT                   /locus_tag="Spro_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.488 at
FT                   residue 22"
FT   gene            183269..184321
FT                   /locus_tag="Spro_0162"
FT   CDS_pept        183269..184321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0162"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   yen:YE0170 putative lipopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39272"
FT                   /db_xref="GOA:A8G832"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:A8G832"
FT                   /protein_id="ABV39272.1"
FT                   /translation="MNPETRSDKNIPAVDNELDIRGLCCTLWRGKPWIIGIAVLFAVVA
FT                   LMVSYLVKQEWSATAITDRPTVNALGGYYSQQQFLRNLDVRTMPAASTDQPGIADEAYN
FT                   EFIMQLAAYDTRRDFWLQSDYYKQRQEGDAAADAALLDELINNIQFTPRDDKKVPNDGV
FT                   KLTAETAADANRLLRQYVAFASHRAAQHLNEEIQGAWAARTTSMKAQVKRQEAVAAAVY
FT                   KRELNTIQQALKIAETQGISRTQTDTPTEQLPDSDLFLLGKPMLQARLEGLQASGPTFD
FT                   LDYDQNRAMLSTLNVGPTLDEKFQTYRYLRTPEEPVKRDSPRRIFWLIMWGAMGALVGA
FT                   GVALVRRPRN"
FT   gene            184406..185536
FT                   /locus_tag="Spro_0163"
FT   CDS_pept        184406..185536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0163"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   yen:YE0171 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39273"
FT                   /db_xref="GOA:A8G833"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:A8G833"
FT                   /protein_id="ABV39273.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAQDEAFESRVCVTAQHREMLDQ
FT                   VLRLFEIVPDYDLNIMKPGQGLSEITCRILEGLKGVLEEFKPDVVLVHGDTTTTLATSL
FT                   AAFYQRIPVGHVEAGLRTGDLYSPWPEEANRKLTGHLAMYHFAPTENSRQNLLRELLPD
FT                   DHIFVTGNTVIDALFWVRDRVMGDAALHDSLAQRYPFLDADKKMILVTGHRRESFGGGF
FT                   ERICSALAEIARTHPDVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPFVYLMA
FT                   NAYMILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVRLVGTDVAKIVDAVTQLL
FT                   TDEDEYHAMSRAHNPYGDGHACQRILEALKNHQVTL"
FT   gene            185533..186795
FT                   /locus_tag="Spro_0164"
FT   CDS_pept        185533..186795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0164"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: yen:YE0172
FT                   putative UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39274"
FT                   /db_xref="GOA:A8G834"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G834"
FT                   /protein_id="ABV39274.1"
FT                   /translation="MSFNTISVIGLGYIGLPTAAAFASRKKKVVGVDVNQHAVDTINRG
FT                   AIHIVEPDLDKVVKDAVDGGYLQAVTQPLAADAFLIAVPTPFKGDHEPDLAYVEAAAKS
FT                   LAPVLKKGDLVILESTSPVGATEQMAQWLAEARSDLSFPQQAGEAADVNIAYCPERVLP
FT                   GQVMVELIQNDRVIGGMTPKCSERASALYKIFLEGECVITNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICADQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPQQ
FT                   ARLIHTARLVNDGKPLWVVDRVKAAVADCLAATDKRASEVKIACFGLAFKPNIDDLRES
FT                   PAVEVAHLIADWHVGETLVVEPNVEQLPKSLVGHVTLKALPEALQQADVIVMLVDHKQF
FT                   KAIKPEEITQSWIVDTKGVWR"
FT   sig_peptide     185533..185604
FT                   /locus_tag="Spro_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.773 at
FT                   residue 24"
FT   gene            186792..187859
FT                   /locus_tag="Spro_0165"
FT   CDS_pept        186792..187859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0165"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: ypi:YpsIP31758_0186 dTDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39275"
FT                   /db_xref="GOA:A8G835"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G835"
FT                   /protein_id="ABV39275.1"
FT                   /translation="MKRILVTGGAGFIGSAVVRHIIEATQDSVLVLDKLTYAGNLESLS
FT                   VVADNPRYSFEQVDICDRAALDRVFAEYQPDVIMHLAAESHVDRSIDGPAAFIETNVVG
FT                   TYTMLEAARHYWQPLDAAKKQSFRFHHISTDEVYGDLHGTDDLFTETTPYSPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNAVAGKPLPVYGDGAQ
FT                   VRDWLYVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVQTICDLLEELAPNKPQGV
FT                   EKYRDLITYVKDRPGHDMRYAIDAGKIDRELGWRPQETFESGIRKTVSWYLNNEIWWRR
FT                   VQDGSYAGERLGLSD"
FT   gene            187911..188792
FT                   /locus_tag="Spro_0166"
FT   CDS_pept        187911..188792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0166"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: ypi:YpsIP31758_0187
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39276"
FT                   /db_xref="GOA:A8G836"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A8G836"
FT                   /protein_id="ABV39276.1"
FT                   /translation="MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IRDILIISTPEDLPSFKRLLGSGEEFGINLSYAEQPSPDGLAQAFLIGEEFLAGEPSCL
FT                   VLGDNIYFGQGFSPKLKTVAARTQGATVFGYQVMDPERFGVVEFDDNFRALSIEEKPKA
FT                   PKSNWAVTGLYFYDSQVVEFAKQVKPSERGELEITSINQMYLERGELTVELLGRGFAWL
FT                   DTGTHDSLLEASSFVQTVEKRQGFKIACLEEIAWRNGWLDDEGVKRAAQSLLKTGYGKY
FT                   LLDLLHARPRQY"
FT   gene            188770..189501
FT                   /locus_tag="Spro_0167"
FT   CDS_pept        188770..189501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0167"
FT                   /product="TDP-D-fucosamine acetyltransferase"
FT                   /note="TIGRFAM: TDP-D-fucosamine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; KEGG: ypi:YpsIP31758_0188
FT                   TDP-D-fucosamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39277"
FT                   /db_xref="GOA:A8G837"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8G837"
FT                   /protein_id="ABV39277.1"
FT                   /translation="MHAHASIEPLAWETEFFALNSAKLNFSTAAPMLTEAELDGYALVQ
FT                   AKIPAHQTALVDGLTRLGFQLVEGEVDLVLNIGTECASLHTEATQAIRPAVPADIPMLR
FT                   AAAAGVFTASRFRAPWYHAQDSGRFYAEWIEKAVLGTFDHQCLLVLDDTGQPEGFVSLR
FT                   ELGGSEARIGLLAAFPGAAGKGIGSRLMTAVIAECRQRSLQRLRVATQFGNIAALRLYQ
FT                   RQGAAIESTSYWLYRGRHDPI"
FT   gene            189488..190618
FT                   /locus_tag="Spro_0168"
FT   CDS_pept        189488..190618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0168"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /note="TIGRFAM: TDP-4-keto-6-deoxy-D-glucose transaminase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; aromatic amino
FT                   acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   ssn:SSON_3963 putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39278"
FT                   /db_xref="GOA:A8G838"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:A8G838"
FT                   /protein_id="ABV39278.1"
FT                   /translation="MIPFNAPPVVGTELDYMQAAMGSGKLCGDGGFTRRCQQWMEQRFG
FT                   SPKVLLTPSCTASLEMAAILLDIQPGDEVIMPSFTFVSTANAFVLRGATVVFVDLRPDT
FT                   MNIDESKIEAAITDKTRAIVPVHYAGVACEMDTIMALAEKYKLYVVEDAAQGVMSTYKG
FT                   KALGTIGHIGCFSFHETKNYTAGGEGGATLINDSALIDRAEVIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWGQLEAADRINQRRLALWQKYYDSFLPLAEAGRIVLPS
FT                   IPADCVQNAHMFYIKLRDVEDRTAFIDYMKEAEIMTVFHYIPLHDCPAGDRFGRFAGED
FT                   RFTSQESARLVRLPLFYNMTDVTQRTVINTILNFFA"
FT   gene            190620..191870
FT                   /locus_tag="Spro_0169"
FT   CDS_pept        190620..191870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0169"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   yen:YE0177 putative lipopolysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39279"
FT                   /db_xref="GOA:A8G839"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:A8G839"
FT                   /protein_id="ABV39279.1"
FT                   /translation="MSLAKASIWTAGSTLIKIGVGLLVVKLLAVAFGPSGVGQAGNFRQ
FT                   LITVLGVLSGAGIFNGITKYVAEYHQDPQRLRLAVGTASTIVLGFSTLLALVFLFAAEP
FT                   ISIGLFGHADYVGVVRAVAFIQMGIAYANLFMAVLKGYRDAMGNALAVIGGSLIGVVAY
FT                   YLCFKLGGYEGALAGLALVPALVVLPACFMLWRRKTLPLSYLALAWDKALASHLGKFTI
FT                   MALITSVTLPVAYVMMRNLLASHYSWEEVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLKEKSAISQEIVRSLKFVLPAVAAASFTVWLLRDFAIWLLFTDKFVAMRDLFAWQLVG
FT                   DVLKVGAYVFGYLVIAKASLRFYILTEVSQFLLLTLFSHWLIPLHGALGAAQAYMATYI
FT                   VYFTLCSCVFILYRRRV"
FT   gene            191867..192952
FT                   /locus_tag="Spro_0170"
FT   CDS_pept        191867..192952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0170"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /note="PFAM: 4-alpha-L-fucosyltransferase; KEGG: yen:YE0178
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39280"
FT                   /db_xref="GOA:A8G840"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G840"
FT                   /protein_id="ABV39280.1"
FT                   /translation="MTTLIHVLGSDIPHHNQTVLRFFNDVLAKRLPSDQTRHFMVAAKD
FT                   AAALGPFPELNLECHPDKKSLAMAVIARAQADRDQRFFFHGQFNPTLWLALLSGKIKAH
FT                   QVSWHIWGADLYENATSWKFRLFYLLRRIAQGRVGRVFATRGDVIHYQQRHARVPASLL
FT                   YFPTRMDPALTGISVEKNLAGPMTILVGNSGDRTNRHVEALKAIHQQFGADVRVILPMG
FT                   YPANNEAYIEQVRTAGLALFSASNLQVLTQQVAFDDYLNILRECDLGYFIFNRQQGIGT
FT                   LCLLIQFGVPFVLSRQNPFWQDLAEQHLPVLFYGDSLDEAVVREAQRQLASVDKQEIAF
FT                   FNPNYVDGWQQALALAAGDNS"
FT   gene            192949..194325
FT                   /locus_tag="Spro_0171"
FT   CDS_pept        192949..194325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0171"
FT                   /product="WzyE family protein"
FT                   /note="PFAM: WzyE family protein; KEGG: yen:YE0179 probable
FT                   4-alpha-L-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39281"
FT                   /db_xref="GOA:A8G841"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G841"
FT                   /protein_id="ABV39281.1"
FT                   /translation="MTLAQFGGLFVVYLIGTLFVLTLTYQEFRRVRFNFNVFFSLLYLL
FT                   TFYFGFPLTCLLVFQFDVEVVPVEFLLYAILSATAFYAIYYVSYKTRLRKRSVQPRKAV
FT                   FSMNRVETHLTWILLALVAIVTVGIFFLQNGFLLFKLNSYSQIFSSDVSGVALKRFFYF
FT                   FIPAMLVVYFLKQDLRAWFFFLAATVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGW
FT                   ISLWMLVAAGVFGIVGMFWLALKRYSLDVSGPEAFYTFLYLTRDTFSPWENLALLLQNY
FT                   DKIDFQGLAPIVRDFYVFIPSWLWPGRPDTVLNTANYFTWEVLDNHSGLAISPTLIGSL
FT                   VVMGGALFIPVGAVLVGMIIKWFDWLYEMGKSESNRYKAAILQGFCFGAVFNIIVLARE
FT                   GVDSFVSRVVFFCLIFGVCLLMAKLLYWLFDTAGLIKARVQRSRTLTPPASSVRADGLL
FT                   "
FT   gene            194339..195079
FT                   /locus_tag="Spro_0172"
FT   CDS_pept        194339..195079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0172"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   ypi:YpsIP31758_0193 glycosyl transferase, WecB/TagA/CpsF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39282"
FT                   /db_xref="GOA:A8G842"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G842"
FT                   /protein_id="ABV39282.1"
FT                   /translation="MEAKISVPKYELRGFSLWGFRDMAQCMDFLFDGGRVKRGTLVAMN
FT                   AEKILTAEQDTELHALLDEAEYKYADGISMVRSIRRKYPGADVSRVAGADLWEALMQRA
FT                   GREGTPVFLIGGKPSVLAETEQKLRSQWNVNLVGSQDGYFKPEQREPLFERIRASGAAI
FT                   VTVAMGSPKQEILMRDCRKVHPQALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLL
FT                   SQPSRLGRQLRLLKFVSYYYRGKM"
FT   gene            195448..196851
FT                   /locus_tag="Spro_0173"
FT   CDS_pept        195448..196851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0173"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   yen:YE0181 putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39283"
FT                   /db_xref="GOA:A8G843"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A8G843"
FT                   /protein_id="ABV39283.1"
FT                   /translation="MPHTEKPQGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGP
FT                   SVLLAYIIAGLFVFFIMRSMGEMLFLEPVAGSFAVYAHKYMSPYFGYLTAWGYWFMWIA
FT                   VGISEITAIGVYVQFWFPEIPQWLPALIAVAMVALANVAAVRLYGELEFWFAMIKVTTI
FT                   IVMILVGLGVILFGFGNGGQPIGFANLTEHGGFFAGGWKGFLFALCIVVASYQGVELVG
FT                   ITAGEAKNPQVTLKRAINNILWRILIFYVGAIFVIVTIFPWNGIGTTGSPFVLTFAKIG
FT                   IVAAAGIINFVVLTAALSGCNSGMYSGGRMLYALAKNRQLPASLTRLSANGVPVNCIAV
FT                   TIACLLVGSGLNYLIPNPQAVFVYVYSASVLPGMVPWFVVLISQLYFRRAHKEALKTHS
FT                   FKSIMFPYVNYLTIAFLVCVLIGMGINPDTRISLLVGAIFLAAVSLCYFVFGMHKKHHP
FT                   AEKRTETQQ"
FT   gene            196987..197063
FT                   /locus_tag="Spro_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            196987..197063
FT                   /locus_tag="Spro_R0003"
FT                   /product="tRNA-Arg"
FT   gene            197123..197198
FT                   /locus_tag="Spro_R0004"
FT                   /note="tRNA-His1"
FT   tRNA            197123..197198
FT                   /locus_tag="Spro_R0004"
FT                   /product="tRNA-His"
FT   gene            197242..197328
FT                   /locus_tag="Spro_R0005"
FT                   /note="tRNA-Leu1"
FT   tRNA            197242..197328
FT                   /locus_tag="Spro_R0005"
FT                   /product="tRNA-Leu"
FT   gene            197405..197481
FT                   /locus_tag="Spro_R0006"
FT                   /note="tRNA-Pro2"
FT   tRNA            197405..197481
FT                   /locus_tag="Spro_R0006"
FT                   /product="tRNA-Pro"
FT   gene            complement(197585..197827)
FT                   /locus_tag="Spro_0174"
FT   CDS_pept        complement(197585..197827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39284"
FT                   /db_xref="UniProtKB/TrEMBL:A8G844"
FT                   /protein_id="ABV39284.1"
FT                   /translation="MIFIVLNHNVICLNLATMRHADVAENQHGSRNPEQDSRKIPRFFA
FT                   EWQKAKNPFIAERAFLNVVGERGLLHLRCRPAGRC"
FT   gene            complement(198310..199506)
FT                   /locus_tag="Spro_0175"
FT   CDS_pept        complement(198310..199506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0175"
FT                   /product="HemY protein"
FT                   /note="TIGRFAM: HemY protein; PFAM: HemY domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: yen:YE0184
FT                   putative protoheme IX biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39285"
FT                   /db_xref="GOA:A8G845"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A8G845"
FT                   /protein_id="ABV39285.1"
FT                   /translation="MLRVLFLFLVLIASVVVGPMLAGHQGYVLIQTDNYNIETSVTGLV
FT                   IMGVLLFVVLLVIEWILRRIFRTGAHTRGWFLGRKRSRARKQTKAALIKLAEGDYKQVE
FT                   KLLTRNADHAEQPVVNYLLAAEAAQQRGDDFRTNQYLERAAEAADTDQLPVDITRVRIQ
FT                   LAQGENHAARHGVDRLLNQAPRHPEVLRLAELAYLRTGAFASLLEILPSMSKINLHTDA
FT                   ELQALQQQAYIGLMNQAMADEGSEGLKRWWKDQSRKTRHEVPLQIAMVDHLIECNDHEL
FT                   AQEIVLDSLKRQYDERLVLLIPRLKSGNPQQLEKALRQQVKQHGATPLLNSTLGQLLMK
FT                   HGEWQQAADAFREALKQRPDAYDYAWLADVLDKLHRSDEAAQMRREGLMLTLKQNGES"
FT   sig_peptide     complement(199435..199506)
FT                   /locus_tag="Spro_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.791 at
FT                   residue 24"
FT   gene            complement(199510..200634)
FT                   /locus_tag="Spro_0176"
FT   CDS_pept        complement(199510..200634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0176"
FT                   /product="protein of unknown function DUF513 hemX"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   yen:YE0185 putative uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39286"
FT                   /db_xref="GOA:A8G846"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A8G846"
FT                   /protein_id="ABV39286.1"
FT                   /translation="MTEQNTPSAPVEEPTPVADSPKPPDANQRKGKNTGPILGAIAIVL
FT                   VIALGAGGYYHTHRQAQQLISANQNLQQQLEALKQSQQQEKNALEGLLQQQGKTLDAAD
FT                   REQATLTRQLSELQEKVAIISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAAALLKS
FT                   ADASLADMNDPSLLEVRRAITEDVSTLSTLTQVDFDGIILKTNQLSNQVDNLRLADNDS
FT                   DEAPMDQDSGELSSSISEWRQNLTKSWHNFMADFITVRRRDSSAEPLLAPNQDIYLREN
FT                   IRSRLLVAAQAIPRHQNEVYKQSLETISTWIRAYFDTTDPATKAFLEELDALSQQSITM
FT                   DVPDQLKSQPLLEKLMQTRVRNLMTQSPAAHQEG"
FT   gene            complement(200658..201398)
FT                   /locus_tag="Spro_0177"
FT   CDS_pept        complement(200658..201398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0177"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   yen:YE0186 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39287"
FT                   /db_xref="GOA:A8G847"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A8G847"
FT                   /protein_id="ABV39287.1"
FT                   /translation="MTILVTRPSPSGEQLVSRLRALGRVAYHAPLIDFAPGGDLPKLPQ
FT                   ALQQLNDGDLVFILSQHSVSYANSVMGRVGLPWPARLAYYAIGRNTALAMHRISSLPVE
FT                   YPREQEISETLLLLPALQNLDGKQALILRGNGGRELLGNSLSERGAAVSYYECYQRSPV
FT                   HYDGSEQSAHWQRAGVDTLVVTSGEMLQQLYTLVPDYYRSSWLLRCRLVVVSERLATLA
FT                   QELGWSTIRVADNADNDALIRALQ"
FT   gene            complement(201395..202336)
FT                   /locus_tag="Spro_0178"
FT   CDS_pept        complement(201395..202336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0178"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: ypi:YpsIP31758_0198 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39288"
FT                   /db_xref="GOA:A8G848"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G848"
FT                   /protein_id="ABV39288.1"
FT                   /translation="MLDKIIRIATRQSPLALWQAHYVQQRLMANHPGLQVELVPMVTKG
FT                   DIILDTPLAKVGGKGLFVKELELALLDGRADIAVHSMKDVPVDFPAGLGLVTICERDDP
FT                   RDAFVSNRFTSLDQLPQGSVVGTSSLRRQCQLRERRPDLIVRDLRGNVGTRLSKLDNGD
FT                   YDAIILAVAGLKRLGLEQRIRSPLSPEECLPAVGQGAVGIECRLDDETTRALLAPLNHA
FT                   VTETRVRAERAMNTRLEGGCQVPIGSYAELDGDSLWLRALVGSPDGSQMVRGERRGPAA
FT                   LAEQMGIELAEELLAQGAREILQDVYQGNPPA"
FT   gene            202653..205205
FT                   /locus_tag="Spro_0179"
FT   CDS_pept        202653..205205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0179"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylate cyclase class-I; KEGG: yen:YE0189
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39289"
FT                   /db_xref="GOA:A8G849"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A8G849"
FT                   /protein_id="ABV39289.1"
FT                   /translation="MYLYIETLKQRLDAINQLRIDRALAAMKPAFQRVYSLLPTLLHHH
FT                   HPLMPGYLNGNVPHGVCIYTPDETQQEYLNDLEDKWGSPFDKPASGELPITGVYSMGST
FT                   SSIGQSCSSDLDIWVCHQSWLDNEERNRLQQKCSLLEKWAASMGVEVSFFLIDENRFRH
FT                   NESGSLGGEDCGSTQHILLLDEFYRTAVRLAGKRILWNMVPGDEESHYDEYVLSLYSQG
FT                   ALTPNEWLDLGGLGTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNTQLL
FT                   AMDIKQRLHQGEIVCFGLDAYCMMLERVTHYLNAINDTTRLDLVRRCFYLKVCEKLSRA
FT                   NACVGWRREILSQLVSEWGWDEERLAILDNRANWKIARVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEDDLTFIHVPIGR
FT                   ANRTGWYLYNQAPAMDSIVSHQPLEYNRYLNKLVAWAYFNGLLTPKTRLHIKSGNLCDT
FT                   AKLQELVADVSHHFPLRLAAPTPKALYSPCEIRHLAIIVNLENDPTAAFRNQVVHFDFR
FT                   KLDVFSFGQQQQCLVGSIDLLYRNSWNEVRTLHFSGEQSVLEALKTILGKMHQDAAPPE
FT                   SVEVFCYSQHLRGLIRTRIQQLVSECIELRLSSTRLEPGRFKAVRVAGQTWGLFFERLS
FT                   VSVQKLENAVEFYGAISNNKLHGLSIKVETDQVHLPPVVDGFASEGIIQFFFEDTSDDK
FT                   GFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLDGRTQVIPFRSNVLSSLCVPLTDGAAQPLKQQFQLH"
FT   gene            complement(205252..205572)
FT                   /locus_tag="Spro_0180"
FT   CDS_pept        complement(205252..205572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0180"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG:
FT                   ypi:YpsIP31758_0203 CyaY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39290"
FT                   /db_xref="GOA:A8G850"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G850"
FT                   /protein_id="ABV39290.1"
FT                   /translation="MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFEN
FT                   GTKIVINRQEPLHQVWLATKTGGYHFNYRDGVWLCDRSDRAFYPLLSEAASAQAGEEVK
FT                   FA"
FT   gene            205645..205857
FT                   /locus_tag="Spro_0181"
FT   CDS_pept        205645..205857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0181"
FT                   /product="lipoprotein"
FT                   /note="KEGG: ypp:YPDSF_3463 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39291"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A8G851"
FT                   /protein_id="ABV39291.1"
FT                   /translation="MQMKKQLRYALMAVLLAGLSGCGLKGPLYFPPADPASTKKPATQV
FT                   QTGEQVQKNQQELSSSQQKPSMSAQ"
FT   sig_peptide     205645..205722
FT                   /locus_tag="Spro_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.756 at
FT                   residue 26"
FT   gene            205915..206739
FT                   /locus_tag="Spro_0182"
FT   CDS_pept        205915..206739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0182"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: yen:YE0192
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39292"
FT                   /db_xref="GOA:A8G852"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G852"
FT                   /protein_id="ABV39292.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQL
FT                   LVVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRM
FT                   VLSVTDDDLVCVNMGEPNFDPQTVPFRATKEEKTYIMRAAEHTVLCGVVSMGNPHCVLQ
FT                   VDDVKTAKVELLGPVLEGHERFPERANIGFMQIVSREHIKLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQELLSEEVHVELPGGSLHIRWKGPGSPLFMTGPATHVYDGFIHL"
FT   gene            206736..207440
FT                   /locus_tag="Spro_0183"
FT   CDS_pept        206736..207440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0183"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   ypi:YpsIP31758_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39293"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A8G853"
FT                   /protein_id="ABV39293.1"
FT                   /translation="MKSVEDQAVAGIELDDDTVMQFLLQNPDFFIRNARLVEQMRVPHP
FT                   VRGTVSLVEWHLARQRNHINRLEEEITLLMEQASANETLFASLLHLQANLATADSLQDM
FT                   LNRLQRWARGFGLAGANIRLFSESWKIGAPSDFTHLALTRSSFEPLRIQRLGDQQHFLG
FT                   SLNGPELLLLLPQAKLVGSVALSMLGEDGELGMVIFSSRDTQHYQQGMGTVMLNQLARM
FT                   LPELLERWVERA"
FT   gene            207437..208348
FT                   /locus_tag="Spro_0184"
FT   CDS_pept        207437..208348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0184"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: ypi:YpsIP31758_0207 tyrosine recombinase
FT                   XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39294"
FT                   /db_xref="GOA:A8G854"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A8G854"
FT                   /protein_id="ABV39294.1"
FT                   /translation="MIPLAASLQQPVDAFLRYLKVERQLSPLTQLSYSRQLQALMALAQ
FT                   EIGVTEWPLLDAAKVRQLAARSKRAGLQSSSLALRLSALRSFLDWQVSQGMLIANPAKG
FT                   IRTPRSGRHLPKNIDVDEMNQLLNIDLNDPLAVRDRAMLEVMYGAGLRLSELVGLDCRH
FT                   VDLAAGEIWVLGKGSKERKLPVGRTAVTWLEHWLAMRDLFGPSDDAMFLSNQGKRISTR
FT                   NVQKRFAEWGVKQGVNSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTTQIYTH
FT                   LDFQHLANVYDAAHPRAKRGKS"
FT   gene            208348..209064
FT                   /locus_tag="Spro_0185"
FT   CDS_pept        208348..209064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0185"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: yen:YE0195 putative haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39295"
FT                   /db_xref="GOA:A8G855"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8G855"
FT                   /protein_id="ABV39295.1"
FT                   /translation="MHFYRPLRPLAALTFDLDDTLYDNRPVIKQTELQSVAFLQNYHPG
FT                   LNHFQSADFHRLRQELREQDPEIYHDVTQWRWRAIHLALSRQGLRDAEAADGADAAMQN
FT                   FALWRSRIEVPEATHTTLKALGERFPLVAITNGNADPALCGLDGYFQFVLRSGPDGRAK
FT                   PYQDMYQLAAERLGVAPERILHVGDDLTTDVAGALRSGLQACWINDRQRSLMQAADSRL
FT                   LPHIEISQLASLTALL"
FT   gene            209133..211304
FT                   /locus_tag="Spro_0186"
FT   CDS_pept        209133..211304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0186"
FT                   /product="DNA helicase II"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: yen:YE0196 DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39296"
FT                   /db_xref="GOA:A8G856"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A8G856"
FT                   /protein_id="ABV39296.1"
FT                   /translation="MVPMDVSDLLDSLNEKQREAVAAPRGNLLVLAGAGSGKTRVLVHR
FT                   IAWLLAVENCSPYSIMAVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAH
FT                   HLDANLPQDFQILDSDDQFRLLKRIVKALNIDEKQWPPRQAMWYINGKKDEGLRPQHVE
FT                   TYNNPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNVLV
FT                   DEFQDTNSIQYAWIRLLAGNNSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAQSVL
FT                   LEQNYRSTSNILKSANTLIANNGGRMGKNLWTEGGEGEPISVYCAFNELDESRFVVGRI
FT                   KAWQENGGALNDCAILYRSNAQSRVLEEALLQTAMPYRIYGGQRFFERQEIKDALAYLR
FT                   LIANRNDDAAFERVVNTPTRGIGDRTLDEVRRTARDRQLTMWQATRVLLQDKVLAGRAA
FT                   SALQRFTELLDSLAHETADMPLHVQTDRVIRDSGLFIMYEQEKGEKGQARIENLEELVT
FT                   ATRQYSYQDEDQDLMPLQAFLSHAALEAGEGQADAYQDAVQLMTLHSAKGLEFPQVFIV
FT                   GMEEGMFPSQMSLDEGGRLEEERRLAYVGLTRAMQKLTLTYAETRRLYGKEVYHRPSRF
FT                   IGELPEECVEEVRLRASVSRPANHRRMGTPISENDTGYKLGQRVRHPKFGEGTIVNLEG
FT                   SGEHSRLQIAFPGEGIKWLVAAYARLETV"
FT   gene            complement(211347..211826)
FT                   /locus_tag="Spro_0187"
FT   CDS_pept        complement(211347..211826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_02730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39297"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027565"
FT                   /db_xref="UniProtKB/TrEMBL:A8G857"
FT                   /protein_id="ABV39297.1"
FT                   /translation="MKQITAHDLTAMSEQAAKVARLRAHRTLHEELSDPVQRLAIAMEP
FT                   GTYIRPHRHPQTWELLTPLRGRFVVLQFNEDGVVTQRTLLGEETKVLEMPAFTWHAVLS
FT                   VDPGGVVFEVKQGPYQALSEEDCMPWAPQEGAEGTEAVMRWYATAQIGDRYTHTV"
FT   gene            212272..213222
FT                   /locus_tag="Spro_0188"
FT   CDS_pept        212272..213222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0188"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: yen:YE0200 magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39298"
FT                   /db_xref="GOA:A8G858"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A8G858"
FT                   /protein_id="ABV39298.1"
FT                   /translation="MLSAFKLDNSRLSRLELDDSDDLTTSLWVDLVEPEEGERERVQNE
FT                   LGQSLATRPELDDIEASARFFEDEDGLHIHSFFYFEDAEDHAGNSTVAFTIRDGRLYTL
FT                   RERELPAFRLYRMRARNLTMVDGNAYELLLDLFETKIEQLADEIENVYSDLEKLSRVIM
FT                   EGHQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPTGQLEQAREVLRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWSFGYPGAISLMILAGLAPYLYFKRKNWL"
FT   gene            213334..214392
FT                   /locus_tag="Spro_0189"
FT   CDS_pept        213334..214392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0189"
FT                   /product="putative ammonia monooxygenase"
FT                   /note="PFAM: putative ammonia monooxygenase; KEGG:
FT                   eca:ECA4176 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39299"
FT                   /db_xref="GOA:A8G859"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:A8G859"
FT                   /protein_id="ABV39299.1"
FT                   /translation="MEKFPRLIQWSILLLASLVLGFGLQTFHIPAALLLGPMIVGVAMG
FT                   LLGATVRIPGYLFIAAQAVLGCMIAQSLSPAILTPLLDDWPLVLLVLIATLLASGISGW
FT                   CLVRFSGLPGPTGAWGSSPGGASAMVAMAGDFGADVRLVAFMQYLRVLFVATAAAMVAR
FT                   IGLGDEAGHGSAALEWFPSLDWRFPATLGVAMVGAWLGPRLRIPSGALLLPMIIGATLH
FT                   SSGTMALQIPEWLLALAYTLIGWSVGLRFTRPIFLLALRTLPQMVVSIVALMLFCGLLA
FT                   WMLTHFLPVDLMTAYLATSPGGLDTVAIIAAGSRVDMSFVMAMQTLRLFTILLTGPAMA
FT                   RFISNHATPAST"
FT   gene            complement(214401..215288)
FT                   /locus_tag="Spro_0190"
FT   CDS_pept        complement(214401..215288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0190"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   ypi:YpsIP31758_0215 RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39300"
FT                   /db_xref="GOA:A8G860"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A8G860"
FT                   /protein_id="ABV39300.1"
FT                   /translation="MDAQQTRQGIFFALAAYFIWGIAPAYFKLIQQVPADEILTHRVIW
FT                   SFFFMLALITLGRNWSQVRAACHDRKRLLLLAVTALLIGGNWLLFIWAVNNHHMLEASL
FT                   GYFINPLVNVLLGMLFLGERFRRMQWLAVALAFAGVLIQLWQFGSLPIIGLGLAFSFAF
FT                   YGLLRKKIAIDAQTGMLIETLWLLPVAAAYLFLFADSPTSHLGANAWSLNLLLVAAGIV
FT                   TTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFLLAVTFYGETVGQDKLVTFGFIWAALL
FT                   LFILDALYTQRKLR"
FT   gene            complement(215353..215823)
FT                   /locus_tag="Spro_0191"
FT   CDS_pept        complement(215353..215823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0191"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ypi:YpsIP31758_0216 thioesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39301"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A8G861"
FT                   /protein_id="ABV39301.1"
FT                   /translation="MSTTPLTLEAARQKIGEIFVYHMPFNRELGLELRRFDDDYVELSF
FT                   TNQPKLVGNAAQKILHGGVIASVLDVAAGLACAGSVLMRLDPLIEEEVATRLSRMGTID
FT                   LRVDYLRPGRGEHFVAAASVLRSGNKVAVARVELHNHDGLHIASATATYLVG"
FT   gene            216024..216902
FT                   /locus_tag="Spro_0192"
FT   CDS_pept        216024..216902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0192"
FT                   /product="Phospholipase A(1)"
FT                   /EC_number="3.1.1.32"
FT                   /note="PFAM: phospholipase A1; KEGG: ypi:YpsIP31758_0217
FT                   phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39302"
FT                   /db_xref="GOA:A8G862"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A8G862"
FT                   /protein_id="ABV39302.1"
FT                   /translation="MRILSGFILATLAAAPLAQAEEAKEQQIHDKPAVRGSIIANMLQD
FT                   HDNPFTLYPYDTNYVLYTDTSNINKEAIQSYNWADNARKDEVKFQLSLAFPLWRGIAGD
FT                   NSVLGASYTQRSWWQLSNHSESSPFRETNYEPQVFLGWATDYSFAGWTLRDVEVGLNHQ
FT                   SNGRSDPTSRSWNRGYARFMAQNGNWQVDLKPWFRFSESDSSDDNPDITKYMGYYRLKV
FT                   GYAWGDSVFSVDSHYNWNSGYGGAELGWSYPISKHVRFYTQVFSGYGESLIDYNFRQTR
FT                   VGVGVMLNDIM"
FT   sig_peptide     216024..216086
FT                   /locus_tag="Spro_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            216939..218783
FT                   /locus_tag="Spro_0193"
FT   CDS_pept        216939..218783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0193"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: ypi:YpsIP31758_0218 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39303"
FT                   /db_xref="GOA:A8G863"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G863"
FT                   /protein_id="ABV39303.1"
FT                   /translation="MGKCVSTAAVINKELLAEQVLRDTFGYQQFRPGQQTIINTAIGGQ
FT                   DCLVVMPTGGGKSLCYQIPALVMDGLTLVVSPLISLMKDQVDQLLAYGVAAACYNSTQT
FT                   REQQLEVMAGCRSGQIKMLYIAPERLMMDSFLDQLGGNPPALLAVDEAHCISQWGHDFR
FT                   PEYRALGLLKQRFPDMPVIALTATADESTRGDIVRLLALQDPLVQVSSFDRPNIRYTLV
FT                   EKFKPLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVGAYHAGLDNDRRAQ
FT                   VQEAFQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEA
FT                   ILLYDPADMAWLRRCLEEKPAGQQLDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGKHQ
FT                   NCGNCDICLDPPKRYDGLEDARKALSCVYRVGQRFGLGYIVEVLRGSNNQRIREYGHEK
FT                   LPVYGIGREQTTEHWTSVLRQLIHLGFITQNIAMHSALQLTEAARPVLRGELELQLAVP
FT                   RIQSLKARSSSNQKSYGGNYDRKLFAKLRKLRKSIADEENIPPYVVFNDATLLEMAEQM
FT                   PIKAGDLLSVNGVGQRKLERFGAPFMAMIRDHLDNDED"
FT   gene            218796..219422
FT                   /locus_tag="Spro_0194"
FT   CDS_pept        218796..219422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0194"
FT                   /product="homoserine/threonine efflux pump"
FT                   /note="TIGRFAM: homoserine/threonine efflux pump; PFAM:
FT                   Lysine exporter protein (LYSE/YGGA); KEGG: yen:YE0205
FT                   threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39304"
FT                   /db_xref="GOA:A8G864"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A8G864"
FT                   /protein_id="ABV39304.1"
FT                   /translation="MLMLFLTVALVHLIALMSPGPDFFFVSQTAASRSRREAMMGVLGI
FT                   SLGIVVWAGVALMGLHLILQKMAWLHQIIMVGGGIYLCWMGWQLLRSARSQNAQSVPAA
FT                   EMKVALPKPGRSFIRGFLTNLSNPKAVIYFGSVFSLFVGDDVGAGARWGLFLLIIAETF
FT                   VWFSLVAVVFALPTMRRGYQRLAKWIDGLAGVLFTGFGLHLIFTR"
FT   gene            complement(219475..220095)
FT                   /locus_tag="Spro_0195"
FT   CDS_pept        complement(219475..220095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0195"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   eca:ECA4170 homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39305"
FT                   /db_xref="GOA:A8G865"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A8G865"
FT                   /protein_id="ABV39305.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTGISHGYRGAAASIAG
FT                   LQVGLSLHIVLVGIGLGALVSQSLLAFEMLKWFGAAYLVWLGIQQWRAAGSLDLHTLAG
FT                   TMPRRRLFRRAVLVNLTNPKSIVFLAALFPQFILPNQPQAEQYLVLGITTVVVDIFVMI
FT                   GYATLATRIAGWLKTPRQMQLLNRIFGSLFILVAGLLATARKA"
FT   sig_peptide     complement(220021..220095)
FT                   /locus_tag="Spro_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.563 at
FT                   residue 25"
FT   gene            220238..221275
FT                   /locus_tag="Spro_0196"
FT   CDS_pept        220238..221275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0196"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: yen:YE0207
FT                   putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39306"
FT                   /db_xref="GOA:A8G866"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G866"
FT                   /protein_id="ABV39306.1"
FT                   /translation="MTSFTLSTDDWLTREKQFAAFATGPLLDFWRQREEGEFSGVGGVP
FT                   IRFVRFSSSRHQRVVVVSPGRIESYIKYPEVAYDLFHCGYDVMILDHRGQGRSGRLLTD
FT                   MHRGHVINFADYVDDFAQFYQQEVVPRGYRQRFALAHSMGGAILAQFLARQPQAFDAAA
FT                   FCAPMFGIYLPMPGWMANRILNWTEKHPKVRDYYAIGTGQWRPLPYVVNVLTHSRERYR
FT                   RCLRYYADYPELQVGGPTYHWVRESLQAGREIIAQAAKITTPLLLLQAGEDRVVDNRSH
FT                   QAFCQALSEAGHPCEGGKPQVIEGARHEILFERDAMRAEALSAILRFFAHHLGGTPTAD
FT                   HTIRG"
FT   gene            221287..222087
FT                   /locus_tag="Spro_0197"
FT   CDS_pept        221287..222087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0197"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: yen:YE0208 putative haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39307"
FT                   /db_xref="GOA:A8G867"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8G867"
FT                   /protein_id="ABV39307.1"
FT                   /translation="MYHVVASDLDGTLLSPDHTLSPYAKETLKLLTQRGVHFVFATGRH
FT                   HIDVAQIRDNLEISAFMITSNGARVHNTDGELIFSHNLAEDIARDLYGMLHNDPDITTN
FT                   VYRNDDWFINRESPEQKEFFQESVFQYQLFEPGLLETDGVCKVYFTCDDHEKLLPLEDA
FT                   INARWGDRVNVSFSFPTCLEVMAGGVSKGHALEEVAKIIGYTLKECIAFGDGMNDLEML
FT                   SMAGKGCIMRDAHQRLKDKLPELEVIGSNVDDAVPHYLRKMFLG"
FT   gene            complement(222123..223202)
FT                   /locus_tag="Spro_0198"
FT   CDS_pept        complement(222123..223202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0198"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: yen:YE0209 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39308"
FT                   /db_xref="GOA:A8G868"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8G868"
FT                   /protein_id="ABV39308.1"
FT                   /translation="MRTQVKALLTGIILATSMVSAAQAADKVVIAHRGASGYLPEHTLP
FT                   AKAMAYAQGADFLEQDLVMTKDNELVVLHDHYLDRVTDVAERFPDRARKDGRYYAIDFT
FT                   LPEIKSLKFTEGFEIENGKKVQGYPGRFPMGKSDFRVHTFQEEIEFVQGLNHSTGKNIG
FT                   IYPEIKAPWFHKQEGKDISSKVLAVLKQYGYTGKGDNVYLQCFDANELKRIKTELEPKM
FT                   GMDLKLIQLIAYNKWQETYEQKADGKWVEYDYDWMFKPGAMKQIAQYADGIGPDYHMLV
FT                   VAEKSKPGKVVLTDMVKEAHANKLAVHPFTIRADALPDYVTNVNQLYDVIYNQAGVDGV
FT                   FTDFPDKGVQFLQKQGQHK"
FT   sig_peptide     complement(223128..223202)
FT                   /locus_tag="Spro_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 25"
FT   gene            complement(223278..224633)
FT                   /locus_tag="Spro_0199"
FT   CDS_pept        complement(223278..224633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0199"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="TIGRFAM: phosphoglycerate transporter;
FT                   glycerol-3-phosphate transporter; PFAM: major facilitator
FT                   superfamily MFS_1; KEGG: yen:YE0210 glycerol-3-phosphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39309"
FT                   /db_xref="GOA:A8G869"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G869"
FT                   /protein_id="ABV39309.1"
FT                   /translation="MLSIFKPAAHISRVPVDKVDPLYRKLRWQIFMGIFFGYAAYYLVR
FT                   KNFTLAMPYLIDQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGSIVSVWNC
FT                   AHNVGGGLPPLLFLLGMAWFNDWHAALYMPAFGAILVALIAFALMRDTPQSCGLPPIEE
FT                   YKNDYPDDYSEKAEEELTAKQIFMQYILPNKLLWYIAVANVFVYLLRYGILDWSPTYLK
FT                   EVKHFTLDKSSWAYFLYEYAGIPGTLLCGWMSDKVFKGNRGATGVFFMTLVTIATVVYW
FT                   LNPVGNPGIDMACMITIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDYFGWDGGFMVMIGGSVGAVVLLLLTMLSEKKHHAEIAANKRG"
FT   gene            224999..226642
FT                   /locus_tag="Spro_0200"
FT   CDS_pept        224999..226642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0200"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: yen:YE0212
FT                   anaerobic glycerol-3-phosphate dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39310"
FT                   /db_xref="GOA:A8G870"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A8G870"
FT                   /protein_id="ABV39310.1"
FT                   /translation="MSSHSPDNETDVIIIGGGATGAGIARDCARRGLRCILLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDGESARECIEENQILKRIAHHCIERTDGLFITLPQDSLAY
FT                   QQQFIASCHSAGINAEAIDPQLALRLEPAANPALIGAVRVPDGTVDPFRLTAANMLDAR
FT                   EHGAQILTYHQVVGLLRAGDRVTGVRVFDHQSAQRYDIHAEVVVNAAGIWGQQIAEYAD
FT                   LRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISVIGTTSTHIDYDQIDN
FT                   MLVTPQEVDILIREGALLAPELAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHA
FT                   SRDGLEGFITITGGKLMTYRLMAQWATDKVCEKLGIDSPCTTAQEALPGSRQSAEETVR
FT                   SVVSLPASIRGSAVYRHGDRASQVPAGDRLDNSLVCECEAVTAGEVRYAVNSLTVNNLV
FT                   DLRRRTRVGMGTCQGELCACRAAGLLTRFNVTTPQQSIDQLSHFLNERWKGVRPIAWGD
FT                   ALRESEFTSWVYQGLCGLDARGEQEADDAI"
FT   gene            226629..227903
FT                   /locus_tag="Spro_0201"
FT   CDS_pept        226629..227903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0201"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /EC_number="1.1.5.3"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: yen:YE0213 putative anaerobic
FT                   glycerol-3-phosphate dehydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39311"
FT                   /db_xref="GOA:A8G871"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8G871"
FT                   /protein_id="ABV39311.1"
FT                   /translation="MMRFDVVVIGGGLAGMSCAIRLAEQGKRCAVVSSGQSALYFSSGS
FT                   LDLLAQLPDGTLVESPLMALPALELQAPRHPYALIGAERVAALSDDAALLLQRCGLSLQ
FT                   GSNERNHLRVTPLGTRRATWLSPQAIPVTPLDGELPWKNIAVIGIEGFLDFQPQLAASS
FT                   LVQTLGIKAEVAYMHLPALDRLRNNPSEFRAVNIARVLDLPENLTPMAEEMRRLAGDAE
FT                   AIFLPACLGLEDDSALAALRAAVGKPILLLPTLPPSVLGMRLHQALRSRLQQLGGVFMP
FT                   GDSVLRADIEAGRITGLYTRNHTDIPLLAQQVVLASGSFFSNGLVAGFDGIREPVFGLD
FT                   VDSRADRADWSDRNLFAPQPYLQFGVRTDNRLRALRQGEPLSNLYAIGAVTGGYDPLQQ
FT                   GCGAGVSLIGALYVAQQIAAQEERP"
FT   sig_peptide     226629..226700
FT                   /locus_tag="Spro_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.662 at
FT                   residue 24"
FT   gene            227900..229099
FT                   /locus_tag="Spro_0202"
FT   CDS_pept        227900..229099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0202"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: yen:YE0214
FT                   anaerobic glycerol-3-phosphate dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39312"
FT                   /db_xref="GOA:A8G872"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8G872"
FT                   /protein_id="ABV39312.1"
FT                   /translation="MSLHKDNSFENCIKCTVCTTYCPVAKVNPLYPGPKQAGPDGERLR
FT                   LKDPALYDEALKYCTNCKRCEVACPSDVKIGDIIQRARADFAQSKPTLRDAILSHTDLM
FT                   GSLSTPFAPIVNAATGLKPVRALLDKALKIDHRRELPKYSFGTFRRWYRQQAQAQRRYA
FT                   EQVAFFHGCFVNYNHPQLGKDLIKVFNAMDIGVQLLKREKCCGVPLIANGFIAQARKQA
FT                   KVNAESLHETVLERGIPVVATSSSCTFTLRDEYPHLLDVDTSAVRERVELATRYLYRLI
FT                   NQGRQLPLKHTPLRVAYHTPCHMEKMGWTAYTLELLRQIPGLELVVLDSQCCGIAGTYG
FT                   FKSENYETSQGIGASLFRQIEESGVDLVVTDCETCKWQIEMSTSKRCEHPITLLAQALA
FT                   "
FT   gene            complement(229135..229698)
FT                   /locus_tag="Spro_0203"
FT   CDS_pept        complement(229135..229698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0203"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: eca:ECA4355 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39313"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A8G873"
FT                   /protein_id="ABV39313.1"
FT                   /translation="MRKVAKLMGISLLVLGLAACDGETKDTKASAGDAAASAPAGQQVS
FT                   LLDGKLAFTLPAGMADQSGKLGNQANNMHVYADSTGQRALIVILGDKTADSLETLSKRL
FT                   EDTQRSRDANLQVITNKAIDVNGVPLRQLDSIITSGGEKAYSSILIGTLDNNMLTIQVT
FT                   LPADNQQQAQSEAEGIIKTLKLKQ"
FT   sig_peptide     complement(229630..229698)
FT                   /locus_tag="Spro_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.588 at
FT                   residue 23"
FT   gene            complement(229834..230499)
FT                   /locus_tag="Spro_0204"
FT   CDS_pept        complement(229834..230499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0204"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   yen:YE0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39314"
FT                   /db_xref="GOA:A8G874"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A8G874"
FT                   /protein_id="ABV39314.1"
FT                   /translation="MYSFTARQRLTALVWLSLFHIVIITSSNYLVQLPMSIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALFISYVISTVTYQGEWQGFAALGSF
FT                   NLFVARIAVASFMAYVLGQILDVHVFNRLRQRSAWWVAPAAAMFLGNISDTLSFFFIAF
FT                   YKSSDAFMANNWVEIALVDYSFKVLICLLFFLPMYGVLLNMLLKRIAARQNDGSLQPG"
FT   gene            230845..231090
FT                   /locus_tag="Spro_0205"
FT   CDS_pept        230845..231090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0205"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ypi:YpsIP31758_0232
FT                   sulfurtransferase TusA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39315"
FT                   /db_xref="GOA:A8G875"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G875"
FT                   /protein_id="ABV39315.1"
FT                   /translation="MTDLFAQADQTLDALGLRCPEPVMMVRKTVRHMDNGETLLIIADD
FT                   PATTRDIPGFCRFMEHTLVAQETDTAPYRYLLRKGV"
FT   gene            complement(231066..232232)
FT                   /locus_tag="Spro_0206"
FT   CDS_pept        complement(231066..232232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu0508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39316"
FT                   /db_xref="InterPro:IPR025130"
FT                   /db_xref="UniProtKB/TrEMBL:A8G876"
FT                   /protein_id="ABV39316.1"
FT                   /translation="MRSVALLFFLLLPLSLPAKPLETLITSQPTGESQIVWPVAAPLPP
FT                   PGGLRPCCAFGYNLKAQAWGIPVPFYQLGNLVDADRLGTHHYNDSAFNAISNLLGIGSE
FT                   QLGLIYTHRGGFIDIAHVRDTADNTLFLFSQLLPRLGQQWHIDLSPELATRRIQFNAFS
FT                   PPQDAAQRYTLAAYLAGEIAFQMAAWHEIAQWYGYRSVPGFSEEVSAFSPEDLYSNLLG
FT                   ARLAIDAILQGQAVSLTAYNSAMERLLPQALHQLGAVSIAATQRQFDGIDGDWWDSHRR
FT                   VPEKFLVLKRDYATGSNRLPALPPFEKTAPQRLTLPLQLQGFSLASLGELQLWPTDDMR
FT                   HLPAPAHYYRPQDFNGLALHARAADAQQILQNARQTGGDKRQTPLRNK"
FT   gene            complement(232232..233368)
FT                   /locus_tag="Spro_0207"
FT   CDS_pept        complement(232232..233368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39317"
FT                   /db_xref="GOA:A8G877"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A8G877"
FT                   /protein_id="ABV39317.1"
FT                   /translation="MAIFTRSLPLALLVLLPGVDAALLSRQQVDEMLAPLGSDNRFDSS
FT                   KAIDWGVLPGPFYTPELGLGLGTAIVGIYRPDSHDNVSQNSTLALKGFVSSTGAFGVGF
FT                   QNHSFFADDQWRFFADGSLNNMPTYFWGTGYQAGHNEGNKEKYTQQSFQIAPQLLYRIA
FT                   SATYAGVGWDFSSTHASDPDEGDNSLLRAQNAGVSSLSSGISGSLSYDTRDFVSNASRG
FT                   QFFRLSDTYFAPELGGDSRFNAVEGQYNAYHSLSAKSVLALDAFSRLTTGEVPWDRLSE
FT                   LGDDQRMRGYYQGRYRDRNVFSSQVEYRRKLNWRHGYVLWAGAGTLSSKAGDLGRGPWL
FT                   PTLGAGYRFEFKPKMNVRLDFGVGRGSSGFYFQVGEAF"
FT   sig_peptide     complement(233303..233368)
FT                   /locus_tag="Spro_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.870 at
FT                   residue 22"
FT   gene            complement(233368..234438)
FT                   /locus_tag="Spro_0208"
FT   CDS_pept        complement(233368..234438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stt:t3689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39318"
FT                   /db_xref="UniProtKB/TrEMBL:A8G878"
FT                   /protein_id="ABV39318.1"
FT                   /translation="MKNFNYTYLLFVPMTLLSPLSFAQQPETDSTQQLIDQAQRPPFTQ
FT                   GVLPAASHTPVTAEKSQPQPEHRLLPIWGDEARARGYDLPEPFGIGVNYMNMRQNIEVD
FT                   SINFTGLGWDTFNLPSNLFKIDVGKTREQSKTETMRLDTWVLPFLNVYGIVGHTKGSSL
FT                   SQVSVDADPSQHSEMMEKIIANVVHGMNKQGTLRDLDFKLDFKGTTYGAGATIVGGYDN
FT                   WFASVDTNYTRTSFDILDGQISALTVSPRVGYRFLVPGIRGQSHLNLWVGTMYQDVQQE
FT                   FKGSLSDLRMPAELQSLMALANQKGEGRFEVKQHLQSPWNVLVGTQYEITRNFNVLTEF
FT                   GFSQRNSFMVSGEYRF"
FT   sig_peptide     complement(234367..234438)
FT                   /locus_tag="Spro_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(234592..236907)
FT                   /locus_tag="Spro_0209"
FT   CDS_pept        complement(234592..236907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0209"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: yen:YE0218 putative P-type
FT                   cation-translocating membrane ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39319"
FT                   /db_xref="GOA:A8G879"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8G879"
FT                   /protein_id="ABV39319.1"
FT                   /translation="MTNHEKHNHQEHHHAEGGCGCNHSHSKTQHGCSSEKQSADSHSGH
FT                   AHTHDHGAGGCNTDGHEDPDEESDRLAAAPLSGSRRYSWKVTGMDCPSCAKKIENAVTA
FT                   LPGVDNARVLFATEKLVVDAQSDISLRIQDAVKQAGFTLLGTQTSQADQPKTSRLGEFG
FT                   PLLLLTTLMIVSWALSMVNPELSRIAFIATTLVGLAPVATKAVRLIRSGTPFAIETLMS
FT                   VAAIGALFIGATAEAAMVLLLFMVGEMLESYAANRARRGVKALMELVPEDALLLQGMER
FT                   KRVPVASLRPGDVIEIAPGGRLPADAELLNPFASFDESALTGESVPVERQQGQKVAAGS
FT                   LSVDQAAQMKVISEPGKNAIDRILQLIEEAEERRAPIERFLDRFSRYYTPAIMLLAIAV
FT                   ILVPPLLYAQPWDVWIYRGLTLLLIGCPCALVISTPAAITSGLAAATRRGALIKGGAAL
FT                   EQLGQVQTIAFDKTGTLTEGKPTVTDVLPLNGISEQQLLTLAAAVEAGSHHPLAQAIIN
FT                   RAEQYGAPLPLAQGRRALAGVGVEGVIDGKTLLISAPAKLAAGLLSQQGSQQVEQLENA
FT                   GKTAVVVLEDGVPIGLLALRDTLRSDAKQAIAELKALGINGVMLTGDNPRAAAAIATEL
FT                   GLDYRAGLLPEDKVRAVTELSELRPTAMIGDGINDAPAMKASSIGIAMGSGTDVALETA
FT                   DAALTHNRLVGVAEMIRISRATHANIRQNITIALGLKGVFLITTLLGLTGLWLAVLADS
FT                   GATALVTANALRLLKKRQ"
FT   gene            237472..238986
FT                   /locus_tag="Spro_0210"
FT   CDS_pept        237472..238986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0210"
FT                   /product="Serralysin"
FT                   /EC_number="3.4.24.40"
FT                   /note="KEGG: eca:ECA2785 metalloprotease; PFAM:
FT                   Hemolysin-type calcium-binding region; peptidase M10A and
FT                   M12B matrixin and adamalysin; Peptidase M10 serralysin;
FT                   SMART: peptidase metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39320"
FT                   /db_xref="GOA:A8G880"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR016294"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034033"
FT                   /db_xref="UniProtKB/TrEMBL:A8G880"
FT                   /protein_id="ABV39320.1"
FT                   /translation="MSICLIDNDQLMSGIEPMQSTKKAIEVTESSLAATGSGYNAVDDL
FT                   LHYHERGNGIQVNGKDSFSNEQAGLFITRENQTWNGYKVFGQPAKLTFSFPDYKFSSTN
FT                   VAGDTGLSKFSAEQQQQAKLSLQSWSDVANLTFTEVAAGQKANITFGNYSQDRPGHYDY
FT                   GTQAYAFLPNTIYQGQDLGGQTWYNVNQSNVKHPASEDYGRQTFTHEIGHALGLSHPGE
FT                   YNAGEGNPTYNDVTYAEDTREFSLMSYWSETNTGGDNGGHYAAAPLLDDIAAIQHLYGA
FT                   NLSTRTGDSVYGFNSNTGRDFLSTTSNSQKVIFAAWDAGGNDTFDFSGYTANQRINLNE
FT                   TSFSDVGGLKGNVSIAAGVTIENAIGGSGNDVIVGNAVNNVLKGGAGNDVLFGGGGADE
FT                   LWGGAGKDIFVFSAVSDSAPGASDVIKDFQKGTDKIDLSFFNQGKQSGDQIHFVDHFSG
FT                   SVGEALLTYNASNNVSDLALNIGGHQTPDFLVKIVGQVDVTTDFIV"
FT   gene            239102..239416
FT                   /locus_tag="Spro_0211"
FT   CDS_pept        239102..239416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0211"
FT                   /product="metalloprotease inhibitor I38"
FT                   /note="PFAM: metalloprotease inhibitor I38; KEGG:
FT                   pap:PSPA7_4142 alkaline proteinase inhibitor AprI"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39321"
FT                   /db_xref="GOA:A8G881"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="InterPro:IPR022815"
FT                   /db_xref="UniProtKB/TrEMBL:A8G881"
FT                   /protein_id="ABV39321.1"
FT                   /translation="MASSLVLPSAQSLAGQWQVADAQQQCQIEFLASEQSATNGYPLID
FT                   RQNCLKKVLTAEVVGWRPAPDGIALLQADGSTLAFFSRDGDVYRNQPGADGGLTLKALA
FT                   "
FT   gene            complement(239454..240080)
FT                   /locus_tag="Spro_0212"
FT   CDS_pept        complement(239454..240080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0212"
FT                   /product="YhhN family protein"
FT                   /note="PFAM: YhhN family protein; KEGG: yen:YE0219
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39322"
FT                   /db_xref="GOA:A8G882"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A8G882"
FT                   /protein_id="ABV39322.1"
FT                   /translation="MSWPFLAVFFSGWLFVDASYRGPRWQRWVFKPVTLLLLLLLAWQA
FT                   PVLGAAGYLIVLGLLATLLGDALLLLPRERVLYAIGAFFLSSLLYTLSFASQMTFSLFW
FT                   PLPLALLVIGVLLLATIWTRLEEMRWPIATLVAMTLLMVWLAGEQYFMRSTDFGFSLLA
FT                   GTSLLLLANVIWLLNRYRFSFRAADALVAFCYFSGHFLIVRSLYL"
FT   gene            complement(240272..241024)
FT                   /locus_tag="Spro_0213"
FT   CDS_pept        complement(240272..241024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0213"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39323"
FT                   /db_xref="GOA:A8G883"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G883"
FT                   /protein_id="ABV39323.1"
FT                   /translation="MRLTINDHIGYFPPFNWQEIYDTTRQNSLPNVVLGQCPNVGSTVL
FT                   LEPQHHEHAVNWLPLLWQLVILKSCRPDLKLALSAPFSAPNWHRLLAALGITPLEGNVT
FT                   PSPPTPQLTLTESQVLLTLLDGTHTQQLASRLNRDIRTVSSHKKRAMDKVGLRHNGELY
FT                   ALGALLYDREYTMPAVFLPPAEQRVLASLLHNGSVTATARLLGKSVKTVSGQKLNIMRR
FT                   FGVPHEVALFAVAVTQQGTTGNFYRVLP"
FT   gene            complement(241085..242242)
FT                   /locus_tag="Spro_0214"
FT   CDS_pept        complement(241085..242242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0214"
FT                   /product="CblD family pilus biogenesis initiator protein"
FT                   /note="PFAM: CblD family pilus biogenesis initiator
FT                   protein; KEGG: stt:t2547 putative fimbrail protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39324"
FT                   /db_xref="InterPro:IPR010888"
FT                   /db_xref="UniProtKB/TrEMBL:A8G884"
FT                   /protein_id="ABV39324.1"
FT                   /translation="MKAMLNRTVKKIIAHGLLPLLAMVSLPAQAARVPPADNHQVINLS
FT                   YDKSTPLADSYIWRRASGGYDTDNGPLWGRNTWLCQSQSNSLEGACSTEARWVYDSWKT
FT                   TAITLTFTEQRSNLSTQLRLTAYMEATRASDLCTSYAALTPLDAAPHRSCEDGTIFSEK
FT                   AITAYLPQTELAKLPVGGIWKARLVLNEMQWSPYIKVATFSADITLDVTDKNNGAIYLP
FT                   AFGSATPRVDLNLRTQPLSTAPGGEVSGQANIDMCLYDGYNSNSPWLKVALSDLQTVAG
FT                   RPADVFSLRRDGSSGTAAADRVDYRITLNYNNQPQTVNNGQDITLASVNSTLIRPVVLP
FT                   GIAFPVICTPTPLTLNVLPFAKLSKAAGHFSGTLRVTLSADALAP"
FT   sig_peptide     complement(242150..242242)
FT                   /locus_tag="Spro_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(242263..244890)
FT                   /locus_tag="Spro_0215"
FT   CDS_pept        complement(242263..244890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0215"
FT                   /product="outermembrane fimbrial usher protein"
FT                   /note="KEGG: spt:SPA2453 outermembrane fimbrial usher
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39325"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="InterPro:IPR035224"
FT                   /db_xref="UniProtKB/TrEMBL:A8G885"
FT                   /protein_id="ABV39325.1"
FT                   /translation="MNTRYRPLYLPLLLACQATAAPQVPPGFESLLLGQTEQLEVRLPG
FT                   HSLGLFAVEVKPDTLTFEAPEALLAASGLQTLPEAQKQQALQALSQPLLRHGNLACNGS
FT                   QTPGCGYVATDSAAAILDESQGAVLLFLKPDWLTTLKQDQRWLRPTPAAKNAFIHRQTA
FT                   NYSGDRDSQNLALNGTGALGLGERRYLGGNWAYTWNRVRDDNASRFWFDNLYARQDMGN
FT                   RYYLQAGRMDQRNLSSPLGGNFAFTLLPLTRFDGLRIGTTEAYVNHSINRDATPVMIQV
FT                   NRNARVDIYRGAQLLGSQYFAPGMHTLNSDSFPPGSYPLELRVYEDGVLQRKESQPFSK
FT                   GGGTFSDQWQWFLQGGKASAERATSQQSTAQGTQAAGVQMALWRNLQLTSGLAKTQNTT
FT                   YNETRLDAQHAFSFGVLSLAASGLTGSNGARGDSQQVSFADGFSASLYRYRVGGAGCDQ
FT                   TGNANNDIGCYTTLNGSLSVPLAGWSATLGYSDTKNNGRRNSRSASTDNLLPPPTLRSA
FT                   DQRNRAWQLGLARAFNWSGTTINTRLGTFRNSNGQTTDNGVYLGFTLSRVDNAAKSGGS
FT                   DSYSSAGIDWRNGSGQSQTSYNLNHTRMWQQDTYRELALNFSGYNDDSYSGNLGGRANG
FT                   RYGDLTGTLSDSQRRGGGSRTALTGGYSSAFALAGDGLFWGGNGGGEPAAGLAVRVAPA
FT                   EENGAAAQISGGSYRPLTLGFGQSTLLPLDGYQLSNVTVQDIAGTSDGGVANVTGGAGE
FT                   GRYFLPPGRLLVRDVRANITWVYIGQAIGPEGRALANAQVLNQALPALGADGGFTLQTQ
FT                   QKVPALWLISDGQLLRCPLQVKTVRDILQVVGETRCTVSGPEGLPQSLRMTPRVMKLLA
FT                   TAKR"
FT   sig_peptide     complement(244828..244890)
FT                   /locus_tag="Spro_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.991 at
FT                   residue 21"
FT   gene            complement(244975..245508)
FT                   /locus_tag="Spro_0216"
FT   CDS_pept        complement(244975..245508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0216"
FT                   /product="CS1 type fimbrial major subunit"
FT                   /note="PFAM: CS1 type fimbrial major subunit; KEGG:
FT                   sec:SC0301 putative fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39326"
FT                   /db_xref="GOA:A8G886"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:A8G886"
FT                   /protein_id="ABV39326.1"
FT                   /translation="MKKSYAFAPIALAALFSLSAMAVQKDITVTADIDPTVELLQSDGT
FT                   ALPSSIKMTYLPGVGLQKQTLSTKIFTNDATKQVEMRLLATPSLTSITTPTAAAIPLTV
FT                   SYNGKALTTAVTKDSTLEPAVLFPNGRLDGGSVPFDLVIAQSTPGLVTTSGSYQGVVSL
FT                   VLNTSTVPVTPPAP"
FT   sig_peptide     complement(245440..245508)
FT                   /locus_tag="Spro_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(245518..246252)
FT                   /locus_tag="Spro_0217"
FT   CDS_pept        complement(245518..246252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0217"
FT                   /product="putative fimbrial protein"
FT                   /note="KEGG: stt:t2550 putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39327"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A8G887"
FT                   /protein_id="ABV39327.1"
FT                   /translation="MAKTNHPLTPSKLTGLAGVLMLISTCALANLTVYPISKDIGAGQT
FT                   ATTLQVFSKSPQTQYVRVNVKRILNPATPLEKEVEAESQQGLVVSPDKFVLPAGATRTV
FT                   RLITLVTPLREEAWRVYFEPVASLGDEDPDKSQKAQVNVNLVWGVLIRLLPAVAQPLLA
FT                   RSADGAQLLNQGNVRLGVLKVGLCSPVCRWQQIDRSVYPGEALMLPAGMSGGVVRVEYR
FT                   DSAATPVTADLPAGASTTKTMK"
FT   sig_peptide     complement(246163..246252)
FT                   /locus_tag="Spro_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            complement(246627..247202)
FT                   /locus_tag="Spro_0218"
FT   CDS_pept        complement(246627..247202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0218"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: stm:STM0716
FT                   putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39328"
FT                   /db_xref="GOA:A8G888"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8G888"
FT                   /protein_id="ABV39328.1"
FT                   /translation="MKKNVRKHLTRPEIERMLAAADSIPDPERNTCLLWMCFVHGCRVS
FT                   ELTGMHLADLDIAGDSLYVRRLKNGLSTMQPLHPMERKLLARWLQRRQSYPGAKDYDWL
FT                   FLSHKGGRLSRSRIYRILKDLGERAGLSIAVHPHMLRHACGYALADKGADTRLIQDYLG
FT                   HRNIQHTVLYTASNVGRFRALWGEENVT"
FT   gene            complement(247450..247722)
FT                   /locus_tag="Spro_0219"
FT   CDS_pept        complement(247450..247722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0219"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="PFAM: protein of unknown function DUF1145; KEGG:
FT                   yen:YE0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39329"
FT                   /db_xref="GOA:A8G889"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A8G889"
FT                   /protein_id="ABV39329.1"
FT                   /translation="MLINLGRLLMLCVWGFLLSNLFHPFPKPLKYFIDVALFFMVVMHG
FT                   LQLVLLKSTQPKDQPISYWQEAKIFIFGVFELLAWQKKQPPIKRK"
FT   gene            complement(247712..248332)
FT                   /locus_tag="Spro_0220"
FT   CDS_pept        complement(247712..248332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0220"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein; KEGG: ypi:YpsIP31758_0238 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39330"
FT                   /db_xref="GOA:A8G890"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A8G890"
FT                   /protein_id="ABV39330.1"
FT                   /translation="MTRISPRASAKKPPQAAAGQIRIIGGQWRGRKLPVPNSPGLRPTT
FT                   DRVRETLFNWLAPVIQGARCLDCFAGSGALGLEALSRYAGSVTLLEFERPVAQQLEKNL
FT                   ALLQGKGHVVNTNALSWLANNAQPFDVVFLDPPFRKGLLAETVTLLEQQGWLADEAWIY
FT                   VEAEAESAATDVPANWQLHREKVAGQVAYRLYIRSQEKTDNAD"
FT   gene            248556..250163
FT                   /locus_tag="Spro_0221"
FT   CDS_pept        248556..250163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0221"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: yen:YE0225 cell division protein; TIGRFAM:
FT                   signal recognition particle-docking protein FtsY; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39331"
FT                   /db_xref="GOA:A8G891"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A8G891"
FT                   /protein_id="ABV39331.1"
FT                   /translation="MAKDKKRGFFSWLGFGQKEEEQQQPETAVEPAENQAVETPAEPVA
FT                   PKLDDQLPAQESEPAASVETPGEWDGSLTGEHIAESVPVVAEHSAAAQALAEEIVTLTE
FT                   QVAAEQQPVTEEDIAEPVAEVEPEPVVVIEPEAVVIPEPEWVEPEPVIEPEPEVIAPEP
FT                   VIEPEPEPEVIAPEPEPEPEPEPEPEPEPLPASVALEPIIVAPAIIEEQQPELLAPAVT
FT                   QEQERPTKEGFFARLKRSLVKTKQNLGSGFIGLFRGKKIDDDLFEELEEQLLIADVGVE
FT                   TTRKIITSLTQHASRKQLKDAEALYGKLKEEMSEILAKVDQPLDVGGKNPYVILMVGVN
FT                   GVGKTTTIGKLARQFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNRIPVIAQHTGADSA
FT                   SVIFDAVQAAKARGIDVLLADTAGRLQNKAHLMEELKKIVRVMKKLDDQAPHEVMLILD
FT                   ASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAIADQFAIPIRYIGVGEGIED
FT                   LRPFKADDFIEALFARED"
FT   gene            250169..250840
FT                   /locus_tag="Spro_0222"
FT   CDS_pept        250169..250840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0222"
FT                   /product="Type II (General) Secretory Pathway (IISP) Family
FT                   protein"
FT                   /note="KEGG: yen:YE0226 cell division ATP-binding protein;
FT                   TIGRFAM: cell division ATP-binding protein FtsE; Type II
FT                   (General) Secretory Pathway (IISP) Family protein; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39332"
FT                   /db_xref="GOA:A8G892"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G892"
FT                   /protein_id="ABV39332.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLRNSEVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPL
FT                   IIAGASTEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTGLIARRNYRTLRLSQGRMAGGAHHG
FT                   E"
FT   gene            250830..251783
FT                   /locus_tag="Spro_0223"
FT   CDS_pept        250830..251783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0223"
FT                   /product="putative protein insertion ABC transporter, inner
FT                   membrane subunit FtsX"
FT                   /note="TIGRFAM: putative protein insertion ABC transporter,
FT                   inner membrane subunit FtsX; PFAM: protein of unknown
FT                   function DUF214; KEGG: ypi:YpsIP31758_0241 putative protein
FT                   insertion permease FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39333"
FT                   /db_xref="GOA:A8G893"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A8G893"
FT                   /protein_id="ABV39333.1"
FT                   /translation="MANNAKTAKSKALRGGWREQWRYAWMNAIKDMLRQPLATLLTVMV
FT                   IAISLTLPSVCYIVWKNVSTAATQWYPTPQLTVYLDKSLDDDAAVKVLDAIKAEAGVEK
FT                   VNYLSREEARGEFRNWSGFGGALDMLEENPLPAVAIITPKMSFQSSDTLNTLRDRVAAV
FT                   QGVDEVRMDDSWFARLAALTGLVGQVAAMIGVLMIVAVFLVIGNSVRLSIFSRRDTINV
FT                   MKLIGATDGFILRPFLNGGAMLGFFGALLSLLLSGGMVWRLESVVTGVAKVFGTTFTLH
FT                   GLGWDEALLLLIVSAMIGWIAAWLATVQHLRRFTPQ"
FT   gene            252100..252957
FT                   /locus_tag="Spro_0224"
FT   CDS_pept        252100..252957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0224"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; KEGG: yen:YE0228
FT                   RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39334"
FT                   /db_xref="GOA:A8G894"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G894"
FT                   /protein_id="ABV39334.1"
FT                   /translation="MTKEMQTLALVPQGSLEAYIRAANTYPMLTAEEERELAERLHYQG
FT                   DLEAAKQLILSHLRFVAHIARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVARELGV
FT                   TSKDVREMESRMAAQDMTFDPTPDDDAREGQSMAPVLYLQDKSSDFAEGIEEDNWESNA
FT                   ADKLAYAMEGLDERSQHIIRARWLDDDNKSTLQELADQYGVSAERVRQLEKNAMKKLKM
FT                   AIEA"
FT   gene            complement(253017..255074)
FT                   /locus_tag="Spro_0225"
FT   CDS_pept        complement(253017..255074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39335"
FT                   /db_xref="UniProtKB/TrEMBL:A8G895"
FT                   /protein_id="ABV39335.1"
FT                   /translation="MSHLNARTLPLAALIGSALALPINGYACGPDFPNRLLVDRNGTLL
FT                   YMPEGNFAFEAGRLVAIDKQLPQWKAPPPPMPPKPMPLSPETIIIGKMRAAKTVEEADA
FT                   VNTQGLSDAARLYQLGAVAFAGQDPRAGEYFQQVLALPAAEQGDWGLRAQYSLGRLLMG
FT                   DHGTPENESGEPAATAKHPAKPQLEQALAAFQQVIERVKSGTADPDQLALSSLGQQARI
FT                   HLWLNDVTQAARLYAQQAAQGDQNGGLSLQYVSSYLVNPDHFDTLKQAITDPLIQQLVT
FT                   IELFARSSNLQMADTDGTGSRSTQIISQILTLLDASVKNGFSGSDRLAALAYRTGQYPM
FT                   AASLLKHAGDSGLAWWLRAKMALRDGDVKAATANYAKAAAAFPSSESWGEQRNADFVQE
FT                   TIVPECRVAGEQAILALDRGDYLQAMDFLYRGKEIYWADVADVAERVLTVDELKGFVDK
FT                   HAPAPTTPLKPVNPDEYSGQPLTPEVQLRELLARRLMRAGRPQEAMGYFDIPNYRQVAQ
FT                   QYADTLKTAQDKTADKLARAKAYYQAATLLRTQGLTFTGYEMTPDYAIYDAGYSYLGDA
FT                   FDTRELKHKSWISSAEAARAKAALPPQDNRFLHYRWQAVTLAQQAADLLPPKSQAYAAV
FT                   LCNAAGWVIKRDAKTGQALYQRYINTGSRYPWANKFGYSCPAPDFAAVTP"
FT   sig_peptide     complement(254991..255074)
FT                   /locus_tag="Spro_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.739 at
FT                   residue 28"
FT   gene            complement(255061..256278)
FT                   /locus_tag="Spro_0226"
FT   CDS_pept        complement(255061..256278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN2726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39336"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:A8G896"
FT                   /protein_id="ABV39336.1"
FT                   /translation="MKRGLMALLMLALAFIAWFGGRQQALQLQQAWDNQAYVWQRVWTP
FT                   QHAAALAQSRDLFSALRVLGLQVHPREGWREIPVNLPLLKQDGRPLWLVVRLDGQLAQL
FT                   NESAIRQRLLKQVQQWQAAGLQVIGVEIDHDAATARLPDYQHFLQQLRQQLPRSLQLGI
FT                   TALPTWIGSATLPGVLQQVDSSVLQVHAVLSPQQGLFSGPLALRWVKQYAKMTTKPFRV
FT                   ALPAYGMGLVGFDEQGAQVESEASLRVAGTSRELTVAPQQIADFLHQLNAQTTPHLRGI
FT                   IWFRLPLADDRRAWSLTTLRAVIENQPLSVNWLVKISPQPQQNGLNDLILHNNGLIDAP
FT                   LPHEIVITASDCLAADAAGNYRLESEPQRQRFVLISGDQLRAGQSRPLGWLRCQQLTPG
FT                   GTLVTP"
FT   sig_peptide     complement(256201..256278)
FT                   /locus_tag="Spro_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.812 at
FT                   residue 26"
FT   gene            complement(256275..256667)
FT                   /locus_tag="Spro_0227"
FT   CDS_pept        complement(256275..256667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0227"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yps:YPTB0225 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39337"
FT                   /db_xref="GOA:A8G897"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:A8G897"
FT                   /protein_id="ABV39337.1"
FT                   /translation="MKLTIERLTTLSPQDLIDLGKIWPHQQPEQWQSGLSGDKALFAAR
FT                   FNERLLGAVKIELNGKHAQLQDLLVREVTRRRGVGLYLVQDAQRQLPQITHWQLSTAGL
FT                   TARERGEVDNFMRACGFTQQGELWQQ"
FT   gene            257074..258189
FT                   /locus_tag="Spro_0228"
FT   CDS_pept        257074..258189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0228"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   yen:YE0230 branched-chain amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39338"
FT                   /db_xref="GOA:A8G898"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G898"
FT                   /protein_id="ABV39338.1"
FT                   /translation="MKLTKGKALLAGCIAMAIGHAAMAKDIKVAIVGAMSGPVAQYGDM
FT                   EFTGARQAIADINAKGGIKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLCSS
FT                   STQPASDIYEDEGVIMITPAATNADLTTRGYKMIMRTTGLDSDQGPTAAKYILSEIKPK
FT                   RIAVIHDKQQYGEGLARSVRDSLKKQGTDVVMFEGITAGDKDFSTLVARLKKENVDFVY
FT                   FGGYYPEMGQILRQAKQAGLTTRFMGPEGVGNSSLSNIAGAASEGMLVTLPKRYDQVPA
FT                   NKPVVDALKAKKLDPTGPFVWTTYAALQSLTTGMERSGSQEPADIVKDLKTGKPVDTVM
FT                   GPLSWDDKGDLKGFEFGVFEWHADGTSTPIK"
FT   sig_peptide     257074..257148
FT                   /locus_tag="Spro_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            258306..259232
FT                   /locus_tag="Spro_0229"
FT   CDS_pept        258306..259232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0229"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ypi:YpsIP31758_0245 high-affinity branched-chain amino acid
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39339"
FT                   /db_xref="GOA:A8G899"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A8G899"
FT                   /protein_id="ABV39339.1"
FT                   /translation="MSEQVLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMIGSYVSFIVIAALMMVGIDVSWLLIGAGFLVSIVIASAYGWSIERVAYKPVRNSKR
FT                   LIALISAIGMSIFLQNYVSLTQGSRDLALPSLVTGQWVLGESNGFAATITTMQLIIWVV
FT                   TFLAMLALTIFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGAVMAAVAGVL
FT                   LGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLVLGVAEALTSAYLSTEYKD
FT                   VVSFALLIVVLLIMPTGILGRPEVEKV"
FT   gene            259229..260512
FT                   /locus_tag="Spro_0230"
FT   CDS_pept        259229..260512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0230"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: yen:YE0232
FT                   high-affinity branched-chain amino acid transport system,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39340"
FT                   /db_xref="GOA:A8G8A0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A0"
FT                   /protein_id="ABV39340.1"
FT                   /translation="MKLNLLNALIATLVLFVMASFLMGMQLSLDGTKLVVHGAAEVRWM
FT                   WIGIGCVIVFFFQLLRPLMQQGLKKISGPSFVLPSFDGTTARQKLLAAAIIIAAVAWPF
FT                   LVSRGTVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYYGLGF
FT                   WESLPLAGIVTAIFGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGIS
FT                   QIPKPTFFGLEFNRSVRDGGWDTFHNFFGLKYDPSDRIVFLYLVALLLVVLTLFVINRL
FT                   LRMPLGRAWEALREDEIACRSLGLNPTKIKLTAFTISAAFAGFAGTLFAARQGFVSPES
FT                   FTFVESAFVLAIVVLGGMGSQFAVILAAILLVVSREMMRDLNEYSMLLLGALMVLMMIW
FT                   RPQGLLPMKRPQLKLKAADIHAGKGEQA"
FT   sig_peptide     259229..259303
FT                   /locus_tag="Spro_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.786 at
FT                   residue 25"
FT   gene            260509..261276
FT                   /locus_tag="Spro_0231"
FT   CDS_pept        260509..261276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0231"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE0233 high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39341"
FT                   /db_xref="GOA:A8G8A1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A1"
FT                   /protein_id="ABV39341.1"
FT                   /translation="MSMQPLLKVEGLSMRFGGLLAVNNVALELNEGEIVSLIGPNGAGK
FT                   TTVFNCLTGFYRPTGGTIKLRERHLEGLSGQNIARMGVVRTFQHVRLFREMTVIENLLV
FT                   AQHQHLKSGVFAGLLKTPAFRRAEADALERAAVWLQRVGLLEMANRSAGNLAYGQQRRL
FT                   EIARCMVTRPELLMLDEPAAGLNPKETDELDHLIVELRNQHKVSVLLIEHDMKLVMGIS
FT                   DRIYVVNQGTPLAQGTPAEIRNNPDVIRAYLGE"
FT   gene            261280..261981
FT                   /locus_tag="Spro_0232"
FT   CDS_pept        261280..261981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0232"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE0234 high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39342"
FT                   /db_xref="GOA:A8G8A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A2"
FT                   /protein_id="ABV39342.1"
FT                   /translation="MLSFNQVSAHYGKIQALHQVSLNIKQGEIVTLIGANGAGKTTLLG
FT                   TLCGEPRASEGSITFLDQDITQWQTSRIMREAVAIVPEGRRVFSRMTVEENLAMGGFFA
FT                   DRQQYQQRIERVFGLFPRLLERRAQRSGTMSGGEQQMLAIGRALMSQPKLLLLDEPSLG
FT                   LAPIIIQQIFDIIEQLREEGMTIFLVEQNANQALKLADRGYVLENGRVVLEDTGAALLA
FT                   NEAVRSAYLGG"
FT   gene            262024..263211
FT                   /locus_tag="Spro_0233"
FT   CDS_pept        262024..263211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0233"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4336 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39343"
FT                   /db_xref="GOA:A8G8A3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A3"
FT                   /protein_id="ABV39343.1"
FT                   /translation="MNREGLLAQRIVKVKSSAIRELLKHSKMENVISLAGGIPSDALFD
FT                   FEGLSIATHQAITEQPKSAFQYGLTEGSPVLRERICELCAQRGVSATAEEVMVTAGSQQ
FT                   ALDLVMRAIVNPGDVFVVERPTYLAALQTLELAEANIMSVSSDSDGMVVEELAELLKTQ
FT                   RIKGVYVVPNFGNPSGITLSAPRRELLVKLAAEHNFLIIEDDPYGELRFTEERNATLHQ
FT                   ISQQVLGHTDNIIYTSTFSKILAPGLRLGWAILPEFLLHKVAIIKQAADLHASALSQSI
FT                   VECYLGLDRLPAQIEKIRAAYKHKGEILAGLVEQELGDHISFDMPKGGMFLWARFRQPF
FT                   NATEWLKTTLQQGVVFVPGEYFFSDNPDRSTFRLSFATATEQQMQEAVARLRRSL"
FT   gene            263403..264722
FT                   /locus_tag="Spro_0234"
FT   CDS_pept        263403..264722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0234"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: yen:YE0241 glycerol-3-phosphate-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39344"
FT                   /db_xref="GOA:A8G8A4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A4"
FT                   /protein_id="ABV39344.1"
FT                   /translation="MLTYAIRKTTLCVALTLAVSTQALAATEIPFWHSMEGELGKEVDS
FT                   LADRFNQSHTDVKIVPVYKGNYEQSLAAGIAAYRSGKAPAILQVYEVGTATMMASKAIK
FT                   PVYEVFKDAGINFDESVFVPTVAGYYTDNKSGHLLSQPFNSSTPVLYYNKDAFKKAGLN
FT                   PDQPPKTWQELAADTAKLRAAGMKCGYASGWQGWIQLENFSAWHGVPFATENNGFGGAS
FT                   AKLEFNKPLQVKHIQLLEEMNKKGNFTYFGRKDESTEKFYSGDCAITTASSGSLADIKH
FT                   YAKFNYGVGMMPYDADAKNAPQNAIIGGASLWVMNGKDAATYKGVAEFLQYLAQPEIAA
FT                   EWHQKTGYLPITTAAYDLTKQQGFYDKNPGADVATRQMLNKPPLPFTKGLRLGNMPQIR
FT                   TVVDEELEGVWTGKKTPQQALDAAVQRGDVLLRRFESQTK"
FT   sig_peptide     263403..263480
FT                   /locus_tag="Spro_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            264837..265724
FT                   /locus_tag="Spro_0235"
FT   CDS_pept        264837..265724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0235"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: yen:YE0242
FT                   sn-glycerol-3-phosphate transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39345"
FT                   /db_xref="GOA:A8G8A5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A5"
FT                   /protein_id="ABV39345.1"
FT                   /translation="MSSSRPGFGCSWLPYVLVLPQLLITAIFFLWPAGEALWYSVQSLD
FT                   PFGLSSQFVGLDNFTQLFQDPYYLDSFYTTLIFSFLVAGIGLVVSLFFAALVDYVLRGS
FT                   RIYQTLMILPYAVAPAVAAVLWIFLFNPGLGLITHFLNGLGYNWNHAQNSGQAMFLVVL
FT                   ASVWQQISYNFLFFLAALQSIPRSLVEAAAIDGAGPVRRFFNLVLPLITPVSFFLLVVN
FT                   LVYAFFDTFPVIDAATGGGPVQSTTTLIYKIYREGFAGLDLSSSAAQSVILMLLVIGLT
FT                   VIQFRFVERKVRYQ"
FT   gene            265721..266566
FT                   /locus_tag="Spro_0236"
FT   CDS_pept        265721..266566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0236"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ypi:YpsIP31758_0258
FT                   glycerol-3-phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39346"
FT                   /db_xref="GOA:A8G8A6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A6"
FT                   /protein_id="ABV39346.1"
FT                   /translation="MIENRRGLDIFSHVMLIIGVLVVLFPLYVAFVAATLDDKQVFQVP
FT                   MTLIPGGHLWENISNIWQGGVGNLKVPFSLLLLNSVIMALAITCGKIVVSVLSAYAIVY
FT                   FRFPLRSLFFWLIFMTLMLPVEVRIFPTVEVISNLNLLDSYTGLTLPLMASATATFLLR
FT                   QFFMTLPDELLEAARIDGAGPMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILIT
FT                   SDASMGTAVAGIKSMISTSGAPTQWNQVMAAMILTLIPPLAVVLLMQRWFVRGLVDSEK
FT                   "
FT   gene            266571..267644
FT                   /locus_tag="Spro_0237"
FT   CDS_pept        266571..267644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0237"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: yen:YE0244
FT                   sn-glycerol-3-phosphate transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39347"
FT                   /db_xref="GOA:A8G8A7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A7"
FT                   /protein_id="ABV39347.1"
FT                   /translation="MAGLKLQAVTKSYDGKTPVIKQIDLDVADGEFIVMVGPSGCGKST
FT                   LLRMVAGLERTTSGDIYIDSQRVTDMEPKDRGIAMVFQNYALYPHMSVYDNMAYGLKIR
FT                   GFGKQHIQQRVEEAARILELEPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGTPSEV
FT                   YQRPASLFVASFIGSPAMNLLPGTLSADGSQLQLADGMTLNLPQAKAHWGGRRLTLGIR
FT                   PEHIQLLPDGQGGVPLVLQTLELLGADNLAHGQWGGHGVIARLSHETMPTAGSTLYLQL
FT                   PAQALHFFDTDSGLRME"
FT   gene            267641..268390
FT                   /locus_tag="Spro_0238"
FT   CDS_pept        267641..268390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0238"
FT                   /product="Glycerophosphodiester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: ypp:YPDSF_3409 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39348"
FT                   /db_xref="GOA:A8G8A8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A8"
FT                   /protein_id="ABV39348.1"
FT                   /translation="MMTTAWPYPHIVAHRGGGSLAPENTLAAIDVGARHGHKMIEFDAK
FT                   LAQDGQIFLLHDDTLDRTSNGWGVAGELPWDKLVQLDAGNWYNSAYKGERLPLLAEVAE
FT                   RCLQHGMMANIEIKPTTGSDDETGRVVALAARLLWQGQTDPLLSSFSVEALAAAQRTVP
FT                   ELPRGLLLDQWDDNWPALTERLGCVSLHINHKELTAERVAALKAAGLRILVYTVNQPAR
FT                   ARLLLNWGVDCICTDRIDLIGPDFPNG"
FT   gene            complement(268387..268716)
FT                   /locus_tag="Spro_0239"
FT   CDS_pept        complement(268387..268716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39349"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8A9"
FT                   /protein_id="ABV39349.1"
FT                   /translation="MKTYHLLYGLLLLSGLATAANGVTELSSQQQFLNQRSQQAQQQRM
FT                   LNNQQLDQRRLQQQRQFDNNQQQLLRNSPNGGKLLPNGNQPRNPFDRTTPAVPQAPLPT
FT                   PVNRG"
FT   sig_peptide     complement(268657..268716)
FT                   /locus_tag="Spro_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.654 at
FT                   residue 20"
FT   gene            268869..269732
FT                   /locus_tag="Spro_0240"
FT   CDS_pept        268869..269732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0240"
FT                   /product="carboxylate/amino acid/amine transporter"
FT                   /note="TIGRFAM: carboxylate/amino acid/amine transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   ypp:YPDSF_3407 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39350"
FT                   /db_xref="GOA:A8G8B0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B0"
FT                   /protein_id="ABV39350.1"
FT                   /translation="MLLLVITTILWAFSFSLIGEYLAGQVDSWFSVLMRIGLAALVFLP
FT                   FLRWRNIKLKVILMYMLVGACQLGIMYLFSFRAYMYLTVPEFLLFTVLTPLYVTLIYDL
FT                   ISGQRLRWSYVFSALLAVLGAAIIRYHQLSEHFWLGLLLVQAANISFAIGMVGYKRLME
FT                   VHPLPQHTAFSWFYLGALVVAVVAWCLWGNPQQLPTTNLQWGILVWLGVVASGLGYFMW
FT                   NYGATQVDAGTLGIMNNMHVPAGLLVNLAIWQQQPHWPSFIIGGAVIVASLWVHRRWVA
FT                   PKIISK"
FT   gene            complement(269766..270716)
FT                   /locus_tag="Spro_0241"
FT   CDS_pept        complement(269766..270716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0241"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ypi:YpsIP31758_0262
FT                   transcriptional regulator MetR"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39351"
FT                   /db_xref="GOA:A8G8B1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B1"
FT                   /protein_id="ABV39351.1"
FT                   /translation="MIELKHLRTLQALRNTGSLAAAAAQLHQTQSALSHQFSDLEQRLG
FT                   FKLFVRKSQPLRFTAQGEILLQLAEQVLPQIQQALQTCHEPHQATLRIAIECHSCIQWL
FT                   TPALDNFRQSWPQVVMDFKSGVTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFDFEV
FT                   RLVLAPDHPLASKLHIEPEDLIDETLMIYPVQRQRLDIWRHFLQPAGISPALKNVDNTL
FT                   LLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGDGLWSRLYAAVRDGEQRQAVTEAF
FT                   IRSARQHACNHLPFVRDAARPSAGVASVKPLASQP"
FT   gene            270822..273098
FT                   /locus_tag="Spro_0242"
FT   CDS_pept        270822..273098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0242"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="KEGG: yps:YPTB0248
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase; TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39352"
FT                   /db_xref="GOA:A8G8B2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8B2"
FT                   /protein_id="ABV39352.1"
FT                   /translation="MAILNHTLGFPRVGLRRELKKAQESYWAGNSTQEELLAVGRELRA
FT                   RHWQQQQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPARHQNADGTIDLDTLFRLGRGRA
FT                   PTGEPAAAAEMTKWFNTNYHYMVPEFHKGQQFKLGWSQLLDEVDEALALGHKIKPVLLG
FT                   PVTYLWLGKVKGEPFDRLSLLNDILPVYQQVLAELAKRGVEWVQIDEPALVLELPQAWL
FT                   NAFKPAYDALQGQVKLLLTTYFDSVGHNLDTLRELPVQGLHVDLVGGHDDIAVLNKALP
FT                   KEWLLSLGVINGRNVWRADLSNWFERLQPLVGSRPLWIGTSCSLLHSPIDLSVETRLDE
FT                   EVKSWFAFALQKCGELALLSAALNAPGAAKQAELDAYSAPIRARRQSSRVHNAQVGQRL
FT                   AAITAQDSERQRPYAERAQAQRERFNLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGN
FT                   NYRTSISEHIKQAIVEQERLGLDVLVHGEAERNDMVEYFGENLDGFVFTQNGWVQSYGS
FT                   RCVKPPVIIGDISRPEAITVEWAKYAQSLTDKPVKGMLTGPVTILCWSFPREDVTREVI
FT                   AKQIALALRDEVEDLEKAGIGIIQIDEPALREGLPLRQSDWAAYLNWAVDAFKLNAAVA
FT                   KDDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMDLLEAFKEFEYPNEIGPGVY
FT                   DIHSPNVPSVEWIEALLRKAAQNIPAERLWVNPDCGLKTRGWPETRQSLANMVLAAQRL
FT                   REQQA"
FT   gene            complement(273203..274039)
FT                   /locus_tag="Spro_0243"
FT   CDS_pept        complement(273203..274039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0243"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG:
FT                   ypi:YpsIP31758_0265 dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39353"
FT                   /db_xref="GOA:A8G8B3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B3"
FT                   /protein_id="ABV39353.1"
FT                   /translation="MKTDQVMTLKQAQGGFTPAVTPLAASTIITDEQGIHAGETTIPSQ
FT                   GDNLPAYIAKPADSSGPFPVVLVVQEIFGVHEHIQDVCRRLAKQGYLAIAPELYFRQGD
FT                   ARDYTDIGELFQKLVTKVPDRQVLADLDHAAHWATRHGGDAGKLAITGFCWGGRISWLY
FT                   AAHNPQLKAAVAWYGKLVGEKTLNSPKHPIDVATQLSAPVLGLYGGQDTGIPLDTVESM
FT                   RQALRAANADAEIVVYPDVGHAFNADYRPSYDAEAAADGWQRMLAWFTQHGVPGVK"
FT   gene            274546..275307
FT                   /locus_tag="Spro_0244"
FT   CDS_pept        274546..275307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0244"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine or
FT                   other phosphorylase family 1; KEGG: yen:YE0251 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39354"
FT                   /db_xref="GOA:A8G8B4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B4"
FT                   /protein_id="ABV39354.1"
FT                   /translation="MSQSDVFHLGLTKKDLQGAQLAIVPGDPQRVEKIAKLMENPVHLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQSNINV
FT                   GDVLVTTAAVRLDGASLHFAPMEFPAVADFACTTALVEAAKAAGATTHIGVTASSDTFY
FT                   PGQERYDTFSGRVVSRFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
FT                   RTQQEIPNAETMKNTESKAVQIVVDAARRLL"
FT   gene            275478..276260
FT                   /locus_tag="Spro_0245"
FT   CDS_pept        275478..276260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0245"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: yen:YE0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39355"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B5"
FT                   /protein_id="ABV39355.1"
FT                   /translation="MTAQILLHPSLAPLDGGINFRDLGGNSVADGRRIKRGLLFRSGSL
FT                   ERLTEDDCTFLAGVPVRSVLDYRDADEVQAKPDVLWNGADYHHFPANPLSNEVNANLEK
FT                   LTSETLAGFDAQAFMLELYRRLPFGNAAYKQLAKLLSNVDNGAIVQHCAVGKDRTGVGS
FT                   ALVLFALGADEATVVEDYLLTETTLATFREQMLDQLSIRLNASALGQFAYVLSAREEFL
FT                   MTALNCIRDQYGSTDRWLEAEYGLGQNQREALQAFYLE"
FT   gene            276348..276878
FT                   /locus_tag="Spro_0246"
FT   CDS_pept        276348..276878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0246"
FT                   /product="DedA family protein"
FT                   /note="KEGG: ypi:YpsIP31758_0269 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39356"
FT                   /db_xref="GOA:A8G8B6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B6"
FT                   /protein_id="ABV39356.1"
FT                   /translation="MSLNDIIHWVSDTVRQHEAWAIPIIFFLAFGESLAFLSLLLPATV
FT                   ILLALGALIGESGIAFWPIWAAAAAGAFFGDWLSYWIGYHYQDRVAHMWPLSRNPQLLT
FT                   RGHAFFERWGVLGIFIGRFFGPLRAVVPLVGGICGMPQRYFQVANITSAMIWAFGILAP
FT                   GAFGIKWLSQWFG"
FT   gene            277019..278566
FT                   /locus_tag="Spro_0247"
FT   CDS_pept        277019..278566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0247"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   ypi:YpsIP31758_0270 RmuC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39357"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B7"
FT                   /protein_id="ABV39357.1"
FT                   /translation="MDTSLVYGMGGVAIGLLLGWLIASLRVQQTQAQHETEQRLLEQSL
FT                   QQAQQETAARQETLQRNEQQMRQTDLELRNLHSQLAAGHEKLQQLNHWRNECELLNQEL
FT                   RAQREVNSAQEAELREVTIRLEETRMAAEEKQRLLINSEQRLTTQFENLANRIFEHSGR
FT                   KVDEQNKQSLDRLLLPLREQLDGFRRQVQDSFGQEARERHTLTHEIRNLQQLNAQMARE
FT                   AINLTKALKGDNKTQGNWGEVVLSRVLEASGLREGHEYETQVNVRLDHQSRMQPDVIVH
FT                   LPQGKDVVIDAKMSLVAYERYFNSEDEVEREAALSEHIGSLRGHIRLLGRKDYQQLPGL
FT                   RSLDYVLMFIPVEPAFLLAIDREPELISEALKHNIMLVSPTTLLVALRTITNLWRYEHQ
FT                   SQNAQRIADRAARLYDKMRLFVDDMSALGQSLDKAQGSYRQAMNKLSEGRGNLIGQTEG
FT                   FRALGVEVKRPINPLLAQQASAQHDEECEATGFDEVDALPGAEDDDSAEEPRSASQA"
FT   gene            278646..279401
FT                   /locus_tag="Spro_0248"
FT   CDS_pept        278646..279401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0248"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   ypi:YpsIP31758_0271 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39358"
FT                   /db_xref="GOA:A8G8B8"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8B8"
FT                   /protein_id="ABV39358.1"
FT                   /translation="MADQPQETTDFGFRTVARDEKQAMVADVFHSVAAKYDVMNDLMSF
FT                   GIHRIWKRFTIDCSGVRRGQRVLDLAGGTGDLAAKFSRMVGEQGQVVLADINDSMLKMG
FT                   REKLRDRGIIGNVNYVQANAEALPFPDNYFDCITISFGLRNVTDKDKALRSMFRVLKPG
FT                   GRLLVLEFSKPLLAPLSKAYDAYSFHVLPKIGELVVKDPESYRYLAESIRMHPDQETLK
FT                   GMMGAAGFDNVTYFNLTGGIVALHRGFKF"
FT   gene            279403..280023
FT                   /locus_tag="Spro_0249"
FT   CDS_pept        279403..280023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0249"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   yen:YE0257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39359"
FT                   /db_xref="GOA:A8G8B9"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8B9"
FT                   /protein_id="ABV39359.1"
FT                   /translation="MDMPMLLTPLLTGVLETSLNSLLFRDRSMKAARLRLAGKVLRIEL
FT                   QELSSPLVLLFSEQRVDVLGQSEDTADCTVRSRISVLLKLRDRQQLSPLMRSGELIVEG
FT                   DIQVVQQLVGLLDLAEWDPAEWLAPYIGDIAAQGITQALGKGANLLKTGFQRQQHYVAE
FT                   TLTEEWRVAPGPLEVVWFNEEVDATVRNLEALIARMDKLEGKR"
FT   gene            280020..281651
FT                   /locus_tag="Spro_0250"
FT   CDS_pept        280020..281651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0250"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: yen:YE0258 ubiquinone
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39360"
FT                   /db_xref="GOA:A8G8C0"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8C0"
FT                   /protein_id="ABV39360.1"
FT                   /translation="MTPGELRRLYLIVRVFLSYGLDELIPQMRLTLPLRVGRRLLFWMP
FT                   NRHADKPLGERLRLALQELGPVWIKFGQMMSTRRDLFPPQIADQLTLLQDRVAPFDGAL
FT                   ARKHIELAMGGPLETWFDDFDQQALASASIAQVHTARLKTTGQEVVLKVIRPDIRPIIK
FT                   ADVRLMYRLAAWVPKLMPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFDGS
FT                   PMLYVPEVYSDYCRESVLVMERIYGIPVSDIPTLEKQGTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPEDPCYIGIDCGIVGSLNKDDKRYLAENFIAFFNRDYRKVA
FT                   ELHVDSGWVPRDTNVEDFEFAIRTVCEPIFEKPLSEISFGNVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWMRDQVGIPAVIRALKEKAPFWAE
FT                   KLPELPELFYDSLQQHKLLQQSVDKLTNQMQAQRVRQGQSRYLFGVGATLLVSGTILLS
FT                   GDVEVFPAWLIAAGIVSWVIGWKRTT"
FT   gene            281732..281995
FT                   /locus_tag="Spro_0251"
FT   CDS_pept        281732..281995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0251"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: plu:plu4410 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39361"
FT                   /db_xref="GOA:A8G8C1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C1"
FT                   /protein_id="ABV39361.1"
FT                   /translation="MGGISITQLLIIAVIVVLLFGTKKLRTLGSDLGASIKGFKKAIGD
FT                   DNTPPTNTAEKSSLDDADFTAKPITDKQPEVKTEESKNKEQV"
FT   gene            281999..282565
FT                   /locus_tag="Spro_0252"
FT   CDS_pept        281999..282565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0252"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: yps:YPTB0259 sec-independent protein
FT                   translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39362"
FT                   /db_xref="GOA:A8G8C2"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C2"
FT                   /protein_id="ABV39362.1"
FT                   /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVSGWIRALRSLAAS
FT                   VQNELSQELKLQELQDSLKKVEKAGMQNLSPELKASMDELKDAAESLKRSYLGDSDNKT
FT                   EPAHTIHNPLVTDPEAIHDGVTPAEAAAVASSPAVVPEPVVSVTPPVAQPVVEPVKQPV
FT                   VSGVQATPEPVADKTPASYQPSGDR"
FT   gene            282569..283339
FT                   /locus_tag="Spro_0253"
FT   CDS_pept        282569..283339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0253"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ypi:YpsIP31758_0276 twin
FT                   arginine-targeting protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39363"
FT                   /db_xref="GOA:A8G8C3"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C3"
FT                   /protein_id="ABV39363.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNSIISILAIFLVLVFFANDIYQLV
FT                   SAPLIKQLPAGASMIATDVASPFFTPIKLTMIVSVFVSAPVILYQVWSFIAPALYKHER
FT                   RLMMPLLVSSSLLFYLGMAFAYFIVFPLAFGFFAKTAPAGVMIATDINNYLDFVMALFM
FT                   AFGVAFEVPVAIILLCWSGVTSPEDLKKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YLLFEVGVFFARFYTGKRRPQPEEEDEGDEPPAP"
FT   gene            283392..284174
FT                   /locus_tag="Spro_0254"
FT   CDS_pept        283392..284174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0254"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   yen:YE0262 deoxyribonuclease TatD (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39364"
FT                   /db_xref="GOA:A8G8C4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR024918"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8C4"
FT                   /protein_id="ABV39364.1"
FT                   /translation="MFDIGVNLTSSQFAKDRPAVVERARAAGVTGLLITGTDLQESRAA
FT                   SELAQQHANFCWSTAGVHPHHASSWDERVAEQICELAARPRVAAIGECGLDFNRNFSTP
FT                   EQQEAAFSAQLALAAELSMPVFLHCRDAHARFAALLAPWLDKLPAAVVHCFTGTAEELE
FT                   SCLSLGLSVGITGWVCDERRGLELRALLPQIPADRLLLETDAPYLLPRDLLPKPTSRRN
FT                   EPCFLPHIVRQVAAWRQEDPEWLGQKIDENARRLFRLE"
FT   gene            284189..285211
FT                   /locus_tag="Spro_0255"
FT   CDS_pept        284189..285211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0255"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   yen:YE0263 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39365"
FT                   /db_xref="GOA:A8G8C5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C5"
FT                   /protein_id="ABV39365.1"
FT                   /translation="MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVME
FT                   GSNRQEAVASMPGVSRMSIDLLVKEAEAIAKLGVPVISLFPVIEPGLKSLHAEEAYNPD
FT                   GLVQRTVRALKDAVPELGILTDVALDPYTTHGQDGIIDEQGYVINDITKEILVRQALSH
FT                   AEAGAEIVAPSDMMDGRIGAIRDQLEHQGLINTQIMAYSAKYASCYYGPFRDALGSSGN
FT                   LKGGNKKTYQMDPANSDEALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFA
FT                   YQVSGEYAMHMAAIQNGWLQEQPAVMESLMCFKRAGADGVLTYFAKRVAQWMHDDAMQR
FT                   "
FT   gene            complement(285258..285746)
FT                   /locus_tag="Spro_0256"
FT   CDS_pept        complement(285258..285746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0256"
FT                   /product="transcriptional acivator RfaH"
FT                   /note="TIGRFAM: transcriptional activator RfaH; PFAM: NGN
FT                   domain protein; KEGG: eca:ECA0204 transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39366"
FT                   /db_xref="GOA:A8G8C6"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C6"
FT                   /protein_id="ABV39366.1"
FT                   /translation="MESWYLLYCKRGQLLRAQEHLERQEVNCLSPIITLEKIVRGKRIA
FT                   VSEPLFPNYLFVEFDPERIHTTTISATRGVSHFVRFGSTPTTIPQKVIEELQTHTCETY
FT                   VDPETPQPGDSVLIVDGVFEGLQAIYTEPDGEARSMLLLNLINKQVSQSVDNRQFQKL"
FT   gene            285991..286716
FT                   /locus_tag="Spro_0257"
FT   CDS_pept        285991..286716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0257"
FT                   /product="Dipeptidase E"
FT                   /EC_number="3.4.13.21"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG:
FT                   aha:AHA_3293 dipeptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39367"
FT                   /db_xref="GOA:A8G8C7"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C7"
FT                   /protein_id="ABV39367.1"
FT                   /translation="MELFLLSNGKLSGESELLGYAKSHLLAMIARRGITSAVFIPYAMI
FT                   RSDYDQRAQELAQTLGIKVTSIHHAESPAAAIEQAECILVSGGNTWMLNQMLHEKGLIV
FT                   PIQRAVRERSVPYVGWSAGCNVATPSIRTTNDMPVRNSVVLPALSLFPVQINPHYIDAH
FT                   ISGHMGETRDERLAEFCAVNPSESVVALREGSLLHVEGNDLRYFSARDQGFKVFRHGVE
FT                   TQEYQDTQALRPLVPFTCH"
FT   gene            286781..288301
FT                   /locus_tag="Spro_0258"
FT   CDS_pept        286781..288301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0258"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: yen:YE0265 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39368"
FT                   /db_xref="GOA:A8G8C8"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C8"
FT                   /protein_id="ABV39368.1"
FT                   /translation="MPFSLAVIMISMKYRDLRDFLSLLEKRGELKRISQPIDPYLEMTE
FT                   IADRTLRAGGPALLFENPKGYDMPVLCNLFGTPGRVAMGMGQEDVSSLREVGKLLAFLK
FT                   EPEPPKGFRDLFDKLPKFKQVLNMPTKVLGSAPCQEQVWQGDDVDLSRIPVMHCWPEDA
FT                   APLITWGLTVTRGPQKERQNLGIYRQQVLSKNKVIMRWLSHRGGALDYQEWCQAHPGER
FT                   FPVAVALGADPATILGAVTPVPDTLSEYAFAGLLRGNKTEVVKCISCDLEVPASAEIVL
FT                   EGYIEPGEMAPEGPYGDHTGYYNEIDHFPVFTITHITQRRDAIYHSTYTGRPPDEPAVL
FT                   GVALNEVFVPILQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQ
FT                   FMYTKFVIVCDDDVNARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFASPVSGLGSK
FT                   MGLDATNKWPGETQREWGRPIQMDEKVRARVDEIWDELAIFSDREPTL"
FT   gene            288352..289053
FT                   /locus_tag="Spro_0259"
FT   CDS_pept        288352..289053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0259"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   ypi:YpsIP31758_0281 NAD(P)H-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39369"
FT                   /db_xref="GOA:A8G8C9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8C9"
FT                   /protein_id="ABV39369.1"
FT                   /translation="MTILSCKVTSVEAITDTVYRVRLVPEAPFSFKAGQYLMVVMDERD
FT                   KRPFSLASIPSDQDYIELHIGASELNLYAMAVMDRILKEQAITVDIPHGDAWLREEGSR
FT                   PLVLIAGGTGFSYARSILLAALEQQPERDISIYWGGRELKHLYDLSELEALSLRHPNLK
FT                   VIPVVEQPEEEWRGRSGTVLSAVLQDFGTLAEHDIYIAGRFEMAKIARERFCAERGALE
FT                   AHMFGDAFSFI"
FT   gene            complement(289224..290387)
FT                   /locus_tag="Spro_0260"
FT   CDS_pept        complement(289224..290387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0260"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: yen:YE0267 3-ketoacyl-CoA thiolase; TIGRFAM:
FT                   acetyl-CoA acetyltransferase; acetyl-CoA C-acyltransferase
FT                   FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39370"
FT                   /db_xref="GOA:A8G8D0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8D0"
FT                   /protein_id="ABV39370.1"
FT                   /translation="MENVVIVDAVRTPMGRSKGGAFRQVRAEDLSAHLMRAVLSRNPSL
FT                   DAAEIDDIYWGCVQQTLEQGFNIARNASLLAEIPHSVPAVTVNRLCGSSMQALHDAARA
FT                   IMVGDAHVSLIGGVEHMGHVPMNHGVDFHPGLSRSVAKAAGMMGLTAEMLAKMHNISRQ
FT                   MQDEFAARSHQRAHAATLAGYFKNEIIPTTGHDADGVLTRYDFDEVIRPETTVASLAAL
FT                   RPAFDPVNGTVTAGTSSALSDGASAMLLMSESRAKALGLKARARIRSMAVVGCDPSIMG
FT                   YGPVPASKLALKRAGLSVQDIDLFELNEAFAAQSLPCIKDLGLLDSIDDKINLNGGAIA
FT                   LGHPLGCSGSRISTTLLNNMERRDVQFGLATMCIGLGQGIATVFERV"
FT   gene            complement(290398..292587)
FT                   /locus_tag="Spro_0261"
FT   CDS_pept        complement(290398..292587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0261"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   yen:YE0268 fatty acid oxidation complex alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39371"
FT                   /db_xref="GOA:A8G8D1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8D1"
FT                   /protein_id="ABV39371.1"
FT                   /translation="MLYQGETLQLHWLDNGIAELVFNAPGSVNKLDTRTVASLGEALAV
FT                   LEKQTELKGLLLRSTKAAFIVGADITEFLSLFAAPAEKLQEWLNFANAIFNRLEDLPVP
FT                   TISAINGYALGGGCECILATDFRVASPDARIGLPETKLGIMPGFGGSVRLPRLLGNDSA
FT                   LEIIAAGKDVSAKDALKVGLVDAVVAPEKLVEAALKMLQQAIEGKLDWRAYRQPKLEPL
FT                   KLSPIEAAMSFTTAKGMVMQTAGKHYPAPMTAVKTIEAAARLGRDEALKLETASFVPLA
FT                   RSKEARALVGIFLNDQFVKGQAKKLAKGIEAPKQAAVLGAGIMGGGIAYQSALKGVPVV
FT                   MKDISDKSLTLGMNEAAKLLNKQLERGKLDGMKMAQVLSTIQPTLDYAGIERAQVIVEA
FT                   VVENPKIKAAVLSEVEGLIGENTVLASNTSTIPINHLAKSLKRPQNFCGMHFFNPVHRM
FT                   PLVEIIRGEQTSDSTIAAVVAYASRMGKTPIVVNDCPGFFVNRVLFPYFAGFSMLLRDG
FT                   ADFRQIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPERMGKDYRDAIDVMF
FT                   DNQRFGQKNQLGFYRYSQDNKGKPRKDNDEQTDVLLAEVSQPRQTISDEEIIARMMIPM
FT                   INEVVRCLEENIIASPAEADMALVYGIGFPPFHGGAFRYLDTLGTANYVELAQRYAHLG
FT                   ALYQVPAGLRAKAEHNESYYPVAAPLSDVSTGQPA"
FT   gene            292821..294017
FT                   /locus_tag="Spro_0262"
FT   CDS_pept        292821..294017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0262"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aha:AHA_1632 probable MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39372"
FT                   /db_xref="GOA:A8G8D2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8D2"
FT                   /protein_id="ABV39372.1"
FT                   /translation="MSKAVCVKHSGFWSIPARTMTLACLLVFMAQMATTVYLPSLPTVM
FT                   QELAMTRRATELSISIFVIGAALPVLFWGAAADRFGRRLPLTLSLALFISCSALLAFCS
FT                   NGTQLLVLRALQGVAAGGAAIIARIIVRDNWSGDELARRLSVLSIAFIAALGGGQFIGG
FT                   LLSQYSHWQMGFVVMGLTGLAIWLLMLTLPLEAGRGAGRRPAMAATYWHILRRPGFFWP
FT                   AVVGGLGFATTVTLQEVSPFIMQQGFGLNVTAFGALGLVIGVAYFTGAMTVNRTVARFG
FT                   GKRLMQAGTSIVAVATAAIMVLWWSGVLVGLSGMTVFIALYCLTIFGQAVLFPNSMAMA
FT                   VSDVKQQGAYAMALCGFLQQCLAGIAAAGAVLLEHHGLWAAAIALLGLIAWLIVKLRM"
FT   sig_peptide     292821..292922
FT                   /locus_tag="Spro_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.666) with cleavage site probability 0.495 at
FT                   residue 34"
FT   gene            294135..295466
FT                   /locus_tag="Spro_0263"
FT   CDS_pept        294135..295466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0263"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: ypi:YpsIP31758_0284
FT                   Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39373"
FT                   /db_xref="GOA:A8G8D3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8D3"
FT                   /protein_id="ABV39373.1"
FT                   /translation="METLASLYNDHLAELQKRAREVLTRNKLDALLIHSGELQRIFQDD
FT                   RSYPFKVNAHFKAWVPVTSVPNCWLWVDGVNKPKLWFYSPVDYWHSVEPLPESFWTRSV
FT                   ELMPLANADDIAQQLPAQRERVGYIGYAQQRARDLGILAENVNPKAVLNYLDFHRSIKT
FT                   GYELACMREAQKTAVMGHRAAHEAFLSGMSEFDINQAYLTATGHRDTDVPYDNIVALNE
FT                   HASVLHYTTLDHQPPSEMLSFLLDAGAEYNGYAADLTRTYAGQSGSDFAQLIKDLNGEQ
FT                   LALMDTIKAGVRYTDYHVQMHQRVAKLLKSHKLVTGISEEAMVEQGLTTPFLPHGLGHP
FT                   LGLQVHDSAGFMQDEQGTHLAAPSKYPYLRCTRMLQPGMVLTIEPGMYFIDSLLAPWRS
FT                   GEFSQHFAWDRIDALKPYGGIRIEDNIVIHEKRIENMTRDLNLA"
FT   gene            295466..296080
FT                   /locus_tag="Spro_0264"
FT   CDS_pept        295466..296080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0264"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: ypi:YpsIP31758_0285
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39374"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8D4"
FT                   /protein_id="ABV39374.1"
FT                   /translation="MQPYPIPAGPVSVSEEIKKSRFITLLAPTSGVDVAKAFIQQVRDE
FT                   HPAARHHCWAFVAGSPTDSQQLGFSDDGEPSGTAGKPILAQLMGSGIGEITAVVVRYYG
FT                   GIKLGTGGLVRAYGSGVQQALKQLAVSYKIPQAEYTLQCDYAQLALVENLLQQTEGRIV
FT                   QGEYGASVMLHLALPVTGVEAFGNKLRDLSRGNLQLTPISQ"
FT   gene            296115..297566
FT                   /locus_tag="Spro_0265"
FT   CDS_pept        296115..297566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0265"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: yps:YPTB0270 Trk system
FT                   potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39375"
FT                   /db_xref="GOA:A8G8D5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8D5"
FT                   /protein_id="ABV39375.1"
FT                   /translation="MHFRAITRIVGLLVILFSGTMFIPGLVALIYRDGAGRAFSQTFFV
FT                   AVTIGLMLWWPNRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSLTDAFFE
FT                   SFSGLTTTGATTLVGLDSLPKAILFYRQMLQWMGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALALWGAGMSVFDAIGHSFSTIAIGG
FT                   FSTHDASIGYYASPTINTIIAIFLLISGCNYGLHFALLSGRSLKVYWRDPEFRMFIAVQ
FT                   LTLVVVCTAVLWGHGVYKTGMETVNQAFFQVVSMATTAGFTTDSIAKWPLFLPMLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLYLQGSRELKRLVHPNAVYTIKLGNRALPERILEAVWG
FT                   FFSAYALVFIVSMLAIIATGVDDFSAFAAVTATLNNLGPGLGVVADNFTTMPAPAKWIL
FT                   VLTMLFGRLEVFTLLVLFTPTFWRE"
FT   sig_peptide     296115..296201
FT                   /locus_tag="Spro_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.760 at
FT                   residue 29"
FT   gene            297589..298122
FT                   /locus_tag="Spro_0266"
FT   CDS_pept        297589..298122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0266"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: yen:YE0273 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39376"
FT                   /db_xref="GOA:A8G8D6"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8D6"
FT                   /protein_id="ABV39376.1"
FT                   /translation="MKALILYSSRDGQTRSIASYIANKLQDTLRCDVIDLLQADNVDLS
FT                   QYQQVLIGASIRYGHFHPTLEKFVKRHAEQLNQMPSAFFSVNLTARKADKRSPQTNAYT
FT                   RKFLLSSPWQPKQCAVFAGALRYPRYRWFDRVMIQLIMRMTGGETDTSKEVEYTDWQQV
FT                   DRFAQEFGHIQYEK"
FT   gene            298569..300103
FT                   /locus_tag="Spro_R0007"
FT   rRNA            298569..300103
FT                   /locus_tag="Spro_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            300248..300323
FT                   /locus_tag="Spro_R0008"
FT                   /note="tRNA-Glu1"
FT   tRNA            300248..300323
FT                   /locus_tag="Spro_R0008"
FT                   /product="tRNA-Glu"
FT   gene            300559..303468
FT                   /locus_tag="Spro_R0009"
FT   rRNA            300559..303468
FT                   /locus_tag="Spro_R0009"
FT                   /product="23S ribosomal RNA"
FT   gene            303567..303682
FT                   /locus_tag="Spro_R0010"
FT   rRNA            303567..303682
FT                   /locus_tag="Spro_R0010"
FT                   /product="5S ribosomal RNA"
FT   gene            304136..305173
FT                   /locus_tag="Spro_0267"
FT   CDS_pept        304136..305173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0267"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: eca:ECA0213
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM: FAD
FT                   linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39377"
FT                   /db_xref="GOA:A8G8D7"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8D7"
FT                   /protein_id="ABV39377.1"
FT                   /translation="MSTESASLKKHNTFALPVNAAHLVIAETIELMIKVWQKTQKRQEP
FT                   LLVLGEGSNVLFLDDFSGTVMINQLKGIDIREEKDAWFLHVSSGENWHGLVCRTLEIGI
FT                   PGLENLALIPGLVGSAPIQNIGAYGIELKSVCDYVDLLDLTTGAIDRIAASDCGFGYRE
FT                   SIFKHHFQKGHIIVGVGLRLSKQWDPMLNYGDLTKLDPETVTPRQVFDSVCAMRRSKLP
FT                   DPKVTGNAGSFFKNPLVGSEKAAELTTEYPGIPHYPQQDGQVKLAAGWLIDQCGLKGHQ
FT                   IGGAAVHNQQALVLVNADNAASQDVVALARHVRNTVAKKFDVWLEPEVRFIGAVGELNA
FT                   VEVLS"
FT   gene            305170..306132
FT                   /locus_tag="Spro_0268"
FT   CDS_pept        305170..306132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0268"
FT                   /product="bifunctional BirA, biotin operon
FT                   repressor/biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: yen:YE0275 bifunctional protein BirA; TIGRFAM:
FT                   biotin--acetyl-CoA-carboxylase ligase; biotin operon
FT                   repressor; PFAM: biotin protein ligase domain protein;
FT                   biotin/lipoate A/B protein ligase; Helix-turn-helix type 11
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39378"
FT                   /db_xref="GOA:A8G8D8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8D8"
FT                   /protein_id="ABV39378.1"
FT                   /translation="MKDTKVPLKLISILADGDFHSGEHLGELLGMSRAAINKHIQTIRE
FT                   WGLDVFTVPGKGYSLPSPIQLLDVECILDQLVDKRVTVLPVVDSTNQYLLDRITELQSG
FT                   DACVAEYQQAGRGRRGRQWISPFGANLYLSMFWRLDQGPAAAMGLSLVIGIVMAEVLKD
FT                   LGAQDVRVKWPNDLYLNDRKLAGILVELTGKTGDAAQLVIGAGINLAMRETNANAINQG
FT                   WINLQEAGINIDRNELAATLLNELRQSLRQFEIDGLAPFIARWRALDNFIDRPVKLLIG
FT                   EQQIFGIARGIDQQGALLLDQDGVIKPFIGGEISLRSAE"
FT   gene            complement(306179..307129)
FT                   /locus_tag="Spro_0269"
FT   CDS_pept        complement(306179..307129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0269"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="KEGG: ypi:YpsIP31758_3870 pantothenate kinase;
FT                   TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39379"
FT                   /db_xref="GOA:A8G8D9"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8D9"
FT                   /protein_id="ABV39379.1"
FT                   /translation="MIKRDQSLATPYLQFDRTQWAALRDSVPLTLSEEEIVKLKGINED
FT                   LSLEEVAQIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYVIGIAGSVAVGKSTT
FT                   ARLLQALLSSWPEHRSVELITTDGFLHPNKVLNERGLMKKKGFPQSYDMHSLVKFVSEV
FT                   KSGAKRVTAPVYSHLIYDVVPEGNKVIEQPDILILEGLNVLQSGMDYPHDPHRVFVSDF
FT                   VDFSIYVDAPEELLQSWYINRFLKFRQGAFSNPDSYFHNYSKLPEPEAINIASQLWNEI
FT                   NGLNLQENILPTRERASLIMTKSANHAVENVRLRK"
FT   gene            307568..307643
FT                   /locus_tag="Spro_R0011"
FT                   /note="tRNA-Thr1"
FT   tRNA            307568..307643
FT                   /locus_tag="Spro_R0011"
FT                   /product="tRNA-Thr"
FT   gene            307668..307752
FT                   /locus_tag="Spro_R0012"
FT                   /note="tRNA-Tyr1"
FT   tRNA            307668..307752
FT                   /locus_tag="Spro_R0012"
FT                   /product="tRNA-Tyr"
FT   gene            307952..308026
FT                   /locus_tag="Spro_R0013"
FT                   /note="tRNA-Gly1"
FT   tRNA            307952..308026
FT                   /locus_tag="Spro_R0013"
FT                   /product="tRNA-Gly"
FT   gene            308033..308108
FT                   /locus_tag="Spro_R0014"
FT                   /note="tRNA-Thr2"
FT   tRNA            308033..308108
FT                   /locus_tag="Spro_R0014"
FT                   /product="tRNA-Thr"
FT   gene            308218..309402
FT                   /locus_tag="Spro_0270"
FT   CDS_pept        308218..309402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0270"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG:
FT                   ypi:YpsIP31758_3918 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39380"
FT                   /db_xref="GOA:A8G8E0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E0"
FT                   /protein_id="ABV39380.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPFIIVFMNKCDMVDDEELLELVEMEVRELLSAYDF
FT                   PGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTQFDSEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNVNMKVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            309660..310043
FT                   /locus_tag="Spro_0271"
FT   CDS_pept        309660..310043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0271"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: yen:YE0279
FT                   preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39381"
FT                   /db_xref="GOA:A8G8E1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8E1"
FT                   /protein_id="ABV39381.1"
FT                   /translation="MSANTEAQGSGRGLETAKWLIVAVLLVVAIVGNYFYRDFSLPLRA
FT                   LAVVVVIAVAGAVALMTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   gene            310045..310590
FT                   /locus_tag="Spro_0272"
FT   CDS_pept        310045..310590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0272"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: yen:YE0280 transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39382"
FT                   /db_xref="GOA:A8G8E2"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8E2"
FT                   /protein_id="ABV39382.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREYIKLHDMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFAQVEKG"
FT   gene            310749..311177
FT                   /locus_tag="Spro_0273"
FT   CDS_pept        310749..311177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0273"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: sgl:SG0130 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39383"
FT                   /db_xref="GOA:A8G8E3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E3"
FT                   /protein_id="ABV39383.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TDSVEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSA
FT                   QVREIAETKAADMTGSNVEAMTRSIEGTARSMGLVVED"
FT   gene            311181..311885
FT                   /locus_tag="Spro_0274"
FT   CDS_pept        311181..311885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0274"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: ent:Ent638_0194
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39384"
FT                   /db_xref="GOA:A8G8E4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E4"
FT                   /protein_id="ABV39384.1"
FT                   /translation="MAKLTKRMRVIRDKVDATKQYDITEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPNGTGRSVRVAVFAQGPNAEAAKAAGAELVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFESDKLKENLEALLVALKKAKPSQAKGVYIKKVSLSTTMGAGV
FT                   AIDQSGLTAVAN"
FT   gene            312228..312725
FT                   /locus_tag="Spro_0275"
FT   CDS_pept        312228..312725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0275"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: eca:ECA0221 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39385"
FT                   /db_xref="GOA:A8G8E5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E5"
FT                   /protein_id="ABV39385.1"
FT                   /translation="MALNLQDKQAIVAEVNEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLMRRVVEGTPFECLKDTFVGPTLIAFSHEHPGAAARLFKDFAKANA
FT                   KFEIKAAAFEGEMIPAAQIDRLATLPTYDEAIARLMATMKEAAAGKLVRTLAALRDQKE
FT                   AA"
FT   gene            312788..313153
FT                   /locus_tag="Spro_0276"
FT   CDS_pept        312788..313153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0276"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: ent:Ent638_0196 ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39386"
FT                   /db_xref="GOA:A8G8E6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E6"
FT                   /protein_id="ABV39386.1"
FT                   /translation="MSITKDQIIEGVAALSVMEIVELIAAMEEKFGVSAAAVAAGPAAA
FT                   AEAVEEKTEFDVVLKGIGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDA
FT                   EALKKALEEAGAEVEVK"
FT   gene            313487..317515
FT                   /locus_tag="Spro_0277"
FT   CDS_pept        313487..317515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0277"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; KEGG: yen:YE0286
FT                   DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39387"
FT                   /db_xref="GOA:A8G8E7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E7"
FT                   /protein_id="ABV39387.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QHGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTFSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILD
FT                   LFFAKVVYEIRDNKLQMELVPERLRGETASFDIEANGKIYIEKGRRITARHIRQLEKDE
FT                   IQSIEVPVEYIAGKVVAKDYIDTNTGELICAANMELSLDLLAKLSQSGHKRIETLFTND
FT                   LDHGAYISETVRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIGIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGLVTDEINYLSAIEEGNFVIAQANSNLDDDGRFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTAVARRGGVIQYVDASRIVIKVNEDEMLAGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTIID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHAVLVAGGVEAEKL
FT                   SKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKSDFEKKLDAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINQMLKQHQEVAKLREFIQKAYDLGDDVCQKVDLNTFTD
FT                   DEVLRLAENLKKGMPIATPVFDGAKESEIKQLLEMGGIPTSGQITLFDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPESFNVLLKEIRSLGINIELEGE"
FT   gene            317634..321860
FT                   /locus_tag="Spro_0278"
FT   CDS_pept        317634..321860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0278"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: yen:YE0287 DNA-directed RNA polymerase beta'
FT                   chain; TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase alpha subunit; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase Rpb1
FT                   domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39388"
FT                   /db_xref="GOA:A8G8E8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8E8"
FT                   /protein_id="ABV39388.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKNMDLEQECETLREELNETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLSGPKEAERIYRAGLASLHARVKVRITEEIKNTEGESVHQTSIVDTTVGR
FT                   AILWMIVPRGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPAKKAEIIEEAETEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHNGIMMTPVIEGGDVKEPLRERVLGRVTAEDIIKPGTADILVPRNTLLHEKTCDL
FT                   LEENSVDSVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGTLKLSNVKFVMNAAGKLVITSRNTELKLIDEFG
FT                   RTKERYKVPYGSVMGKGDGMEVNGGETVANWDPHTMPVITEVSGFIRFADMVDGQTITR
FT                   QTDELTGLSSLVVLDSAERTGSGKDLRPALKIVDAKGDDVLIPGTDMPAQYFLPGKAIV
FT                   QLEDGIQIGAGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVVERGDVVSDGPESPHDILRLRG
FT                   VHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKGTIVSAGGTEFLEGEQAEVSR
FT                   VKIANRQLAAEGKIEATFSRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRKAQGETPVVPQVSAEEATANLAELLNAGNL
FT                   GGGNND"
FT   gene            complement(322193..323326)
FT                   /locus_tag="Spro_0279"
FT   CDS_pept        complement(322193..323326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0279"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="TIGRFAM: thiazole biosynthesis protein ThiH; PFAM:
FT                   Radical SAM domain protein; biotin and thiamin synthesis
FT                   associated; KEGG: ypi:YpsIP31758_3857 thiazole biosynthesis
FT                   protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39389"
FT                   /db_xref="GOA:A8G8E9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8E9"
FT                   /protein_id="ABV39389.1"
FT                   /translation="MADDFSSRWQQLDWDDISLRINSKTARDVEHALNAEKLSREDFMA
FT                   LISPAAASYLEPLAQRAQQMTRQRFGNVVSFYVPLYLSNLCANDCTYCGFSMSNRIKRK
FT                   TLDAAEIERECLAIKALGFEHLLLVTGEHQTKVGMDYFRQHIPAIRRHFSSLMMEVQPL
FT                   EQQEYAELKALGLDGVLVYQETYHPATYLQHHLRGQKQDFHWRLATPDRLGRAGIDKIG
FT                   LGALIGLSNSWRTDCYMLAEHLFYLQQTYWQSRYSISFPRLRPCAGGIEPASIMSEPQL
FT                   VQLICAFRLFAPDVELSLSTRESPFFRDHMIPVAINSVSAGSKTQPGGYADDVPPELEQ
FT                   FEPHDGRTPQQVAQAISDAGLQPVWKDWDGYLGRSPQ"
FT   gene            complement(323326..324105)
FT                   /locus_tag="Spro_0280"
FT   CDS_pept        complement(323326..324105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0280"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   yen:YE0290 thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39390"
FT                   /db_xref="GOA:A8G8F0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8F0"
FT                   /protein_id="ABV39390.1"
FT                   /translation="MLQIADTTFTSRLFTGTGKFATPTLMLEALQASGSQLVTMAMKRV
FT                   DLRGGNDAILAPLQQLGVRLLPNTSGAKTAAEAVFAARLAREALGTHWVKLEIHPDVKY
FT                   LLPDPIETLKAAEILVKEGFVVLPYCGADPVLCKRLEEAGCAAVMPLGAPIGSNRGLRT
FT                   RDFLEIIIEQARVPVVVDAGIGAPSHALEAMELGADAVLVNTAIAVARDPVQMARAFRL
FT                   ALEAGELARQAGLGSSQRNAVASSPLTAFLSQTGETL"
FT   gene            complement(324107..324307)
FT                   /locus_tag="Spro_0281"
FT   CDS_pept        complement(324107..324307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0281"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: plu:plu0483 thiS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39391"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8F1"
FT                   /protein_id="ABV39391.1"
FT                   /translation="MKIRLNDQPLELAQPLSISALLEQLERHQPGTALAINQIIIPRTD
FT                   WANHLVQDGDDILLFQAIAGG"
FT   gene            complement(324304..325053)
FT                   /locus_tag="Spro_0282"
FT   CDS_pept        complement(324304..325053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0282"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: eca:ECA0230 thiamine
FT                   biosynthesis adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39392"
FT                   /db_xref="GOA:A8G8F2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8F2"
FT                   /protein_id="ABV39392.1"
FT                   /translation="MLNDQEFLRYSRQLLLEDIGPAGQEKLKQSTALIVGLGGLGSPAS
FT                   LYLAAAGVGTLLLADDDRLHVTNLQRQILYRSSDVSQSKAALAKHQLQALNPMVESIAL
FT                   EQRLQGEVLQRAVQRADLILDCSDNMETRHAVNAACIQAGKPLISGSAVGFSGQLLVIE
FT                   PPYAHGCYACLYPEQTEPQRNCRTAGVLGPVVGVIGTLQALEAIKMLAGLPSAISGKLR
FT                   LFDGKQQSWSTLQLSQASTCPACGGTA"
FT   gene            complement(325058..325696)
FT                   /locus_tag="Spro_0283"
FT   CDS_pept        complement(325058..325696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0283"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: eca:ECA0231 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39393"
FT                   /db_xref="GOA:A8G8F3"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8F3"
FT                   /protein_id="ABV39393.1"
FT                   /translation="MTDITTPFPATPHKLGLYPVVDSVEWIARLLDAGVTTLQLRIKDL
FT                   PDEQVEDDIAAAIALGKRYDARLFINDYWQLAIKHGAYGVHLGQEDLDTTDLAAIHRAG
FT                   LRLGVSTHDDSELARAIAVKPSYIALGHIFPTQTKDMPSAPQGLVELKRHIAGLSDYPT
FT                   VAIGGISIDRVAAVLDCGVGSVAVVSAITQAPDWRAATAQLLQLIEGKE"
FT   gene            complement(325689..327632)
FT                   /locus_tag="Spro_0284"
FT   CDS_pept        complement(325689..327632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0284"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   ypi:YpsIP31758_3853 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39394"
FT                   /db_xref="GOA:A8G8F4"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8F4"
FT                   /protein_id="ABV39394.1"
FT                   /translation="MSNVNKPRARKEQREEAQQFINTLQGVSFPNSRRIYLQGSRSDLQ
FT                   VPMREIQLSPTLIGGDKDNPKYEPNEAIPVYDTAGPYGDPQSELNVHSGLAKLRAGWIA
FT                   ERGDTEALKGVSSGFTQQRLADEGLDHLRFEHLPLPRKAQPGQCVTQLHYARAGTVTPE
FT                   MEFIAIRENMGRERIRGEVLRHQHPGQSWGANLPENITPEFVRQEVAAGRAIIPANINH
FT                   PESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYIHET
FT                   REWILRNSPVPIGTVPIYQALEKVNGVAENLTWEMFRDTLLEQAEQGVDYFTIHAGVLL
FT                   RYVPMTAKRLTGIVSRGGSIMAKWCLSHHQENFLYQHFREICEICAAYDVSLSLGDGLR
FT                   PGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHE
FT                   APFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLI
FT                   TYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPATARAYHDETLPQES
FT                   GKIAHFCSMCGPKFCSMKISQEVRDYAAAQEAAKPIAVQLTGMEKMSAEFRSRGSELYH
FT                   SAGNLQEELNND"
FT   misc_binding    complement(327748..327872)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 69.75"
FT   gene            complement(327912..328415)
FT                   /locus_tag="Spro_0285"
FT   CDS_pept        complement(327912..328415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0285"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: yen:YE0295 regulator of sigma D"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39395"
FT                   /db_xref="GOA:A8G8F5"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8F5"
FT                   /protein_id="ABV39395.1"
FT                   /translation="MLNRLESLTQRVGGSNELVDQWLQARKQLLVAYCALVGIKPNKEK
FT                   HTPLNEKALENFCHNLVDYLSAGHFHIYDRIIKQVEGASSPKMSLAVNIYPKLWANTEQ
FT                   IMAFHDRYTEVDIDQDLCLELHQALSDIGETLAARFTLEDRLIQLAAETWQQAEPDKTL
FT                   DPAG"
FT   gene            328515..329282
FT                   /locus_tag="Spro_0286"
FT   CDS_pept        328515..329282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0286"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: yen:YE0296
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39396"
FT                   /db_xref="GOA:A8G8F6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8F6"
FT                   /protein_id="ABV39396.1"
FT                   /translation="MELALTGNENGWWIVSHESKLWLPNGELPCGLAASFSLLGRMARV
FT                   IGEWEGLPVWLVRHAMPQEMGSVRQLLELDRGLFQLAGRGVQLAEFYRSHRYCGYCGHE
FT                   MHLSRTESACLCGHCRERYYPQIAPCVIVAIRRDDEILLAQHVRHRGGIHTVLAGFVEV
FT                   GETLEQAAAREVMEESNIEIKNLRYVTSQPWPFPHSLMMAFMADYHRGEIRHDPKELLN
FT                   AGWYRYDRLPLLPPPGTVARRLIEDTVALCREQ"
FT   gene            329323..330387
FT                   /locus_tag="Spro_0287"
FT   CDS_pept        329323..330387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0287"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: yen:YE0297 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39397"
FT                   /db_xref="GOA:A8G8F7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8F7"
FT                   /protein_id="ABV39397.1"
FT                   /translation="MNELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFSSPIT
FT                   SRADVDKLPAFDPEVELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKLKKMMYAEPATLHLLLDKLADSVILYLNAQIKAGAQSVMVFDTWGGVLTGRDYREF
FT                   SLHYMHKIVDGLLRENDGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIADARRR
FT                   VGDKVALQGNMDPSMLYASPERIGQEVETILAGFGHGEGHVFNLGHGIHPDVPPENAGA
FT                   FVEAVHAQSGKYHR"
FT   gene            330397..331083
FT                   /locus_tag="Spro_0288"
FT   CDS_pept        330397..331083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0288"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="PFAM: Endonuclease V; KEGG: stm:STM4168 endonuclease
FT                   V (deoxyinosine 3'endoduclease)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39398"
FT                   /db_xref="GOA:A8G8F8"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8F8"
FT                   /protein_id="ABV39398.1"
FT                   /translation="MIDTQALRAEQRLRASEVIRQDDFLVVPPAFIAGADVGFEQEGAV
FT                   TRAAIAILRYPSLELVEYQVARVATTMPYIPGFLSFREYPALLAAWEQLHQKPDLVLVD
FT                   GHGISHPRRLGVASHFGLLVNVPTIGVAKKRLCGKFAPLDEATDALAPLEDKGEQLGWV
FT                   WRSKARCNPLFISTGHRVGADSALAWVQRCMAGYRLPEPTRWADAIASRRPAFQRWLQQ
FT                   HPEVSQ"
FT   gene            331132..331722
FT                   /locus_tag="Spro_0289"
FT   CDS_pept        331132..331722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0289"
FT                   /product="protein of unknown function DUF416"
FT                   /note="PFAM: protein of unknown function DUF416; KEGG:
FT                   yen:YE0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39399"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8F9"
FT                   /protein_id="ABV39399.1"
FT                   /translation="MLRNPIHLRLEKLESWQHLTFMASLCERMYPNYQMFCLQTEFGEP
FT                   AIYRRILDLVWETLVVKDAKVNFDSQLEKLEEAIPAAEDYDLYGVYPAIDACIALGELI
FT                   HSRLSGETLEHAIAISETSIRTVAMLEMTQAGKEMTDDELKVLPAVEEEWDIQWEIFRL
FT                   LADCEERDLELIKGLRSDLREAAVSNIGIKLTQ"
FT   gene            331911..332183
FT                   /locus_tag="Spro_0290"
FT   CDS_pept        331911..332183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0290"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: yen:YE0300 DNA-binding protein HU-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39400"
FT                   /db_xref="GOA:A8G8G0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G0"
FT                   /protein_id="ABV39400.1"
FT                   /translation="MNKTQLIDVIADKADLSKAQAKLALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
FT   gene            332253..332891
FT                   /locus_tag="Spro_0291"
FT   CDS_pept        332253..332891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0291"
FT                   /product="protein of unknown function DUF1481"
FT                   /note="PFAM: protein of unknown function DUF1481; KEGG:
FT                   yen:YE0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39401"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G1"
FT                   /protein_id="ABV39401.1"
FT                   /translation="MVIGIAAGLSACSSHSDLPSFSASGYVADQGVMRLWRKDDERHRP
FT                   LVLMSVYSPYRGPGTVTTLYEYQDGKLRQIKRTDADGDQDSIQLRFADDGGVSFMQRQL
FT                   ATRREQLTADEIALYQYQARRVLELSNALRAGKVKLLQGRWQQGVVQTCDGQTLKPDLD
FT                   SSAEAWIARRARNSSQPVNIAWLDAPEGRELLLVANDDFCRWEPKEDQL"
FT   gene            complement(332937..334220)
FT                   /locus_tag="Spro_0292"
FT   CDS_pept        complement(332937..334220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0292"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: yps:YPTB0299 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39402"
FT                   /db_xref="GOA:A8G8G2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G2"
FT                   /protein_id="ABV39402.1"
FT                   /translation="MNILIIGNGGREHALAWKAAQSPLADKVYVAPGNAGTALESNLEN
FT                   VAISATDIPALVAFAQSHDIGLTIVGPEAPLVIGVVDAFQAAGLKIFGPSQAAAQLEGS
FT                   KAFTKDFLARHNIPSAEYQNFTEVEPALAYLRSKGAPIVIKADGLAAGKGVIVAMTLQE
FT                   AEDAVQDMLAGNAFGDAGHRIVIEEFLEGEEASFIVMVDGENVVPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDEIHQRAMDQIIWPTVRGMAAEGNTYVGFLYAGLMISADGQ
FT                   PKVIEFNCRFGDPETQPIMLRLRSDLVELCLAGAEGKLGEKTSEWDERPALGVVLAAGG
FT                   YPGDYNNGEVIQGLPQQESADGKVFHAGTRMQGNDVVTSGGRVLCVTALGESVAQAQQR
FT                   AYQLAEGIQWPGSFSRKDIGYRAIARGK"
FT   gene            complement(334269..335858)
FT                   /locus_tag="Spro_0293"
FT   CDS_pept        complement(334269..335858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0293"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: yps:YPTB0300
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39403"
FT                   /db_xref="GOA:A8G8G3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8G3"
FT                   /protein_id="ABV39403.1"
FT                   /translation="MQQPRPIRRALLSVSDKAGIVEFAEALSQRGVELLSTGGTARLLA
FT                   DAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMGQHDIKPIDMVVVN
FT                   LYPFAQTVARPNCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYAAIITEMDNN
FT                   DGSLQYTTRFDLAIKAFEHTAAYDSMIANYFGALVPAYHGDTEQPAGRFPRTLNLNYIK
FT                   KQDMRYGENSHQQAAFYIEENVQEASVATAEQLQGKALSYNNIADTDAALECVKEFAEP
FT                   ACVIVKHANPCGVAIGDDILSAYERAYQTDPTSAFGGIIAFNRELDAATAQAIISRQFV
FT                   EVIIAPSISQEARSLLAAKQNVRVLACGQWQQRIAALDFKRVNGGLLVQDRDLGMVSEG
FT                   DLRVVSERQPTAQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVKGSAMASDAFFPFRDGIDAAAAVGISCVIQPGGSIRDDEVIAAANEHGI
FT                   AMIFTDMRHFRH"
FT   gene            336532..338066
FT                   /locus_tag="Spro_R0015"
FT   rRNA            336532..338066
FT                   /locus_tag="Spro_R0015"
FT                   /product="16S ribosomal RNA"
FT   gene            338141..338217
FT                   /locus_tag="Spro_R0016"
FT                   /note="tRNA-Ile1"
FT   tRNA            338141..338217
FT                   /locus_tag="Spro_R0016"
FT                   /product="tRNA-Ile"
FT   gene            338255..338330
FT                   /locus_tag="Spro_R0017"
FT                   /note="tRNA-Ala1"
FT   tRNA            338255..338330
FT                   /locus_tag="Spro_R0017"
FT                   /product="tRNA-Ala"
FT   gene            338536..341444
FT                   /locus_tag="Spro_R0018"
FT   rRNA            338536..341444
FT                   /locus_tag="Spro_R0018"
FT                   /product="23S ribosomal RNA"
FT   gene            341546..341661
FT                   /locus_tag="Spro_R0019"
FT   rRNA            341546..341661
FT                   /locus_tag="Spro_R0019"
FT                   /product="5S ribosomal RNA"
FT   gene            341925..347828
FT                   /locus_tag="Spro_0294"
FT   CDS_pept        341925..347828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0294"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   type I phosphodiesterase/nucleotide pyrophosphatase; KEGG:
FT                   fno:Fnod_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39404"
FT                   /db_xref="GOA:A8G8G4"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G4"
FT                   /protein_id="ABV39404.1"
FT                   /translation="MNNEYTKTVFEGNTADKADTLLARIDFNTEINDVSGSDNIEKVEG
FT                   NIILVKNNIGQNGYFENGTISLVRDGFLFSTDRDFSLSFWIKSGSSSDGVIISNKNWGK
FT                   GSNIGWLVGINHDYLVCNWKGVSGSRLDVGAEQNIKVADNQWHHIAVTFDRQGDAIFYK
FT                   DGDQVYNINISNSGSIDSGYTTVIGADALGQYPLKGCHLDEIEIHDKVLTQEDIKQKFY
FT                   DLKDKLQKPLSVFMNFEGDLKDSSGQSNDGIATGDIGFVRGFDGLAAKLEKSYITLPQS
FT                   ELFPALDGDFSVSFWVKANAQYEGVIFSNKDWRVGGNIGWVIGISGKSLRWNWQGAYGR
FT                   RLDMADIPIADFKWHHVAIAHDRSRDAVFYLDGQEQSRVTIANSGHTNTHLDFNIGADG
FT                   RGEYRLANTFLDRVNITNTIISAQQARQEYDEYYEKLTPAPISLHYDFNDHLNDASVNG
FT                   YDAVIHGKEEYVSGFANSAFLFNGDSFITIPNPELQNDLSGDFSLCFWIKAPTGNKEQT
FT                   IISNKDWNSGGNPGWQLGIHKNALSWNWKGDSAGRYDLADDYPIYVADGRWHQITVSHD
FT                   RFGNACFFKDGVLKQQIDIRFSGDTATALDIAVGADAMGQYRLSNETMIDELRIINRAV
FT                   DRQEALALYEEYRDLIVKPLTEKFSGSLKFVGAEQTVTDSAFTLNLHLRTNNMENVIDD
FT                   CTSELHYDSSLFEFIEAVGRDISARVTANGVLKVSVYGGRTFNNTDPLDWQKTKVGELR
FT                   FKTTAAAGAGEFSLSNCQFYENGRLYQIDSLDVETHHLTINEALSLDANQDGVITLGDI
FT                   IGLPHDRQVHVAEQLAFMPYKRVLFIGLDGAGAGVSMQAPYWPSVESKKETVGDRLHIP
FT                   YLRKMIEQGAVTYTAQSVMPSDSAPNWGAILTGVDTSKHGVTNGVAAEYYYPENSLYPT
FT                   LFKRLRQAMPNRKLAAYVSWDAIANSLIEPSLGVECVKDYDAAIVEKVTAYIAGGKMKD
FT                   TAFMMVHLSNIDLAGHSKGYYGPDYYRAMTTADGQVEKIISELERQGLCEDTLVIISPD
FT                   HGGGTEQVDGTQTQNFSHGQNSALARTVFIAANGRTVARETAGEKTLLGGSTKDIAAMV
FT                   CHALNIPQTSDEVGLRNMFMRQDELSDADLPEWVMTQVVNTPSNSVGSYQLMLANGSDD
FT                   ICAADITIEVDNTQIEQVIPLLADIRLLRKEFAAEKLRLVFVSDQPLPAGQALFTFTTR
FT                   RHSPQYGLQIKDAMVANQQGHETLPGLTQQTLTQGDPLGITLSQETVTLEMGKQFTLIA
FT                   GIKGVQADDLKWKNTRQDVVILQANETICTVNALKPGFTKITVESVDGAYSAECDVTVI
FT                   APLTLDNEGFTDKSRWLMGSATPGSKLEVTTENGASIFGSVADDGRFHLELPSLLEHSQ
FT                   FYIQETYPQGTKGERHSFEVRPSYNLLWDINAQASASSVWFKQPQYGADKAIDGDAGSR
FT                   WASHNDPLPAWLVVDLGAEIDFDLVRIKEYESRVAAFTLEILQNGQWLPVYQGTTLGQN
FT                   AQLYFPRVKASQIRLNITAASDSPTIYELQIFDTANPPVREISDSALIALETRKSFNFF
FT                   WEMANSDPASPGYGLVSDAKPSAICNVAQVGFALSAIPIGVNNGWITWDEGAARTLGTL
FT                   NMLLNNVDQHRGFFYHFLNKWTGKRAWNSELSTIDTTLALNGVIVAGEFFGGEIKQMAD
FT                   QIYHKVDWEWFRDPITNQFYMAWYPENGGGFNEYKWSGPVEQASMYVLAAGSPTHPVNG
FT                   DMFYSINRAKRSYRGSEPVFDTWFGSSFTNQFSNAWVDFRGKVDKLGDDWFNDAVLNSQ
FT                   ISRQYSIDEQDNFKTFGPDSWGLSAAPGPDGIYHGTYGAPPATAASTDGTMVLSGAVGA
FT                   IVFTPQASLAAMQNYYRNHPYTWGKYGFKSGYNLDVKPYWYSSSVNGLEKGISVVMLEN
FT                   YRTGIIWRLYMQNEAIKRGVAAIGLTARNEVSGE"
FT   gene            complement(347914..349566)
FT                   /locus_tag="Spro_0295"
FT   CDS_pept        complement(347914..349566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0295"
FT                   /product="Cation/acetate symporter ActP"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   Cation/acetate symporter ActP; PFAM: Na+/solute symporter;
FT                   KEGG: yen:YE0307 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39405"
FT                   /db_xref="GOA:A8G8G5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G5"
FT                   /protein_id="ABV39405.1"
FT                   /translation="MKPLLSVAALLMLPGLAFADAISGEVHRQPLNIQAIVMFVLFVGA
FT                   TLYITYWASKRTRSRQDYYTAGGKITGLQNGLAIAGDFMSAASFLGISALVYTSGYDGL
FT                   IYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLKQKPIRTLSACGSLVVVALYLI
FT                   AQMVGAGKLIQLLFGLNYHVAVILVGILMVLYVLFGGMLATTWVQIIKAVLLLAGASFM
FT                   ALMVMKSVNFDFNTLFAEAVKVHPKGIAIMSPGGLVSDPISALSLGLALMFGTAGLPHI
FT                   LMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNPAFKDATGALLGGT
FT                   NMAAVHLANAVGGNFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKNGKATE
FT                   RDELRVSKITVVILGIVAIALGILFEKQNIAFMVGLAFSIAASCNFPIIILSMYWSRLT
FT                   TRGAMIGGWLGLLTAVILMILGPTIWVQILGHEKAIYPYEYPALFSMIVAFVGTWLFSV
FT                   TDSSLAGQQERERFRFQFVRSQTGLGISQGSSH"
FT   sig_peptide     complement(349507..349566)
FT                   /locus_tag="Spro_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(349563..349874)
FT                   /locus_tag="Spro_0296"
FT   CDS_pept        complement(349563..349874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0296"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   yen:YE0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39406"
FT                   /db_xref="GOA:A8G8G6"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G6"
FT                   /protein_id="ABV39406.1"
FT                   /translation="MNDTIYQGIEENPRFIELVRKRSRFAWLLSLITLALYVSFILLIA
FT                   FDPQWLGTPIAEGSTITRGIPVGVGLIVISFVLTGIYVFRANGEFDRLTAEVLREVKK"
FT   gene            complement(349967..351925)
FT                   /locus_tag="Spro_0297"
FT   CDS_pept        complement(349967..351925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0297"
FT                   /product="acetate--CoA ligase"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: yen:YE0309 acetyl-coenzyme A
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39407"
FT                   /db_xref="GOA:A8G8G7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8G7"
FT                   /protein_id="ABV39407.1"
FT                   /translation="MSQVHKHAIPSAIAEHALINPTQYQQYYQQSVQDPETFWGEQGKI
FT                   LDWIKPYSRVKNTSFDPGHISIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPTQ
FT                   SKQVTYKQLHHDVCQFANVLKKLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIF
FT                   GGFSPEAVAGRIIDSNSKLVITADEGLRAGRAVPLKKNVDDALKNPGVKSITNVVVFQR
FT                   TGKPGYWQEGRDLWWHELTAGVSADCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYAAMTFKYVFDYHDGDVYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVN
FT                   RLSQVIDKHQVNILYTAPTAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYY
FT                   NKIGNAKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNIGTVQEG
FT                   ACEGNLVITDSWPGQARTLFGDHDRFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYITLNHGEEPTPELY
FT                   TEVRNWVRKEIGPIATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADP
FT                   AVVDKLLEEKQSMKVPS"
FT   gene            352747..354063
FT                   /locus_tag="Spro_0298"
FT   CDS_pept        352747..354063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0298"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   yen:YE0310 proton glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39408"
FT                   /db_xref="GOA:A8G8G8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G8"
FT                   /protein_id="ABV39408.1"
FT                   /translation="MKSVKISLAWQIMIALALGIIVGAVLHNQTESREWLVSNILSPAG
FT                   DIFIRLIKMIVVPIVISTLVVGIAGVGDAKKLGRLGLKTIIYFEVITTIAIVVGLTLAN
FT                   VFQPGHGIDMSTLTAVDISQYEKTTEQVQSGSHSLVATILSLIPSNIFASMAKGDMLPI
FT                   IFFSVLFGLGLSSLPKETKEPLLKVFKAVSESMFKVTHMIMRYAPIGVFGLIAVTVANF
FT                   GFASLLPLAKLVLLVYFAIAFFALVVLGAVARICNLRIWTLIRILKDELILAFSTASSE
FT                   TVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSLGQE
FT                   IVLVVTLMLTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVVAKWEHQFDSKKALAFEKEFLSGKARQITDS"
FT   sig_peptide     352747..352833
FT                   /locus_tag="Spro_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.543 at
FT                   residue 29"
FT   gene            complement(354129..354878)
FT                   /locus_tag="Spro_0299"
FT   CDS_pept        complement(354129..354878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0299"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: Peptidoglycan-binding LysM; peptidase M23B;
FT                   KEGG: yen:YE2451 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39409"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8G9"
FT                   /protein_id="ABV39409.1"
FT                   /translation="MGSTFAVWRLIAVCVISLGLLGCGSGKKSNSYDRDYDRLARGSYN
FT                   GNTYTVKRGDTLFYIAWITNSEVSELARRNKIPKPYNLEIGQKLALNNATAKKGKTRKT
FT                   QSTSQIAAVAPPIRSSIKCWRWPTQGNIISKYSTADGGNKGIDIAGNRGQPVFAAAKGR
FT                   VVYVGNQLRGYGNLIMIKHNDEYISAYAHNNTLLVRNAQEVKAGQKIATMGSTGTDKVM
FT                   LHFQIRYRATALDPLRFLPAQGSAPSC"
FT   gene            355043..355789
FT                   /locus_tag="Spro_0300"
FT   CDS_pept        355043..355789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0300"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   yen:YE3446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39410"
FT                   /db_xref="GOA:A8G8H0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H0"
FT                   /protein_id="ABV39410.1"
FT                   /translation="MQETLTLSGYLVLAATLLVAYVIFGIAGFGSALVASPIMALYMPV
FT                   AKIVPLLALLDMCAAIVNVSRDGRNAQWPELKRLVPLMIIGSLLGAAILLKTRPEILLL
FT                   ALGIFVVFYALYSLSGLKPARQFSPRAAVPFGLVGGIFSALFGSGGFIYAIYLSGRIEK
FT                   KEAFRITQTTLIGMSTLTRVVIFALAGVYLDVDLLLLALVLVPGMLVGITLGRYFTLKM
FT                   SREQFLKLINVILLASGAMLIIKYFS"
FT   sig_peptide     355043..355147
FT                   /locus_tag="Spro_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.565 at
FT                   residue 35"
FT   gene            complement(355873..355948)
FT                   /locus_tag="Spro_R0020"
FT                   /note="tRNA-Phe3"
FT   tRNA            complement(355873..355948)
FT                   /locus_tag="Spro_R0020"
FT                   /product="tRNA-Phe"
FT   gene            356010..356936
FT                   /locus_tag="Spro_0301"
FT   CDS_pept        356010..356936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39411"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H1"
FT                   /protein_id="ABV39411.1"
FT                   /translation="MENIVTKATTASISTKPQIVPMVSTKGGEGKSTQSANLAGFLADA
FT                   GKKTLLIDGDHSQPTASSIFSLEYEAPYGLYELLMKTVDLNHSEQIISRSVIRNLDIIV
FT                   SNDPHDRLSSAMLHAPDGRMRLRNVLQHPLFNEYDAIIIDSKGAASVMLELILVASTEF
FT                   AVGVIKPILPDTREFLRGTLGLMEGLLPLTCYGIALPRIRILTNCMEYTNLDWQTLESL
FT                   RSIITNGQYLRADAFDVSLLDTIIPKLEIYKMGHASGQPVHRLEKTTTRTSTPAAAATM
FT                   HMLACELFPQWQSNFDALLAGKSEVQP"
FT   gene            356933..358288
FT                   /locus_tag="Spro_0302"
FT   CDS_pept        356933..358288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0302"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: plu:plu1031 unnamed
FT                   protein product; similar to DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39412"
FT                   /db_xref="GOA:A8G8H2"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H2"
FT                   /protein_id="ABV39412.1"
FT                   /translation="MNQTTSNVPYSSDAEQAVLGGLMLDNERWDDVLPLVGERDFHLAV
FT                   HRRIFQAMARLMAVQQPIDLITLHESLEQNGELEQVGGFAYLAELSKNTPSAANIVAYA
FT                   EIVAERSRLRSLLQLGRELSADAANPRAESSALTERAEQQLFQLSEQTQSEQNVSLTVG
FT                   LNAVVTYLETANGGNGITGTPTGFSRLDEMTCGLQPGDLILIAARPSMGKTAFALSTYT
FT                   GALRGTEKPAFFFSLEMPREQLLQRLIAVDGRVELSRLRSGQLEDEDWARISNAMERLL
FT                   PLENRLIIDDESFLTPALLRSRARRYTRLYGKPGLIMVDYLQLMRCPGQENRTQEIAEI
FT                   SRSLKALAKELDCPVVALSQLNRQLESRADKRPFNGDLRDSGALEQDADVIAFIYRDEV
FT                   YYADSDDAGTAEIIIGKQRQGATGTVRVKFEGQFTAFSDLHDGQYDQYSGRA"
FT   gene            358291..360027
FT                   /locus_tag="Spro_0303"
FT   CDS_pept        358291..360027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stt:t4228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39413"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H3"
FT                   /protein_id="ABV39413.1"
FT                   /translation="MARPKTKILDLNSALLQQGKTAAGTQPLAPVVAETPVSEMPLVLT
FT                   LDEVNPNPDNPRTSRNPKYEEIKSSIRARGLDTVPKVTRDPERPELGYFFSDGGNTRYA
FT                   ILSELWQETGEERFYRFSCVFKPWPGRLSCVIGHLAENEVRGDLSFIEKAFGIRQAREL
FT                   YEAQLGKPVSLRELSTLLTAEGYSVHNSSISRMEDAVQYLYPYMPHLLETGLGRPQILQ
FT                   LLAMRSHAETTWQKHCITQDSDQPFDTVFGDVCRHFDSPEVYSLDMFRDELIGALIKAL
FT                   PHPLLNYDRWLLELDPKEQNRRKHLGEPTSTPELPDKASTVVLAPELQQEENGGLPSTE
FT                   SEVPGGGSSLVLDSALLESAGDSDNESQGVQDEEIPSSQTEPRVETQPDLYGASSVLSG
FT                   DVETLLDGENTTVNDPLLPGSHAPHNNIETQPKQAVAPVVEVPFAEVGLEPVSSIWAIS
FT                   ALQDDIEHLQVITFRLAFELAEVAGCEAEIKADKADLQAAGYALTAERPSRFTALLLTL
FT                   AGNNPDGAGTSSLNEALIGSENAADWPLLDDIHAVKLMRLIRVLRRLRELQRDLPASEE
FT                   TA"
FT   gene            360027..360572
FT                   /locus_tag="Spro_0304"
FT   CDS_pept        360027..360572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39414"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H4"
FT                   /protein_id="ABV39414.1"
FT                   /translation="MSHSQRQTRLVKLVRKLLELAHSNSNAHEAGLALARAQKLMAKYG
FT                   ISELEANLSSIQTAPSQGAPSEAQKLQEWMISLVWAVSRAFGCRPYFSWRDTPSGQRRN
FT                   VTFYGFSERPAVAAYAFDVLSRQLKESTADYLKTQNSRLKLSTRRAVSGRLGAWCTESH
FT                   FQFPGTRQRAAIDDDLDC"
FT   gene            360736..361365
FT                   /locus_tag="Spro_0305"
FT   CDS_pept        360736..361365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39415"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H5"
FT                   /protein_id="ABV39415.1"
FT                   /translation="MSNSLSQATNSLLTQLVMELKSGYIRRCESLGLTTEEMQLLHGLT
FT                   IEDLHYLMNSSVSVLTFQIHHENFSLMLQHARREQQRMQRIDRALALGGSIEMMQHYFG
FT                   LSTVEVAARRRMTGINIRQGRCAALSDDENAALWRQWQKADVDDASSADGLDVMMLAAE
FT                   QMDVSLTAVWHAVRSFDAPQTATARKAIQAVRTPRGTPGGNARRLA"
FT   gene            361362..361625
FT                   /locus_tag="Spro_0306"
FT   CDS_pept        361362..361625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0522A hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39416"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H6"
FT                   /protein_id="ABV39416.1"
FT                   /translation="MKPVILMPGLQVPRSAPPSCQKKAKEQVRRFRSGERNYKQLHVKG
FT                   KHAPGRAWMKIDIGTSWRLLSRNSGDDWELLTHERYNNELWK"
FT   gene            361740..363011
FT                   /locus_tag="Spro_0307"
FT   CDS_pept        361740..363011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H7"
FT                   /protein_id="ABV39417.1"
FT                   /translation="MSIKTPDDSLITFTLEQMNARLAERIGAEKHAGAPDVTNLRSGLL
FT                   FMGNVHDSIPRRLLLDTRLSPLDKTAWIMIRLYAQQNQGAVFPTYDELQLQLASPFNGK
FT                   ASRETVSRVLLMLRLTGWLSLCRRVRDDKGRVKGNIYAQHDEPLSARDAETLDPTWLDT
FT                   VAMGCAHKNRTVSQTAWSVLSDIQNDPTMRHQHSQMAAIAERLGSPQTPQQMAARVSQW
FT                   QDNSPSSDVELRKKSPNSDAELSRYTPGSDTELSVKQGSKTPSSFSELILESATYGAST
FT                   QPNCNVRSFTQSVNKTTYVPELPSELQSSMAADDLRQIGVQLKALPAETARQVLESLEQ
FT                   TMARGNLNNPTGWLLAVIKRARNGELYASAKSPEPARPVPAHQIPCSMAPAKPTGPVRE
FT                   QLASRDHVSDVVAKLRQKMMRATK"
FT   gene            363199..363942
FT                   /locus_tag="Spro_0308"
FT   CDS_pept        363199..363942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0308"
FT                   /product="Domain of unknown function DUF1845"
FT                   /note="PFAM: Domain of unknown function DUF1845; KEGG:
FT                   plu:plu1036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39418"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H8"
FT                   /protein_id="ABV39418.1"
FT                   /translation="MVDSSGSKENKPSPARAGALKSTLTVQLHTQYAILLWEGRQREKE
FT                   SNKPQIVSMPQVIARAGKINADSNTDNPYADSAMLSLEQAIERGTARLQSAVAGLDAVL
FT                   SSLPGQVSMSEVSSVSPLNIGVFSRTPLGYRCVWLLVGFDQLAMKAFQAWHYGLISRQK
FT                   RDDLLSQGGHWVRQVYGVVQQYRSVAVTRDDIRLQTQVGIDAVKRLGEPDADIMSGKSR
FT                   SAFSPPLNKTSVLTPSISSKKGAKA"
FT   gene            363939..364514
FT                   /locus_tag="Spro_0309"
FT   CDS_pept        363939..364514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39419"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8H9"
FT                   /protein_id="ABV39419.1"
FT                   /translation="MNMNRQVKSVLMPGVLCTALLLTGCAGTELGEWNQKISDAAHSLA
FT                   SGGSGGSSEGSMPWMTRAGISGGRQDVRHTYTLSVDVDTAAARLKSHYQFISSEELESL
FT                   RQRDQHGDWSASSIDEARPVWSANRGSYYKMGQEWKGNDRLELEVVKSGTGSRLKVTYS
FT                   SPDASHLTDAYLDRLMTQLQQVAKGQLG"
FT   sig_peptide     363939..364034
FT                   /locus_tag="Spro_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.507 at
FT                   residue 32"
FT   gene            364529..366568
FT                   /locus_tag="Spro_0310"
FT   CDS_pept        364529..366568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0310"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: plu:plu1037 unnamed protein product; similar
FT                   to DNA topoisomerase III; TIGRFAM: DNA topoisomerase III;
FT                   PFAM: TOPRIM domain protein; DNA topoisomerase type IA
FT                   central domain protein; DNA topoisomerase type IA zn finger
FT                   domain protein; SMART: DNA topoisomerase I ATP-binding; DNA
FT                   topoisomerase I DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39420"
FT                   /db_xref="GOA:A8G8I0"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I0"
FT                   /protein_id="ABV39420.1"
FT                   /translation="MQLYLCEKPSQGKDIGAILGATQRKQGYLAGAGVIVTWAIGHLLE
FT                   QAQPETYGEQFGSPWRESVLPIVPTQWKMAVKKDTADQFAVIRGLLKQVDSVVIATDAD
FT                   REGEVIARELLEHCHFTGPVQRLWLSALDEASIRHALANKLPGEKTAPLYEAGLARSRA
FT                   DWMTGMNLTRLYTLKAREQGYGEVLSIGRVQTPTLALVVNRDRDITNFISKPYWQVRAT
FT                   LQKGGITFPANWVPAANYCDEEKRCIQQNVAQAVVQRCQQTAHAVVLEVGTERKKESAP
FT                   LAFDLGTLQQACSRKWGMSANQVLSIAQSLYETHKATTYPRTDCGYLPTSMREEVADVL
FT                   SAVTRTDPTLNESVARLDRAFVSRIWNDKKITAHHGIIPTKQPFDLSKLSADELKVYQL
FT                   IRQHYLAQYLSLHEVDVTEATFNIGGQLFRTRGKVEAVAGWKVLFQHDVSEAKEEPADT
FT                   DDVRLPALVKGETVAVAGAELKTLQTKPPGHFTDGTLIAAMKNAAAFVSDPQLKKVLKE
FT                   NAGLGTEATRAGILDTLFKRGYLEKKGKYLLSTPIAGELIDALPTALTNPGMTALWEQA
FT                   LDEIAQGQMTLDTFMSRQAQWTGHLVEKGKTQAVKFTAPPSPPCPTCSGSMRRRAGKKG
FT                   GGAFWGCSNYPTCQGVINIDAKGGRKAKRYKAKSPTKNKATGSE"
FT   gene            367237..367704
FT                   /locus_tag="Spro_0311"
FT   CDS_pept        367237..367704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39421"
FT                   /db_xref="InterPro:IPR021960"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I1"
FT                   /protein_id="ABV39421.1"
FT                   /translation="MSSQTQQASTKTEYFNLTIKGMGYLSNIRQVNGPNGTFISCVVNG
FT                   LSGPTDNASYTRFDVTVAGKEASSLINRCQKSVDEDKKVLIGFVLSNLKPDIFTLNSGE
FT                   HAGEQRVSLKARLIKVDWIKIGQEKVFQAEKSDSTPPQQGSAQQQYAENSF"
FT   gene            367777..368283
FT                   /locus_tag="Spro_0312"
FT   CDS_pept        367777..368283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0312"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: yen:YE3844 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39422"
FT                   /db_xref="GOA:A8G8I2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I2"
FT                   /protein_id="ABV39422.1"
FT                   /translation="MESRGVNKVILVGHLGQDPEVRYMPNGGAIANITLATSESWRDKA
FT                   TGEQKEKTEWHRVVLFGKLAEIAGEYLRTGSQVYIEGSLQTRKWTDQAGVEKYTTEIVV
FT                   NIGGTLQMLGGRSQPANGAQSGQGSWGKPQQPQPSHSGTPAQQPQPAQSGGNSAPMDFD
FT                   DDIPF"
FT   gene            complement(368618..368785)
FT                   /locus_tag="Spro_0313"
FT   CDS_pept        complement(368618..368785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ent:Ent638_1532 helix-turn-helix-domain
FT                   containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39423"
FT                   /db_xref="GOA:A8G8I3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I3"
FT                   /protein_id="ABV39423.1"
FT                   /translation="MRLAGHWIIHDKISIDTVALRLGYASQAALSKAFSASMDIHRALC
FT                   GNVQREALIK"
FT   gene            368807..369052
FT                   /locus_tag="Spro_0314"
FT   CDS_pept        368807..369052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39424"
FT                   /db_xref="GOA:A8G8I4"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I4"
FT                   /protein_id="ABV39424.1"
FT                   /translation="MGTLLDGVMVVTAIAASVVMIDSYALINRMGSGEAWTDLCNECLQ
FT                   KIDNAWGRMTENQKVFLGAGAPFSVKACGPYDGMLA"
FT   gene            complement(369227..369493)
FT                   /locus_tag="Spro_0315"
FT   CDS_pept        complement(369227..369493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_1587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39425"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I5"
FT                   /protein_id="ABV39425.1"
FT                   /translation="MKDKHQETEALKDVLAEMQRQDAKWGADRNLDPFIWGAILGEEVG
FT                   EFHQAVLHDRFGGKAAGTSREEAVQIAAVALQIIEYYDRVQTR"
FT   gene            369639..369965
FT                   /locus_tag="Spro_0316"
FT   CDS_pept        369639..369965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0316"
FT                   /product="killer suppression protein HigA, putative"
FT                   /note="KEGG: mca:MCA0276 killer suppression protein HigA,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39426"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I6"
FT                   /protein_id="ABV39426.1"
FT                   /translation="MFITFQSKKLRALCESMHNANENLGEKLASKLRARLSDITVADNI
FT                   LALPVGSPEVCFEEGEECITITLFGDKKMGFVCGNTVQPKNQDNTIDWSQVSRIRLVFI
FT                   GDVK"
FT   gene            369962..371044
FT                   /locus_tag="Spro_0317"
FT   CDS_pept        369962..371044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0317"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bxe:Bxe_A0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39427"
FT                   /db_xref="GOA:A8G8I7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I7"
FT                   /protein_id="ABV39427.1"
FT                   /translation="MMVTQDFQPDWVSPPGDTIIDLMDEYGISDEELSKKIGLSLDRGQ
FT                   QLLEGKLRLNPSLADKLEELFSVSTDFWIRREDAYRQQIEHIQKVNSDWLESLPVRDMM
FT                   EFGWIPRTTTRESKFRHCLSFFDIHSVNEFFHKIHSDAPLVAFRKSLNLTTEPVADLVW
FT                   LTRAEQLSAKQVCAEWNKKALQALLPELRRATNEPDMGIFIPHIRRLLATAGVSLIVLP
FT                   TPRGCRASGATCFFTPDRATLVMSFRYLTDDHFWFTLFHEVGHLILHEAVRVRAEGKEG
FT                   LTTEEEKEADMFAVDVLIPEEYRQQLRRYGVRHWRDIVRTARKMGVSKGIVLGYLQHEG
FT                   NIPFSHLNRLKVRFSKEDIV"
FT   gene            complement(371047..371991)
FT                   /locus_tag="Spro_0318"
FT   CDS_pept        complement(371047..371991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39428"
FT                   /db_xref="InterPro:IPR041271"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I8"
FT                   /protein_id="ABV39428.1"
FT                   /translation="MNRHSQASQLVAALQNFSRDEHPLNGLSSPAHYNVLAFQIIDSIR
FT                   RIRYMATLTSRTDYMDPLRKEPNSDLFDPLRAACLHLRDNNYDEACWLVFLATHFGRSN
FT                   KTGWVLCRDIYSGLGTQTWTWDAITDDFDAFEQWFASVSDELTLHSSLRQYGNHRKYET
FT                   KKYHSRRSIPVVFRSYLGFIGATYSHEARFAEARSFTATPATLFELLYSGLNAVVSFGR
FT                   TARFDYLTMLRKTGLIEAEPGHAFLKGATGPLQGSRLLFSNSRSAGDRLEALNDKLAEL
FT                   AEIIPAPYLRMQVIEDALCNWQKSPDRYVYFGG"
FT   gene            complement(371991..372968)
FT                   /locus_tag="Spro_0319"
FT   CDS_pept        complement(371991..372968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0319"
FT                   /product="thymidylate synthase"
FT                   /note="PFAM: thymidylate synthase; KEGG: bxe:Bxe_A0214
FT                   putative thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39429"
FT                   /db_xref="GOA:A8G8I9"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8I9"
FT                   /protein_id="ABV39429.1"
FT                   /translation="MTLLVTAECVDDLLNDVHQAILTDGLWNTPTKGANIEILGAYLIL
FT                   TDPRRRISRTESRGKIISCLGELLWYLSAQNDLDFIRHFIPRYVKYAESDGRIHGGYGP
FT                   RLFSMHGLYNQLENVISLLQEKRTTRRALIQLFDASDLVTDNPEQTEYADIPCTISLQF
FT                   IVRQDALHLFVCMRSNDAFMGLPHDVFAFTMLQELVARLTGCKLGHYHHFVSSLHIYEE
FT                   HFEQVKALQQEGFMSTLPVMGDMPEIQSLKDITVILEAEKALRENKEFDIDTMPLSDYW
FT                   KDMLRVIKTHFLLRSHTSAHDELARQELTALNNQEYRFIFDGKI"
FT   gene            373757..374401
FT                   /locus_tag="Spro_0320"
FT   CDS_pept        373757..374401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0320"
FT                   /product="type IV B pilus protein"
FT                   /note="KEGG: pap:PSPA7_4470 type IV B pilus protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39430"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J0"
FT                   /protein_id="ABV39430.1"
FT                   /translation="MKKTILVSSLAALMLTGCVTQQPLQQRDISPVTPSVTVNRNVQPV
FT                   SPDAYGQVPEVVRYDRYLLVSTDPAAVQRDPLSQVIDIRIPASVKPTVADALRYALRQS
FT                   GYSLCATGPANGVLYRQALPAVQYQLGPMRLRTALQVLAGPAWQLEVDDVQRVVCHSLR
FT                   DGYQLPATQLPPVMEVPGKAILVPVSARPAATVIAPQAVNAVPATGGWLKK"
FT   sig_peptide     373757..373822
FT                   /locus_tag="Spro_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.635 at
FT                   residue 22"
FT   gene            374398..375141
FT                   /locus_tag="Spro_0321"
FT   CDS_pept        374398..375141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0321"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t4255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39431"
FT                   /db_xref="GOA:A8G8J1"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J1"
FT                   /protein_id="ABV39431.1"
FT                   /translation="MTEHNEEMVPMTPAKKGLLRSKTFWGATAGVVAILVAGLVGTGAI
FT                   NHVDQRIAQLEQAQKALAPQDGMNSMADVVQTHAKQLKSLAERQASLMRQIGALTLTNG
FT                   LPEKLEQQLQAQQVELNVLKDSIESVKKSATEKPASTVAPSTSVPAAPSATAKITPKHK
FT                   PTPIKSSPRNAVRRVVSKAPFVLTGVEQRGTSALAAVAPQGFSDLSQVRLIGEGESVAG
FT                   WTLVSAGYGQATFRVNGRLQTVSAQ"
FT   gene            375152..375862
FT                   /locus_tag="Spro_0322"
FT   CDS_pept        375152..375862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39432"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J2"
FT                   /protein_id="ABV39432.1"
FT                   /translation="MKLKYHMVALMLLSPLSQAAQQTAIENSQSTLSQLQQSQDNKTAE
FT                   QGKQWGISGEEYQRYQQLMDGPRGTQSPGLDPLTALGIEAQSDAERKKYAEQWVKQEFV
FT                   RTEKELKFQREVDAAWQRLGVLPVNMGNAAGIAHDTGGRLALFVKAKDCGQCDARLAAV
FT                   LADNRPVDIYLVDSKGNDSLLRDWAREHHIPIDKVRARQITLNHDGGRWMKFGNGLMPV
FT                   VLQQGENGWTLAAF"
FT   sig_peptide     375152..375211
FT                   /locus_tag="Spro_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 20"
FT   gene            375841..376533
FT                   /locus_tag="Spro_0323"
FT   CDS_pept        375841..376533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0323"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   eca:ECA0556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39433"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J3"
FT                   /protein_id="ABV39433.1"
FT                   /translation="MDTRRVLTRGLLPLLAFLTSVGGGAVHAATQQVPSGYREVALRHG
FT                   VPPESLYSVALAETSMAPKSIVSVTRGAGPAPDVERPWPWTINVAGKGYRYASRLQAWE
FT                   ALQRFLKTHPRKRIDVGIAQVNLGWNGHHFTSTWAAFDPYTNLNAAAAILRECYDRNPG
FT                   SWLTAAGCYHHPAGGAPAARYKSIVSGKLARLNGRASDLPRVASTTPTATTLPAQTAAL
FT                   TWIEPRSQ"
FT   sig_peptide     375841..375927
FT                   /locus_tag="Spro_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            376536..377060
FT                   /locus_tag="Spro_0324"
FT   CDS_pept        376536..377060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39434"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J4"
FT                   /protein_id="ABV39434.1"
FT                   /translation="MKKVNFLLFGLSLVTTAALANLNVIADVGGEDASPYFEGINRQEG
FT                   AQSSPVAPPAPASPADTEAAVLPVATPELTPGDVADRPLQLPGIGALFIVGDDDDSRIW
FT                   LKANAEQLKSRHAAGLVVNVSNLPALQALRELAPGVPMAPASGSELARRLQLAHYPVLI
FT                   TDTGLSQQVSP"
FT   sig_peptide     376536..376598
FT                   /locus_tag="Spro_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.805 at
FT                   residue 21"
FT   gene            377057..377647
FT                   /locus_tag="Spro_0325"
FT   CDS_pept        377057..377647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0325"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: eca:ECA0558
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39435"
FT                   /db_xref="GOA:A8G8J5"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J5"
FT                   /protein_id="ABV39435.1"
FT                   /translation="MMSAQHIVAALVGNPWLAAVLIELFVSVMAGLNCRGRETASHRRH
FT                   RRYQATAARVLQRLPQLAGDAQRLTYLRKINPYVFEELLLLTCERQGHPVKRNDSYSGD
FT                   GGLDGQVIIDGKKYFIQAKRYGRTITPSHIQDFGALLLKSRCEGFFIHTGRTGHLSRAL
FT                   LQNHTHVHLVSGQRLLDLLAGNPRWYEKGINRP"
FT   gene            377644..379758
FT                   /locus_tag="Spro_0326"
FT   CDS_pept        377644..379758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0326"
FT                   /product="putative plasmid transfer protein"
FT                   /note="KEGG: eca:ECA0560 putative plasmid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39436"
FT                   /db_xref="GOA:A8G8J6"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J6"
FT                   /protein_id="ABV39436.1"
FT                   /translation="MSNRHVMEALLRPAVELNTAIVAGAAAAICFVAPWSVALAPSVSY
FT                   VTAGGFAVLSAVRARQGLRVIRYRRNLRRLPRYVMTSAQIPVSRQRLFLGRGFRWQQKH
FT                   TQRLMDTRRPEVEKYVQPPQLYQMARRLELKTEYTLPWLSQLLRKDSPLNPVRPLPPVG
FT                   GNPAIHGIEPDELDVSMALGERVGHSLVLGTTRVGKTRLAELLITQDIRRGDITIVFDP
FT                   KGDADLLRRVWAEAHRAGRGDELFIFHLGWPDISARYNAVGRFERVSEVAGRISGQLSG
FT                   EGNSAAFREFAWRFVNIVARALVALGQRPDYTLITRYVNNISELYETYAKKVIETRMPA
FT                   LQQQIDNNLKVLTEEDVPRNMQGQPNAVKIFAVEMALSSEAGKQLYDPILDGLRSAVRY
FT                   DRTYFDKIVASLLPLLEKLTTGKTAELLAPNYMDMNDPRPIFDWEQVIRKRGIVYVGLD
FT                   ALSDGVVASAVGNSMFADLVSVAGHIYKHGMHGGLPTRADGRLPINLHCDEFNELMGDE
FT                   FIPLINKGGGAGMQVTAYTQTESDIEARIGSTAKAAQVTGNFNTLIMLRVRENRTAQLL
FT                   TTQLPEVDAYTKTLVSGHADTADVEKGQDFTSSTQDRVGTVKTPLLMPADVINLPKGQA
FT                   FALLEGGQLWKIRMPLPSGDGDDELMPPNLEKIAEEMQRNYRTSESWWSASTVMPDAVI
FT                   KGGLNVTSGE"
FT   gene            379739..380497
FT                   /locus_tag="Spro_0327"
FT   CDS_pept        379739..380497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39437"
FT                   /db_xref="GOA:A8G8J7"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J7"
FT                   /protein_id="ABV39437.1"
FT                   /translation="MSQAVNNQPQQPVQPRKHGLFYNVLWGWPWMLIGMFFASLLVSLV
FT                   IEYVGMAFFWPELGASHSEAVMHTEMGYLSSEFTRSLMLSEPSVTVTRWIGQAYQWTFV
FT                   DSGFLDWIQRAYDSQVHSQNAVARELNSWSGWLAATLKEYLVATVYVTVITLVRVTILV
FT                   LSIPLFILVVLVALTEGLGRRDIRRYGAGYESSFVYHHAKRMVKPAIYIPCMLYLSWPT
FT                   AVYPNLLLLPAAILLGIAVTVTTASFKKYL"
FT   gene            complement(380724..381341)
FT                   /locus_tag="Spro_0328"
FT   CDS_pept        complement(380724..381341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39438"
FT                   /db_xref="GOA:A8G8J8"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J8"
FT                   /protein_id="ABV39438.1"
FT                   /translation="MVQYSSDRNRKKHTQNPAGEIITMNTPTTELSITLIFTIITTGIA
FT                   VGVALALNDIGAAYRRGKYEDKLKKAIDLGRLENEDIYLLASRWVVKKEQITTVLHRLL
FT                   NEYVDSKECNVETLGRVRRLIDWHQKNDPFSDLPDDVRLQLQHIKTIAPDSQEEIIRLS
FT                   KSLSDIYISNQRQQKRDRRLAWSGLAIGVVGFGLTLWSFIKN"
FT   gene            381523..381855
FT                   /locus_tag="Spro_0329"
FT   CDS_pept        381523..381855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0329"
FT                   /product="plasmid conserved hypothetical protein RAQPRD"
FT                   /note="PFAM: plasmid conserved hypothetical protein RAQPRD;
FT                   KEGG: eca:ECA0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39439"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8J9"
FT                   /protein_id="ABV39439.1"
FT                   /translation="MRIPVVTRGLGAGFLLGLSFLIALPALAAEKDELASAQRMLVQVQ
FT                   AALERARVAAVQADPSERGRFFFDYARATADLKTINAGIDRYLEPSRAQPRDGSAVAGN
FT                   YHRERP"
FT   sig_peptide     381523..381609
FT                   /locus_tag="Spro_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            381855..382097
FT                   /locus_tag="Spro_0330"
FT   CDS_pept        381855..382097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39440"
FT                   /db_xref="GOA:A8G8K0"
FT                   /db_xref="InterPro:IPR021676"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K0"
FT                   /protein_id="ABV39440.1"
FT                   /translation="MAMTGAQQQAFNAASGGVEANILSLICIGGLLATLFVWAAWALTD
FT                   IWKGWSNQKIRNAAMVQFAVRLVLLLVVVTWMFAS"
FT   gene            382153..382518
FT                   /locus_tag="Spro_0331"
FT   CDS_pept        382153..382518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39441"
FT                   /db_xref="GOA:A8G8K1"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K1"
FT                   /protein_id="ABV39441.1"
FT                   /translation="MNAVVRLFRHLSACVAVATSLAYAASQPAQAALPSVEPPSSGGGG
FT                   GLMDTLKGYLQDGIVLVGLVLAAVAFIVVAQSAVSTFHEVREGKTNWGKFGAIIVVGIV
FT                   LVVAVIWLVGKSAEILF"
FT   sig_peptide     382153..382248
FT                   /locus_tag="Spro_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 32"
FT   gene            382530..382895
FT                   /locus_tag="Spro_0332"
FT   CDS_pept        382530..382895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39442"
FT                   /db_xref="GOA:A8G8K2"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K2"
FT                   /protein_id="ABV39442.1"
FT                   /translation="MQTIRFLPDRLNAEPVVFRGFTTPEMGLAALAGVGLGLLVSLPFF
FT                   PLAGWVVIPTGMLVTPLLVIWFGGSRLTRIKRGKPENYIWQRLEARKRRIGWGNPTLII
FT                   DKQGWSLRRSRVVKRSK"
FT   gene            382892..383563
FT                   /locus_tag="Spro_0333"
FT   CDS_pept        382892..383563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0568 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39443"
FT                   /db_xref="GOA:A8G8K3"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K3"
FT                   /protein_id="ABV39443.1"
FT                   /translation="MSRFRHAVKNRDQHILTLRVACGVLVVFLLVASIGWMRAPENLTI
FT                   HNPPDLRSGSTRAWWEVPPSTVYTFGFYIFQQLNAWPKNGEVDYPAKIAALSPYLTDSC
FT                   ARFLKADAKKRSESGELAGRTRVVFEIPEHGYNGRYNQSPVTVKGRDNWVVRLDLVADE
FT                   SFAGEPVKRALTRYPLKVVRAEGDPERNEFGLALDCYDSMPQRLAAAPAEPTPEKKGVF
FT                   Q"
FT   gene            383560..384471
FT                   /locus_tag="Spro_0334"
FT   CDS_pept        383560..384471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39444"
FT                   /db_xref="InterPro:IPR021844"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K4"
FT                   /protein_id="ABV39444.1"
FT                   /translation="MMKARVLALSLSVLPLAAMFTVPVAQAEELMKWERIPLQIPLAVG
FT                   KERVLFADKNVRVGFPPALNGKLRVQSSGGAVYLKADSVFPPTRLQLQDVENGEVILLD
FT                   VTALDKGSAEPVRIVYSGDVSSVSSSNDTSSVGNSSGSAAPGADDGTQAKRKKIKYNAP
FT                   LPVVLTRYAAQSLYGPVRTVEAVPSIHPVNPHLPKRITTLYPSEPVAIAPLGGWGIGSR
FT                   NVVALKVQNTASRKITLDPRVLQGQFVTATFQHRYLGPVGTPEDTTTLYLVTAGRPDGA
FT                   FVAEPSVVRKAVKAVKKGANHG"
FT   sig_peptide     383560..383643
FT                   /locus_tag="Spro_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 28"
FT   gene            384464..385960
FT                   /locus_tag="Spro_0335"
FT   CDS_pept        384464..385960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39445"
FT                   /db_xref="InterPro:IPR021207"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K5"
FT                   /protein_id="ABV39445.1"
FT                   /translation="MADVKSNMLPKVIVIGVLAASIVVGLKACKDDKTPEKPQQAHNVL
FT                   ANMSPEELRALGVEGDTPEDTLRTLVGTLRTTRTQQAELQSNIDKVLKENEALRKRNTN
FT                   VSGQVNEAVAGYQKQAQQRQQQLQQEQQTLMGKIQTLTEQLAGNKDKAKSDSDIPLGLG
FT                   LDGMGAGEGSAAPGQDGLMWVGPKDMKEPDPRNPNSAKDGPQFPTSFLSDNAITRQKAA
FT                   YEQQVKGRTNEKGAEENAEPVFTLPENSTLVGSRSMTALLGRVPINGTVTDPYPFKLMI
FT                   GKDNLTANGIELPDVEGAIVSGTASGDWTLSCVRGQVNSITFVFADGTVRTLPHPDTNM
FT                   KANSNNNSGNSGKDVSTTAGIGWISDDNGIPCIGGERKSNASTYLPTIAALSAASAAGE
FT                   GISQGQYTTQNNVNGITATMTGNAGQAVLGKALSGGMKETADWVRERYGMMFDAIYVPP
FT                   GQKLAVHITRQLAIDFETQGRKVRYDFSLPGEDGSTGGLD"
FT   gene            386110..386535
FT                   /locus_tag="Spro_0336"
FT   CDS_pept        386110..386535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0336"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: eca:ECA0572 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39446"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K6"
FT                   /protein_id="ABV39446.1"
FT                   /translation="MRKNLFNRVLATAVIVSVMALAGCSTSKEEMLPPGDSSMLELWQG
FT                   EDGGGSARNAVAARDSLRRPLTDNERQATAADDRSYSRTQESEISQQFPRLPNPDLVMY
FT                   VFPHLADGNAPVPGYSTVFPFYSQVQYAMPGERTEAY"
FT   sig_peptide     386110..386193
FT                   /locus_tag="Spro_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.644 at
FT                   residue 28"
FT   gene            386535..389393
FT                   /locus_tag="Spro_0337"
FT   CDS_pept        386535..389393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0337"
FT                   /product="putative plasmid-related protein"
FT                   /note="KEGG: eca:ECA0573 putative plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39447"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K7"
FT                   /protein_id="ABV39447.1"
FT                   /translation="MRFSLFDKKRLTRKTPAVPATGDQDTVIATEDGVPLSVDGREPLR
FT                   RPGKMTVKDEKQVYHANPSIVDYLPWAEFLDREQCILLDDGVSVGAVFEITPVATEGRT
FT                   DDRLEQMRDTVEDALQDSFDEHDENPWVVQFFCQDENNVDAYLDRLRGYIKPHAQGSQL
FT                   SESWLKETERHMRGIARPEGLFKDTLITDQPWRGQQRRTRMVVYRWIGKGNTDPMPPIA
FT                   MLNQTCERVTGALNGAGVVCVRQNGGQVHDWLLRHFNPSPEWVDKETLYRDAAYFDSRD
FT                   TPEGAMPVQNDFAETLLFTPPVSDPDQGVWWFDNQAHCAIPVEKLRRPPEPGTLTGEQK
FT                   RGEKKINALMDMFPEGTMVCMTIVVQPQDTLETDFNKLSKNAVGENTESGRVRQDVAQV
FT                   KEYLGNRHKLYRAGITFLLRAGDLTTLNHKCVDLTNVLLGAGLQPVRPEFDVAPLNTYL
FT                   RALPMCFNPETDKKHWYTRLTWVQHLAGLLPVTGRETGTGNPGLSFFNRGGDILTVDPL
FT                   NKHDRSQNAHMLYFGPTGAGKSATLCATLTQTMAVHRPRLFIAEAGNSFGLLADYFESQ
FT                   GLTVNKISIKPGSGVSLPPFSFAHKLIEELSSLELDESELRDIDADDEDEDKRDYLGEM
FT                   EISARMMITGGDQKEEAELKRADRAMIREALLMAAKSAFDEQRQMLPSDLQNALYAISN
FT                   DTANEKRNPQRRAKAAEMAEALGMFTQAGSFEAELFNREGSLWPEADVTLIDLGHLARE
FT                   GYEAQMALTMVSLTNTINNIAERDQYSERDIVFAVDEAHIVTVNPLLAPYMTKIVKMWR
FT                   KLGAWLWLATQNLKDFPDIAEKMLNMAEWWVCLTMPPEEVNDIARFKALTEEQKAVLLS
FT                   ASKLSGCYTEGVVLSKKLEALFRAVPPSLYLALGMTEKEEKAERRALMHEFGCSELEAA
FT                   RKVAQKLDRLRGLAANGEAAVA"
FT   gene            389390..389794
FT                   /locus_tag="Spro_0338"
FT   CDS_pept        389390..389794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39448"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K8"
FT                   /protein_id="ABV39448.1"
FT                   /translation="MMTLKYPEPVVRPLGQICREPSLFTLPPQGVATLSETDALALDTF
FT                   CAAIRDRLWGPVTLTAHPHRIGSRTSVALHLEGRLGHCIDVLITVTGSTLWPQPEEYDH
FT                   PRWYVTVPDAADVVYLLLHLSDLCERFSVN"
FT   gene            389917..390909
FT                   /locus_tag="Spro_0339"
FT   CDS_pept        389917..390909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0339"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: pst:PSPTO_2960 pyridoxal-phosphate dependent
FT                   enzyme family/ornithine cyclodeaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39449"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR023927"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8K9"
FT                   /protein_id="ABV39449.1"
FT                   /translation="MQFDSVDKLVNDSIFFKFNKFCGLADLFVKVEGMNAGGSIKMKTA
FT                   IALIRDAIKSKGLYKTKRFIESSSGNLGLSLSIIAAAKGLHFTCVVDKNTSSQNVKMMR
FT                   ALGTQVVIIEHKDEQGGYLGNRLAYIRSAIERDPELIWLNQYQNMANPAVHAEMTAKSI
FT                   LTEFSKVDYLFIGAGTTGTLMGCARFFRRYSPKTKLIAVDSIGSITFGTPGQTRHLPGL
FT                   GSSVQPHFFDKSQVDLLIQIPEAETVATCRDAARRFGYLGGASTGTVLAAVKRMRADIA
FT                   QEAIVVAISPDMGSGYVDTVYNDEWCDRTFGASWKMAEKSIDMKGTEYV"
FT   gene            390902..391936
FT                   /locus_tag="Spro_0340"
FT   CDS_pept        390902..391936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0340"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   vei:Veis_1206 ornithine cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39450"
FT                   /db_xref="GOA:A8G8L0"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR023866"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L0"
FT                   /protein_id="ABV39450.1"
FT                   /translation="MSDGQVDFEVITGDYINKVIATSRRDIIDLVRQSYLTHHQGKTEN
FT                   PDSYFLRFKNKPEARIIALPAAIDNPEADTSVSGIKWIASYPRNIEANLQRASAVILLN
FT                   DYETGYPFSCLEASQISAARTAASAVLAANHLGPAGKNAKRLSIIGGGLIARTILAFFK
FT                   DEGWRFDDVVIHDISAEYRDAFIKNTNLQEVYQVRAAVDQAEALAADIVVFATTAASPH
FT                   VMDERTFAPHQLVLNISLRDVSPEIVHAGNNVLDDVEHCMKANTSPHLAEQKYGHRCFI
FT                   NGTLAQVINGEITLDKTKATLFSPFGLGVLDLSLAMFIYRCNRVAPGRHIIPDFFPDTQ
FT                   RWSL"
FT   gene            391940..392929
FT                   /locus_tag="Spro_0341"
FT   CDS_pept        391940..392929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0341"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: ava:Ava_C0007 condensation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39451"
FT                   /db_xref="GOA:A8G8L1"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L1"
FT                   /protein_id="ABV39451.1"
FT                   /translation="MSHSYTVRPLVNGVPHVSLVTASNGNVSIAEFFRDRPIDDILAEK
FT                   GALLFRGFSISQDQQFSQLVSSLAKEELTYQERSTQRKKTAQGVYTSTEYPAAKTIANH
FT                   SENAFQQVVPGKILFYVHQAALKGGETPIADNARVLSLIDDDILAVFRQKGIRYLRNFD
FT                   GGFDLSWQEAFQTESKSEVESYCNKNAIDCEWLSDSHLRTSQLRSATRRHPLTGKEMWF
FT                   NQLHLFHITNLELPVRQALLASLGRDLLPRHAVYGTGEEIPDEVVDHIRAALVEAELVF
FT                   PWQTGDVLIADNILVSHGRKPFEGERAVRVALIDPIYPSAEENSYAHR"
FT   gene            392916..394655
FT                   /locus_tag="Spro_0342"
FT   CDS_pept        392916..394655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0342"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; KEGG: bce:BC2456 peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39452"
FT                   /db_xref="GOA:A8G8L2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L2"
FT                   /protein_id="ABV39452.1"
FT                   /translation="MPIVEVFNPPSLNSRLDMTARRYATRLAVQDETRALTFAEFSDEV
FT                   GTLAARLQLVLEPGDHVAVQLPRGLDYIVAAYAIWQAGGVYLPLDDQWPSSRIEGILHR
FT                   SHVRVLIHAPQAGHGIALTELAAEPRAELPAAGTPAYIIHTSGTTGEPKGVVVSQESLL
FT                   HLVDSHQRDIYQIHGVTEGPVVINASFCFDSALERMALVALGYSVQVVSDRVRKSPHEL
FT                   VGYLCDHHIVNVDLVPSHLKVLLSAGLNEKCDALRLVIVGGEAIDVELWRQLAANEAVY
FT                   INVYGPTENTINTSFCEIRGEMPHIGRPFENVSCLILDEGGQRCPPGEDGELLVAGRHL
FT                   ALGYYNAPALTARAFVNVDGLRYYRTGDRVRQNEQGNLLFLGRIDDQVKINGFRIELAD
FT                   VQHNLAQLPGVQYAAVTPIKLPSGQGLLASVVWHADTAGQTLASLETLLGEKLPAYMVP
FT                   DRWQQLDALPLTDNLKLDHKSLLSYWQRRQEQADEPVVGESLSATERQIQTLWQRILMR
FT                   TSLSPDAHFFASGGDSMAAMTLLVELKKVTPHEVGLGDIFKYPTIRKMAAWLDESSVHA
FT                   EGE"
FT   gene            394655..395380
FT                   /locus_tag="Spro_0343"
FT   CDS_pept        394655..395380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0343"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: bte:BTH_I2357 thioesterase
FT                   type II"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39453"
FT                   /db_xref="GOA:A8G8L3"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L3"
FT                   /protein_id="ABV39453.1"
FT                   /translation="MCLIFCLPHAGGGAHHYFGWAAHLAPDIQWEPLDYAGHFSRMDEP
FT                   AYASFEQAVEDLAEVMIARASGHPFALFGHSMGGALAYEIAQYLAARQLAKDLSFIAVS
FT                   SALPPHRRDPNMPRYYELPDWDFIQHLIDTGGMTAQLAAQAELMASYLPLIRQDYQLYH
FT                   QYQPPSHPPLSTPLYALWGEEEEDRNDNMPAWADYSHAFNGSKAYPGDHFFWRHCLGAV
FT                   AADISAIASQASTGQTCRR"
FT   gene            395402..396676
FT                   /locus_tag="Spro_0344"
FT   CDS_pept        395402..396676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0344"
FT                   /product="phosphoribosylglycinamide synthetase"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; KEGG:
FT                   ypm:YP_3384 acetyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39454"
FT                   /db_xref="GOA:A8G8L4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L4"
FT                   /protein_id="ABV39454.1"
FT                   /translation="MPILNNKEVIVIIDAWSGGKYLIPAFQALGYFCLHVQSPFLPAVF
FT                   VADNQLAIARSDRHVVHDGDIETLLNALQPYAIKAILAGSEGAVALADRLNDALALAFS
FT                   NRFELSAARRNKFLMQEQLARRGVASIKQRLTADCDELQQWLASHDRWPVVLKPVQSAG
FT                   TDGVFICHDLAQATQAFDAILAKKDLFGSPNREVLCQEFLVGEEFVVNGIACQGEYFFT
FT                   ELWQSKKQQRNGFPVYETQYLHYRNDAGFDVLAAYTAQVCQALGIENGAFHAEVMMTQS
FT                   GPVLIEIGARVAGGADPYIIEECLGHSQIGKLVQAVLHPEVFLQEVRRQRDFSGHRRAA
FT                   YVFMISPSTGRVQSSPEARFISIDGVISVNYHHMPGDIQQETRDLLSSPGVVIAIRDNP
FT                   ALLKQTIAEIRDVEGDFYHSGLMAE"
FT   gene            396687..397859
FT                   /locus_tag="Spro_0345"
FT   CDS_pept        396687..397859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0345"
FT                   /product="Coenzyme F390 synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39455"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L5"
FT                   /protein_id="ABV39455.1"
FT                   /translation="MNLELWVKNIGTTFPWYAQLLGDKPADASRLETLPVITEELLTQH
FT                   YYHAEHRLPGQYHSYLTSGTTSGKRKRILYSDNDQRIYLQQRMGIIRDFCGEGHVRACA
FT                   DLGTGHAAATAGEIFQAMGCEVELIDFTRPIEQHIEVLNRFKPDIFFTMPMILDCLVAT
FT                   GKLDFQPKRIIVLGDVASLAWQRKVADYFHIKPGQVLDLFGSIEIGSIAFFDHALGRYR
FT                   FDPYLLPEVVPVQSLYPDAGYRGEGGILLLTSFAREYFPAVRFVTNDLIEGFAQEILEG
FT                   RTVYTYQRCLGRFAGEFKHGEKINLSDISDAMAKNLPYHRYDLDDHDGGLVIRIAAASI
FT                   SAQVSEAIKHDLLSRNPDIAQMIASGLVGDIRIQCVDAQEIAGNVSKRRY"
FT   gene            397882..399714
FT                   /locus_tag="Spro_0346"
FT   CDS_pept        397882..399714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0346"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase; KEGG: sus:Acid_4624
FT                   asparagine synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39456"
FT                   /db_xref="GOA:A8G8L6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L6"
FT                   /protein_id="ABV39456.1"
FT                   /translation="MCGIAGVINFHRQPAQPPLLASMLAALTHRGPDQEGTYHQGHVSI
FT                   GMRRLKIIALDNGAQPCYSNDGRYVLVFNGEIYNYRALRAELIAQGFRFDTESDAEVIV
FT                   NLYQRDGEAFYQRLDGMFALAIYDRISDTLLLARDPAGKKPLFYALRDGVVSFSSELNS
FT                   LLKDQSIPRRIDPVALDYYLRFRVVPGDRCIFQGISKVPAGGGVSFTLGQESRQHYWRV
FT                   AYRPTEDDKPLEQWVDEIDEYLNQAIAKRLMAEVPIGTMLSGGLDSSLITAIACRQGRR
FT                   ELKTFAVGFNESAFSELDYSRRLAKDLGTEHHDYIITPQEAFDAAHGLVSHFGEPFAFP
FT                   SSIASHFMYRLARQHVTVVLGGDGADELFGGYARYSLVANFPHLPTEHNLPRKVDLFNK
FT                   TWQADAFPEFYQALLTDGAGGQLRQQLYSRQMALQLAEENSVAQVRSYSDELTQRPDPL
FT                   SAAMEYDFNHWMQEAQMVKVDIASMANSLEVRVPFLDKQVVGLGSSLPARFKLHAGKEK
FT                   YLLHCLAKRYLPDYIVNRKKQELAVPLEQWMVSSMKTRIIDTLTSEQALSRGYFNPDRL
FT                   RQFVREFDAGHSYALWTMYMLEKWHQQFVDNQES"
FT   gene            399715..400665
FT                   /locus_tag="Spro_0347"
FT   CDS_pept        399715..400665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39457"
FT                   /db_xref="GOA:A8G8L7"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L7"
FT                   /protein_id="ABV39457.1"
FT                   /translation="MTDQGRYLSGVFCTLLYIVIASTQSVMLNIWLFGVNVFFVVGLSF
FT                   VVVTLVFATVGFLRQREAYATLFSQWRLLVALNIVSMFNWLFYFLAVKYLEPSVAVTLT
FT                   QGLGPVSMTVYLLSTRQTVSRVTRCCHLVIFMTAIAMCIYTVMFRNAYTLYSREAMIMG
FT                   IIIAVLCSISITVTVVISKRFAVGKIPASALLSLRFPLLIAVCLGILSLQRGVVVNSTI
FT                   LSAILLIALVGVSASIYFLQKGIELTTPLAVSTVLALSPLAVFVIQLFNVHTPFSPVLF
FT                   AMIMTIVSVSIVSIVYDAREIGRKARNSENSLCEQ"
FT   gene            400801..401205
FT                   /locus_tag="Spro_0348"
FT   CDS_pept        400801..401205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0348"
FT                   /product="protein of unknown function DUF1525"
FT                   /note="PFAM: protein of unknown function DUF1525; KEGG:
FT                   eca:ECA0576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39458"
FT                   /db_xref="InterPro:IPR011090"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L8"
FT                   /protein_id="ABV39458.1"
FT                   /translation="MKISTLLTLFPLLMPASVLAGTVLYTDSHHPPTNVDASVSVIYLD
FT                   GPEQLQAQTFGDLSSNPDDAERQAKAVLQSPQWQAHEQELATVYRAVVHAWEIGITKVP
FT                   AVVFDDTDVVYGTADVAQATALRAQSQGGQ"
FT   sig_peptide     400801..400863
FT                   /locus_tag="Spro_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            401207..402214
FT                   /locus_tag="Spro_0349"
FT   CDS_pept        401207..402214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0349"
FT                   /product="protein of unknown function DUF1527"
FT                   /note="PFAM: protein of unknown function DUF1527; KEGG:
FT                   eca:ECA0577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39459"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8L9"
FT                   /protein_id="ABV39459.1"
FT                   /translation="MQRTPLHGMPPEQPRLTLKSLSVAMMLSAASVPAANAALNSAQIV
FT                   ASAVSQACISWRVSGICYWLLCTPFGCKVRTSVKVTHFIPEAVVSAYNTQGGNPWREMS
FT                   MVSQAAGGLESSITSALSGVSAGGGNNELKTPGERKTNLHFKYADAIGHPATSLIGGSI
FT                   AGYSCRSAATPFVPYFLSTLDSLAWRTGIPESLYPEALVPGMREVGSQAAANMWGNVYP
FT                   RSGFVTQVDDDKVGALVAQRVADIITRSGQPHVYQPLIGQRSEGYWPPGAVTENTGTNN
FT                   HKWQRLAPQLSQSCAVFPDGDHPPAADANAAFALWQPYSCCQRRGQRFLSSTDF"
FT   sig_peptide     401207..401320
FT                   /locus_tag="Spro_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.962 at
FT                   residue 38"
FT   gene            402225..403709
FT                   /locus_tag="Spro_0350"
FT   CDS_pept        402225..403709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39460"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M0"
FT                   /protein_id="ABV39460.1"
FT                   /translation="MNNTMNKRTFRGRRSLLSLLVVSSLMLVGMNAHADDNDDNGTLFG
FT                   ISLPQVNDSNIGYGKNASGAVSDKLFYSLGGGSVISQPATRGNMQRLGMNLGWSSDLMC
FT                   GNFDLKTTIGNQLNGVTDGFKNLMGSVIQGATGAVASLPAMAIQRANPGLYEMLTNGVL
FT                   QGGVAFDKAQLNCQNLSKRMMDMADTGGWSQAAAMEEAKSLVNNGDADAVRSMNATEKV
FT                   TGQSGQTWIGGQKRGGAGQPAIKPTHDLAAAGYNMMNAMPVTSTSSVSGSNCTGGACAK
FT                   YASSEEAAAAVVKVLGDTSLRTCKDASQCTSGEGAEQPGSTVAGTGFAPMLEEATKANN
FT                   EQLAKLVNGAEKPTTANLAKLKTGSLAVTAGVIKALQRDPDNAALVGRLASELAMADTI
FT                   ETAFIMRRMITTGMSEPNASAQKVAMEEGDRRIEALDREITALKNEMEMKREISRNAVL
FT                   TIIDRENNRAETNPQRQSVDSLDTKFNQLAVPENDQ"
FT   sig_peptide     402225..402329
FT                   /locus_tag="Spro_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            403726..404097
FT                   /locus_tag="Spro_0351"
FT   CDS_pept        403726..404097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39461"
FT                   /db_xref="GOA:A8G8M1"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M1"
FT                   /protein_id="ABV39461.1"
FT                   /translation="MTGTEKQGVSPRRGGRLGHRAKRVLQMLGMLVIAMIVALGMAHWG
FT                   VNHPGESAALRDWVHSTRYGWLSWRLALYAVLTWGGWKIWHAPGCKPEYRQPLKRMAIA
FT                   CAVFALACEYSLFGGGLTL"
FT   gene            404094..405611
FT                   /locus_tag="Spro_0352"
FT   CDS_pept        404094..405611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39462"
FT                   /db_xref="GOA:A8G8M2"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M2"
FT                   /protein_id="ABV39462.1"
FT                   /translation="MMTNSYLEYFLTLLGWLINNGLWELLVSTGLFVLPLLFKVAAIWL
FT                   KVREEGEDEGNKGMLSLPRIENLLYGAFFVMLACCLPLMNVSLDTIKYDSSRAATCGTW
FT                   TPKKPDETGYANIMSSMNGQTAKVPVWWLVVHKLSKGITSAAVATIPCRPDLRQVRFEV
FT                   QHSRVNNPALAKELQDFTNDCYALALYTWQNRDQGQTTDKATLRDIEWLGSKTFLSGGY
FT                   YNNLQSKTPRASFPWNEGRDSGRPNTGRGGYPTCSEWWSAGETGLEARVVKQVDPGVML
FT                   RMSAALKMMGQSDADYKEAVVRRLVSPDNLTVSQGGRAYAGYGGNADFTLDNSVNRITS
FT                   MGGTALGSLAAYPAFDAMRQALPMVQAVLLMAVYIMVPLILAFAAYEYKTVITVTFVVF
FT                   ALNFLTFWWELARWLDSWLLEALYGSDTHSRWNVAGFQNSSDDLIMNLVMGCMFLVLPA
FT                   VWLAAFSWAGVRIGELSRMVTDGTSKSQQTGGLVGDAAVSKVASGGK"
FT   gene            complement(405612..405986)
FT                   /locus_tag="Spro_0353"
FT   CDS_pept        complement(405612..405986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39463"
FT                   /db_xref="GOA:A8G8M3"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M3"
FT                   /protein_id="ABV39463.1"
FT                   /translation="MSKTRNQQAYQRGIRVARMWKRLKGTILRWDTLCVSKARKYGLPA
FT                   WLGHVPIASLVAVSVISCLIGGLLIAVVILFVWALILLPSMMELLRPTANVKVTNWEEK
FT                   SHKYNYGSNGSNGSDGSTGS"
FT   gene            406249..406821
FT                   /locus_tag="Spro_0354"
FT   CDS_pept        406249..406821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: osa:4352161 Os12g0450200"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39464"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M4"
FT                   /protein_id="ABV39464.1"
FT                   /translation="MSDPNSGSGWGVSHTPYGDVHNYNPNEFGGGNGGGGNGGGNSGNS
FT                   GNQPGTGSYSGRFSVGSFSANAPGIGSDELKEIFDNTARWEGVSHNMYADSVGNVTVGI
FT                   GTLLSTPDEAAKLGFHNRRVTRAHGDELVGYSPASAGDIRSNFQRVKDVYNDKSLGYRQ
FT                   KVAEWSGSGMVLTDSEGSVWISKIIVR"
FT   gene            complement(406808..407482)
FT                   /locus_tag="Spro_0355"
FT   CDS_pept        complement(406808..407482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0355"
FT                   /product="transposase"
FT                   /note="KEGG: kpn:KPN_pKPN3p05885 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39465"
FT                   /db_xref="GOA:A8G8M5"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M5"
FT                   /protein_id="ABV39465.1"
FT                   /translation="MWVIFTSVLTFIKGKADQYPALQSLISTTSLNLKEIEIHWREVLR
FT                   LATSIKQGTVTASLMLKKLASYPKQNGLAKALREIGRIERTLFMLDWFRDPTLRRRVQA
FT                   GLNKGEARNALARAVFLHRLGEIRDRKPENQSYRASGLTLLTAAISLWNTVYMERAVDA
FT                   LKRKGGKINEQLLSHLSPLGWEHINLTGDYIWKSNRIPASGKFRRLRPAKVERSKNNLN
FT                   VQ"
FT   gene            407515..408558
FT                   /locus_tag="Spro_0356"
FT   CDS_pept        407515..408558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0356"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bvi:Bcep1808_7234 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39466"
FT                   /db_xref="GOA:A8G8M6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M6"
FT                   /protein_id="ABV39466.1"
FT                   /translation="MAALDLPMLTLELRVEIAVLLRQGMSIRGIARQLSCSRQTVRRYI
FT                   RMQDSPAKARYSERLPRPGKLDPFKPYILERVDAARPHWIPASVMLSEIQLRGYCGGYS
FT                   MLTAFLLPLKQQPNDPVVRFETQPGEQMQVDFTVIRQGRNPLLAFVATLGWSRATFVRF
FT                   YPRQDTAAWCDGIEQALLAFGGTPRHLLFDNAKTIILERDVYGDGRHRWNPPLLALAEK
FT                   YGFTPRVCRPYRAKTKGKVERFNRYLKHSFVVPLATTFKQAGLLLDVDSANSRVGPWLI
FT                   TVANARKHGTTGVPPEHRLQQELAALLPLPRVARTVPVVADNQRVIPRESFQHPLSVYQ
FT                   SLLEAGL"
FT   gene            408555..409343
FT                   /locus_tag="Spro_0357"
FT   CDS_pept        408555..409343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0357"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: pst:PSPTO_B0039 transposase/IS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39467"
FT                   /db_xref="GOA:A8G8M7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M7"
FT                   /protein_id="ABV39467.1"
FT                   /translation="MSLQHQRISELCADFKLERIASEWPALAPKTLEDTGTFGDFLEQL
FT                   LQLETNNRNERRRQTLLRLSGLPAVKTLEQFDFKFASGAPRAQLQELAGLAFIERHENI
FT                   VLLGPSGVGKSHLACALAHKVAMSGQSVRFITAADMMLQLVAAHRQGELKGYLGRCVNK
FT                   PRLLVIDEVGYLPFGKEEANLFFQVVARRYETGSLILTSNLPFTQWSGTFGDDETLTAA
FT                   MLDRLLHHAHIVQISGQSYRLKDKLKSGQLKKSKVPEPQE"
FT   gene            complement(409383..410204)
FT                   /locus_tag="Spro_0358"
FT   CDS_pept        complement(409383..410204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0358"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   ent:Ent638_4224 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39468"
FT                   /db_xref="GOA:A8G8M8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M8"
FT                   /protein_id="ABV39468.1"
FT                   /translation="MTLLQSRLEEVNAMAALGELPDVEISDKGVKVSPLDNCVPAQVSP
FT                   LAELVYSMLPRPKITEILDEVNSWTTFTRHFSHIKNDITRPDTRLLLTTILADGINLGL
FT                   TKMAEACPGSTKSSLEDIQAWYIRDETYSAALAELVNAQGKRPLAAFWGDGTTSSSDGQ
FT                   NFRTGSSGRYAGQVNPKYGQEPGRQFYTHISDQYSPFYTCIISRVRDSTHVLDGLLYHE
FT                   SDLEIREHYTDTAGFTDHVFALMHLLGFAFCPRIRDLHDKKLFNLSIPIEL"
FT   gene            complement(410325..411128)
FT                   /pseudo
FT                   /locus_tag="Spro_0359"
FT                   /note="Integrase catalytic region; ISPsy26, transposase
FT                   orfB"
FT   gene            complement(411176..411460)
FT                   /locus_tag="Spro_0361"
FT   CDS_pept        complement(411176..411460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0361"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   pae:PA0983 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39469"
FT                   /db_xref="GOA:A8G8M9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8M9"
FT                   /protein_id="ABV39469.1"
FT                   /translation="MGTPRFTPEFKEEAVRQITERGYSVAEVSDRLGVSAHSLYKWLRA
FT                   IKPDNSEQHAQDLLEAKSEILKLRAQLKRTEEERDILKKAARYFAREPD"
FT   gene            complement(411840..412328)
FT                   /locus_tag="Spro_0362"
FT   CDS_pept        complement(411840..412328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0362"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein; KEGG: eca:ECA0612
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39470"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N0"
FT                   /protein_id="ABV39470.1"
FT                   /translation="MAKDTIVTLLKYKRWIDSETLKTIKLIDEFAYAEKRHLMLRLMNH
FT                   IHVVDMIFRANISGQQHGYTALNTPETPSVGELEVKMADAADWYNQHINSMTSADLGET
FT                   IKFSFVDGGNGEMTAAEMLNHMLFHGTYHRGAVGWLITECGGVAPKDVLAVFLRDHNH"
FT   gene            complement(412613..412945)
FT                   /locus_tag="Spro_0363"
FT   CDS_pept        complement(412613..412945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_4169 esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N1"
FT                   /protein_id="ABV39471.1"
FT                   /translation="MSVFLTCARYLMGLAPKILGDDAKLHKHLLNRDAPQAARIPSALR
FT                   SSCHIKERIYQEQRVVTLTPRTGKRDLHVLYLHGGAYVNPLLGAHWSIIGAVINATGAT
FT                   VTPHSI"
FT   gene            413017..413646
FT                   /locus_tag="Spro_0364"
FT   CDS_pept        413017..413646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0364"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: fal:FRAAL5169
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39472"
FT                   /db_xref="GOA:A8G8N2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N2"
FT                   /protein_id="ABV39472.1"
FT                   /translation="MSKITPTDDPTLPPETTKPAVGRPRDAELDLRIMRAALAQVAEGG
FT                   FHSLTMDAVAKRIGAGKASLYRRWKSRDALLADALLAFSPTDLPIDTGTLRGDLIAVYE
FT                   HFYGLNDPDIRVAVIEFLGNHRILRGWVEQEIPGWLNSRRVRVLEIIERAIGRGELRVS
FT                   AQLNLDLLIDLLPGVIQYRYTERNQIVDNELIVEVVDHVLLPLLSR"
FT   gene            413848..415095
FT                   /locus_tag="Spro_0365"
FT   CDS_pept        413848..415095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0365"
FT                   /product="integral membrane protein, PqiA family"
FT                   /note="TIGRFAM: integral membrane protein, PqiA family;
FT                   PFAM: Paraquat-inducible protein A; KEGG:
FT                   ypi:YpsIP31758_2550 paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39473"
FT                   /db_xref="GOA:A8G8N3"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N3"
FT                   /protein_id="ABV39473.1"
FT                   /translation="MLCPQCDLLVALPPLSTGTKAVCSRCSTTLSARWDEPRKRPIGYA
FT                   LSALFMLLLANIFPFINMRVAGFGNEIKLINIPQVMLEENYTSMATLFMLLVQLIPAFC
FT                   MLAIILLCARVRMPLVLKEWMAKMLFQFKTWCMVEVFLAGVLVSFVKLMAYGDIGIGSS
FT                   FVPYCLFCLLQVRAFQCVDRRWLWQDIEPAPHLDRPLTVGRTGMRQGVRSCRCCTAILP
FT                   ADLTHCPRCHTSGYVRRRNSLQWTLALLATSVMLYIPANLMPIMVTEALGNKMNSTIMA
FT                   GVILLWGEGSYPVAMVIFIASIMVPSLKMLAIGWLCWDANGKGKNRADSERMHLIYEVV
FT                   EFVGRWSMIDVFVIAVLSALVHIGLLMSVYPATGALLFALVVILTMFAAMAFDPRLTWD
FT                   RVNETIKKEPQGDRKQ"
FT   gene            415079..416722
FT                   /locus_tag="Spro_0366"
FT   CDS_pept        415079..416722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0366"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: yen:YE1574 putative paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39474"
FT                   /db_xref="GOA:A8G8N4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N4"
FT                   /protein_id="ABV39474.1"
FT                   /translation="MTENNNNIAGVEKITCWSPVWIVPIVTALIGAWILFYHFSHQGPV
FT                   VMLVTTTAEGLEAGKTKIKSRSVDVGVVETVTLSDDLSKVRVQARLNSGMDKLLRQDTA
FT                   FWVVKPQIGREGVSGLGTLLSGAYIELQPGTKGKDGKDTYQLLDAPPLASPDAKGLRIV
FT                   LDSEKSGQLNAGDPVLFHNYRVGSVETSYFDPKQRAMRYQLFISAPYDQLVTSNVRFWK
FT                   DSGVTFDMSAQGMRVEMGSLATLFSGGVSFDVPHGWDRGEKAKEKAEYRLFDNQRSIQD
FT                   SLYTVHKDYLMFFSDSVRGLQPGAPVEFRGMRLGSVAQVPFFKEGIEHRVKNDYRIPVL
FT                   IHIEPERLKALGKDFDFDSSLKDAESRGIRASLKSANLLTGSLYIDLDFNPQDKPWDGP
FT                   HELFGYPLIPTTSGGLAQIQQKLVQTLDKINAIPLTPMINEATKTLAESQRTMKSTQKT
FT                   MKSLNDIISSKEVKALPQEMQKTLQELNRSMKGFQPGSPAYNKMVGDMQRLDQVLRELQ
FT                   PVLHTLNEKSNALVFEAAASNDPQPKKANK"
FT   gene            416719..417267
FT                   /locus_tag="Spro_0367"
FT   CDS_pept        416719..417267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0367"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   yen:YE1575 putative lipoprotein protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39475"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N5"
FT                   /protein_id="ABV39475.1"
FT                   /translation="MMKWLPVALALLLSACSNTPQKTYYQLPALGTPAQVNSGASTRQL
FT                   WLEHVFVADYLMQNGVVYQTNGVQYAIAQNNLWASPLDQQLQQTLVTNLSSALPGWVVS
FT                   SQPMSSDQDVLNVTISGFHGRFDGKAVIRGEWVLNHQGRLTKRPFNLELKQSEDGYDAL
FT                   VRTLAEGWQKEAQSIAFQL"
FT   sig_peptide     416719..416772
FT                   /locus_tag="Spro_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.446 at
FT                   residue 18"
FT   gene            417843..418454
FT                   /locus_tag="Spro_0368"
FT   CDS_pept        417843..418454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0368"
FT                   /product="plasmid conserved hypothetical protein RAQPRD"
FT                   /note="PFAM: plasmid conserved hypothetical protein RAQPRD;
FT                   KEGG: eca:ECA0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39476"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N6"
FT                   /protein_id="ABV39476.1"
FT                   /translation="MSKRILNQKKFLGITTFNWLRTDLARDACFAYWGGPHADLVSRNG
FT                   FIRDYNQHHFNDDVAGLWPLTPEVVTSIPTDKRIDGVSEIILDSICSGLHLKSTRPAFI
FT                   AHFQPTLAATSDGPGPTIAENEKRATALHCKWLMAALERARVAAVQADPSERGRFFFDY
FT                   ARATSDLKTINAGIDRYLEPSRAQPRDGSAVAGNYRRERP"
FT   gene            418454..418615
FT                   /locus_tag="Spro_0369"
FT   CDS_pept        418454..418615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0369"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_5396 ISPpu14, transposase Orf3"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39477"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N7"
FT                   /protein_id="ABV39477.1"
FT                   /translation="MAMTGAQEQAFNAASDGVDPYAYLKDVLACLPMQWASEIDQLLPH
FT                   NWRLPKLG"
FT   gene            418716..418871
FT                   /locus_tag="Spro_0370"
FT   CDS_pept        418716..418871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39478"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N8"
FT                   /protein_id="ABV39478.1"
FT                   /translation="MYLRVDTIEQAIRHSGALVKDVGRNGYMVTNELALSNLRFGSTVI
FT                   VTMLTQ"
FT   gene            418937..419143
FT                   /locus_tag="Spro_0371"
FT   CDS_pept        418937..419143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39479"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8N9"
FT                   /protein_id="ABV39479.1"
FT                   /translation="MICSDKHEHQRQVETRKIDILGLTPPTRQSVLDHEYDTWESELCN
FT                   IDTALTSPVLAVAMITERFLSKE"
FT   gene            419335..420297
FT                   /locus_tag="Spro_0372"
FT   CDS_pept        419335..420297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro01207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39480"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P0"
FT                   /protein_id="ABV39480.1"
FT                   /translation="MLGCAFVIAVLAGALWGAWKFSSPSLQPFASLRPQVGQGSPDLTV
FT                   RFLGTGTLSFDDGETAIMEDGFFSRPSIYSVLLMPIQPNEQRIDASLRSAGITKLAAIF
FT                   VAHSHYDHVLDSGLVALKTGATVLGTSSTANAVLGAGLPPERIKVIKDGDSFSFGQFQI
FT                   KAFETPHSPHPTSPGFIDHPLHTPVRQGDFKVGGNFSYLITHGSRRLLVIASGNYSPGK
FT                   FKNVRADVVFLGIGTLGKQTPEFVAQYWQEAVVQTGAKLVIPIHWDNFFEPLDQPLTAM
FT                   PRILDSFDKSMGMLLPLAQRDAVKVQLPVAFAPIDLDAR"
FT   gene            complement(420594..421613)
FT                   /locus_tag="Spro_0373"
FT   CDS_pept        complement(420594..421613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0373"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: psp:PSPPH_3647 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39481"
FT                   /db_xref="GOA:A8G8P1"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P1"
FT                   /protein_id="ABV39481.1"
FT                   /translation="MKTVSAVLTSALFTSATAVASEQPVNLPAPTAGVQAFLNVLNSGS
FT                   GKPMEQLTPQEARQVLIGAQKGVTLPSAQVSEKIITVNGQPIKLKIVKPDNTAGTLPVF
FT                   MFFHGGGWVLGDFPTHERLIRDLVRSSGAAAVYVDYTPSPEAHFPVAIHQAYEATKWVA
FT                   EHGQEIGVDGSRLGLVGNSVGGNMVASVALQAKQFNGPKIRYNVMLWPVTDANFDNASY
FT                   NRYENGYFLTKNMMEWFWDNYTTNASDRNNILASPLRATTEQLKGFPQTLIQTAELDVL
FT                   RDEGEAFGRKLDAAGVPVTVTRYNGMIHDYGLLNPLSQEPTVKTALEQAASALHEHLK"
FT   sig_peptide     complement(421551..421613)
FT                   /locus_tag="Spro_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            422431..422853
FT                   /locus_tag="Spro_0374"
FT   CDS_pept        422431..422853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0374"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: sfr:Sfri_0578
FT                   transcriptional regulator, MarR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39482"
FT                   /db_xref="GOA:A8G8P2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P2"
FT                   /protein_id="ABV39482.1"
FT                   /translation="MKQNSILEEKLCFSLYSVTNALIRQYRPLLKEFDLTYPQFVVLMA
FT                   LYEQDDIPLRALGQKTLFDSGTLTPLVQKLEGKGFLKRMAVVGDERMKNVVLTEKAHEM
FT                   KEALLELPGKMRCTMHMKDEELELLRQLSANLLKDL"
FT   gene            423041..423304
FT                   /locus_tag="Spro_0375"
FT   CDS_pept        423041..423304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0375"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   yen:YE1810 insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39483"
FT                   /db_xref="GOA:A8G8P3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P3"
FT                   /protein_id="ABV39483.1"
FT                   /translation="MKKRFSDQQIISILREAEAGVSARELCRKHAISDATFYTWRKKYG
FT                   GMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKY"
FT   gene            423337..424161
FT                   /locus_tag="Spro_0376"
FT   CDS_pept        423337..424161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0376"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: sec:SC173
FT                   hypothetical protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39484"
FT                   /db_xref="GOA:A8G8P4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P4"
FT                   /protein_id="ABV39484.1"
FT                   /translation="MCGATGLSQRRACRLTGLSLSTCRYEAQRPTSDAHLSGRITELAL
FT                   ERRRFGYRRIWQLLRREGVHVNHKRVYRIYHLNSLSVKRRRRRKGLATERFPLLRPDAP
FT                   NLTWSMDFVMDALATGRRIKCLTCVDDFTKECLTITAAFGISGVQVMRILDSIALFRGY
FT                   PATIRTDQGPEFTCRALEQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWF
FT                   SDIVHARKIINNWRQDYNECCPHSSLNYQTPAEFAAGWRNRKYEEKPTDITN"
FT   gene            424320..425852
FT                   /locus_tag="Spro_0377"
FT   CDS_pept        424320..425852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0377"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG:
FT                   bch:Bcen2424_3898 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39485"
FT                   /db_xref="GOA:A8G8P5"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P5"
FT                   /protein_id="ABV39485.1"
FT                   /translation="MNQRVLVSSFILSAVLTGLPQANADPQMTNDNGSPVGDNQNSQTA
FT                   GPNGPTLLQDGHLIQKLQRFERERIPERVVHARGTGAFGEFKAEKDISDLTRAAVFKPG
FT                   TTTPVFVRFSTVIHPKGSPEELRDPHGFAIKFYTTQGNWDLVGLSHGIFFIRDAMKFPD
FT                   MIHSLKPSPVTNVQDPNRYFDFFSHQPESTHMLTQIFSFRGIPTSYRKMDGWGVHAFKF
FT                   INKKGDVTYVKFYFKSRQGVEGYNDHQAQLEQGKDFNNLTNDLYTNINKGNNPVWDLYI
FT                   QTLKPSQLNDFRFNPLDDTKLWLGVPETKVGTLTLNKVPDNYFQSTESVAFDPSNLVPG
FT                   IEPSEDRMLQGRLFSYADAHMYRLGANYQQIPINRPRVAVHNDNQDGRGNQGSTKGDIN
FT                   YQPSVDDGAPVDNAEYKATSALLDGTTQQKIIAKTDNFEQAGIYYRSLTKPQQSDLIEA
FT                   LGSNLKLVKNAHVRQTMLGYFYKADPEYGTRLAEWTKDNVEAIKVLADKLKD"
FT   sig_peptide     424320..424394
FT                   /locus_tag="Spro_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 25"
FT   gene            425890..426450
FT                   /locus_tag="Spro_0378"
FT   CDS_pept        425890..426450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0378"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: xcb:XC_4036 ankyrin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39486"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P6"
FT                   /protein_id="ABV39486.1"
FT                   /translation="MNSRIIRLAALALLGGVWFSTPAFAALNVQLAEAARTGNLSAIKA
FT                   AHLDAAALNESDDDGYTMLILAVYHDQLPVARYLLEQGADPNQKDKHGRTALMGAAFKG
FT                   DVEAADILLTDPRTEVNLQNDQGQTAVMYAALFGHMTFLKHLVAKGAKVDVRDRKGNTA
FT                   ASLAEGQGNHALAQWLIKQSKLS"
FT   sig_peptide     425890..425967
FT                   /locus_tag="Spro_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(426582..426866)
FT                   /locus_tag="Spro_0379"
FT   CDS_pept        complement(426582..426866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_pKPN5p08239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39487"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P7"
FT                   /protein_id="ABV39487.1"
FT                   /translation="MMRTPENVILSALGNGGRIKSFYRRAVQGPQSAKTQLADGYVLDL
FT                   PGERGEVILSHVDFLSVKTKLVETEACEQAVGNTRFGGSTWVLQHESDD"
FT   gene            complement(426863..426967)
FT                   /locus_tag="Spro_0380"
FT   CDS_pept        complement(426863..426967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39488"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P8"
FT                   /protein_id="ABV39488.1"
FT                   /translation="MRETGQYSISYLTELFAVSRPTVYRTLSRHKQGE"
FT   gene            complement(426993..427436)
FT                   /locus_tag="Spro_0381"
FT   CDS_pept        complement(426993..427436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0381"
FT                   /product="Resolvase domain"
FT                   /note="PFAM: Resolvase domain; KEGG: psp:PSPPH_A0101 DNA
FT                   invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39489"
FT                   /db_xref="GOA:A8G8P9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8P9"
FT                   /protein_id="ABV39489.1"
FT                   /translation="MHKTTVLWTGLTPPRCSTDKQDLTAQQEALMKLGVSPDRIYLDKG
FT                   LTGSNRQRPGLDQALAAVRSGDTLVVPKLDRLARSVPDARQIADALQVRGVKLALGTSL
FT                   YDPADPMGKMFFNVLATFAEFEGDLIRLRTREGKTAGKTAKAV"
FT   gene            427534..430092
FT                   /locus_tag="Spro_0382"
FT   CDS_pept        427534..430092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0382"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: sbm:Shew185_0579
FT                   YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39490"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR041508"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q0"
FT                   /protein_id="ABV39490.1"
FT                   /translation="MNTSPFISTPTVTVLDNRGLTVRDIAYHRHPDTPDVTTGCITRHR
FT                   YDARGFLTQSADPRLHETGLANFSYLTDLAGSVLRTVSIDAGITLTLNDAAGRPFMAVS
FT                   NIGTADDGTEDLSRAVTRTWQYEDATLPGRPVSITEQPTGEAAHITERFVYAGNTDKEK
FT                   ALNLAGACVSHYDTAGLTQTDSVALTGVPLAVTRRLLKDADNPDMVADWQGDDVSAWNA
FT                   LLAGESGGYTTLTTADATGAVLTTTDAKGNQQRVTYDVAGLLSGCWLTLRGGTEQVIVS
FT                   SLTYSAAGQKLREVHGNGVVTTYTYEVETQRLTGIKTARPAGHAAGAKVLQDLRYEYDP
FT                   VGNVLKITNDAEETRFWRNQKVVPENTYVYDSLYQLVSATGREMANAGQQGSNPLSATV
FT                   PLPDDGAAYTNYTRTYTYDEAGNLTQIRHSAPSTNNTYTTKITISDRSNRGVLSTLTEN
FT                   PAEVEALFTAGGQQTRLQPGQALVWTPRNELQTVTPVVRDGSTDDRESYRYDAGSQRVL
FT                   KMSVQETKASTQKQRVLYLPGLELHSTQSGNTETESLEVITVGEAGRAQVRVLHWTSGR
FT                   PAEITGDQIRYSYDNLTGSSGLELDGDGSIISAEEYYPYGGTAVWTARSAVEADYKTLS
FT                   YSGKERDATGLYYYGYRYYQPWAGRWLSADPAGTVDGLNLFRMVRNNPVTLKDNDGLIS
FT                   FEDHYSHTEGGMVYGLSESRSQYIRKISPKFSIADNTDTLVIDKYNNALAMTIMFGQHS
FT                   ETQNQQINLDFYSATEDKTQKKLGAKIKVPGEIFDVVKRKFNHPEFKWDDYSSPGKDNP
FT                   KFNIPKIYQQVAKKIRAGLLPWLPDGRKGVSCAQTIMEAR"
FT   gene            430865..431011
FT                   /locus_tag="Spro_0383"
FT   CDS_pept        430865..431011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39491"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q1"
FT                   /protein_id="ABV39491.1"
FT                   /translation="MKLRAARGKRLADPWDDYPSDAYDVAKSWKHNSRRKHQYYRLSHP
FT                   TYW"
FT   gene            431324..432442
FT                   /locus_tag="Spro_0384"
FT   CDS_pept        431324..432442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0384"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: xfa:XF1743 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39492"
FT                   /db_xref="GOA:A8G8Q2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q2"
FT                   /protein_id="ABV39492.1"
FT                   /translation="MKYLSVRTPLLRAAAVSCLFLMPLSGQAAEDNAAWLKLEAEQIQK
FT                   NSIPGPRHVPAKILPAPAGISPELKKDIEAPYNSPRWYGDHASTVAEWQSMIDRSTAAT
FT                   LKVVPVLRKALDVSVREESMGGVPVYEIRPAGYRDNGKVVLYIHGGGYVYNPGITGTPE
FT                   AMLMAAFTGYRVISVDYRMPPSHPYPAALDDVFSVYKALISQQDPGSVAVFGTSAGGGL
FT                   AMSLLLRARNEKVALPAAAGLGTPWMDLTPGGGGDTMNTLEWVDNTLISGRGYIARSAL
FT                   LYADGHSLKDPYISPLFGDFTGLPPVMIISGTRDLFLSQGVLTQRKLREAGNVASLQLW
FT                   DGMSHAQYNNYQAPESRQVFQEVGKFFTEYLR"
FT   sig_peptide     431324..431410
FT                   /locus_tag="Spro_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(432434..433564)
FT                   /locus_tag="Spro_0385"
FT   CDS_pept        complement(432434..433564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO7479 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39493"
FT                   /db_xref="GOA:A8G8Q3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q3"
FT                   /protein_id="ABV39493.1"
FT                   /translation="MLGVILLCVADSRFAEHAGTLAACVTLPHLFGPFVARKIDTANDG
FT                   RRVIASACLLYAAFLISAVVSFSHVPLMFTAAFLIAVGLCGPLLTGGISSRLPSIAGSG
FT                   QHSQRSAQGWDVATYELGGTLGPSLVAAFAAWYSPQISLYLLAAGTTLAAVFIMRLPRQ
FT                   PAAHGGDVSRVPGAIHTVQFIGKNFYLRRTLCMTMTMTMTMTMTMAFGVAALPVSAVSM
FT                   ASLLGVTAASAALLTVGYGTGNLAGSLYLMMRPLQGRPDRLMLQFSCCMLAGIFLILHW
FT                   RAQCRLLCRHACCTDRVFTGLLPGPVFFMGGSHENNGGFAGNGCSRTADSFRCEVSTDD
FT                   KPDCDIAFAGGSIHRKYMAFIKREVREHSCSLYQSA"
FT   gene            433817..434737
FT                   /locus_tag="Spro_0386"
FT   CDS_pept        433817..434737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0386"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="KEGG: psp:PSPPH_B0058 site-specific recombinase,
FT                   phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39494"
FT                   /db_xref="GOA:A8G8Q4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q4"
FT                   /protein_id="ABV39494.1"
FT                   /translation="MLYLDNGPVAKSRVFQDVMLALGVNWLTHLPAGKDGERVTARSKG
FT                   KVERPFRTVKEAHETLYHFHKPETEQQANAWLLRYLLHYNEQPHRSQVHFRKEDWLTNL
FT                   PPEGIRDMCNWEQFCRFAREPERRKVGIDARITVEGTAYEVDPDLAGETVLLLWGLFDS
FT                   ELHVEFEGKRTGPYYPVSGPVPLNRYRAFRKGAISQRAERIRTLAQQLSLPIAALTGEN
FT                   IALISQSETHDIPRQSFPTTAEECYATTIMAKLAIANELATPLAKLTSSDRQFIEQLLG
FT                   ETLIRRIVLNRVLNRPGFPRRFRAS"
FT   gene            complement(434715..435566)
FT                   /locus_tag="Spro_0387"
FT   CDS_pept        complement(434715..435566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0387"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: psa:PST_1859
FT                   transposase, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39495"
FT                   /db_xref="GOA:A8G8Q5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q5"
FT                   /protein_id="ABV39495.1"
FT                   /translation="MSPFYPVRRLCLVLGLHYSGYYQWLKQPESLRARQDERQTGLIKQ
FT                   LWLESGTVYGYRKIWLDMKDLGERAGRNRVARLMRLAELASQTGYRKRRYYGGGKPSVA
FT                   SPNYLERQFIVPTPNTHWVSDMTYIRTHEGWLYLAVVLDLFSRRVIGWSMGGRMTAELV
FT                   MDALLMAVWRRKPTAEVLIHSDQGSQYTSERCQHFMASHNLKSSMSRRGNCHDNAVAES
FT                   FFQLLKRERIKKRIYKNREDAKADIFDYVEMFYNAKRRHSACEDQPPAVYESAWFMRHG
FT                   TV"
FT   gene            complement(435587..435865)
FT                   /locus_tag="Spro_0388"
FT   CDS_pept        complement(435587..435865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0388"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   psa:PST_3402 ISxac3 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39496"
FT                   /db_xref="GOA:A8G8Q6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q6"
FT                   /protein_id="ABV39496.1"
FT                   /translation="MSAKNFTEEFKIEAVKQVTEQGYPVSEVASRLGVSTNSLYAWVKR
FT                   YQKPEPQRKQDDAIQLEVKRLRQELKRVTEERDILKKAAAYFARTSG"
FT   gene            436410..437447
FT                   /locus_tag="Spro_0389"
FT   CDS_pept        436410..437447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39497"
FT                   /db_xref="GOA:A8G8Q7"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q7"
FT                   /protein_id="ABV39497.1"
FT                   /translation="MSIFLYHALFFLLSIAFLFPSDHLAVPIFIMLIGLLVISAIITPK
FT                   IWIIKRSRVDTRNGSRELRRSRYEHSIAWMLFGSVSMFAFIFITEFVSSVDYGAGFLIA
FT                   SFFSIFISSYYYLSNSEGSVGKGNKMIAWAIRVFSILSSFIILSWSKVAAMGYMDLTYN
FT                   DASSRMIIYAYSIMILLITAIPISGFIYMFVSLYETKVIERVYKNGSKIKKINLKYNSL
FT                   PIAIPLIMITTAFLMCYGKHHDVVDVYIVRKSIELDSAEGFWCGGGYKTLGANVDARFI
FT                   KLSEKDYREFIFKGNNISSYRLSCLSTYPYYEMKFVLIKASDIRMQMKADEINNDLKIV
FT                   TKMKG"
FT   sig_peptide     436410..436484
FT                   /locus_tag="Spro_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.629 at
FT                   residue 25"
FT   gene            438505..439392
FT                   /locus_tag="Spro_0390"
FT   CDS_pept        438505..439392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu1152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39498"
FT                   /db_xref="GOA:A8G8Q8"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q8"
FT                   /protein_id="ABV39498.1"
FT                   /translation="MSKLSKQLVTLARQGRGSFKTVADRSRIAERFSERLAKLNIQIRD
FT                   VKHVKTSHIEKYINSRKAENISIRTLQNEMASVRSIMSAAGRNKLADPSHDKLSNQALG
FT                   ISGASRDGTKTPLPDDKLAAIVSHVFRKDEGVAIGVQLSRYLGLRTEETVQSAKSLKTW
FT                   KQTILNDNDRVKVVFGTKGGRPRETTVFNREKVLSVLDKAIKYCDSHNGKLIDKPSLHT
FT                   AIERYRNIVREAGMTGKDAPHSLRYAYAKDAVTHHVNNGMSRDEANALVSMDLGHGDGR
FT                   GRYIKQVYFKNDIE"
FT   gene            439697..440668
FT                   /locus_tag="Spro_0391"
FT   CDS_pept        439697..440668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sty:HCM2.0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39499"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Q9"
FT                   /protein_id="ABV39499.1"
FT                   /translation="MSEYKIKEDGTLKWFKGMKELDGRVRLDIYSSMIEAIEVANETNQ
FT                   YLIKQIGEMDISSDVKESLTRKAWKVVTAKKRLMDEELLMLSVAKQRHSDIPPPNINSL
FT                   IVKDDDDELKRALYEQLKLMPYLKLVWLPKLNLVLENKGGDNWSKCYRANERASKYAFR
FT                   ARIAHAFGLSALAHWGETKATVRDILLPDFAKRLELESVKKLLDEALENGHRVLVAGEY
FT                   IFWYEESGSIGWKLKLRGDSSTKDDGSTLWHEGTIISKNHGRIVVLPYTTSTGKTVKGH
FT                   TKNAPKDGPAKPRHTDEYVELPFEVLEHDKMRGLLGESYHSA"
FT   gene            complement(441073..441267)
FT                   /locus_tag="Spro_0392"
FT   CDS_pept        complement(441073..441267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39500"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R0"
FT                   /protein_id="ABV39500.1"
FT                   /translation="MCCPEHSFIDSQFILGTPHTLDIPSRLFEVDKNALQKQCILCQSG
FT                   QAYSDTRVGKKLFSLVFHK"
FT   gene            442052..442411
FT                   /locus_tag="Spro_0393"
FT   CDS_pept        442052..442411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39501"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R1"
FT                   /protein_id="ABV39501.1"
FT                   /translation="MNVAFLTTTPQSLTQDLCDLANLEGHLLAVRALMRLDTGNEKGEG
FT                   EAYSLNQCGIANAAYRFGFAWYGGRFDSSACEPLINALHTLGTDLDPAVWKRCFDEGCN
FT                   DAEIEQEQVNLLTPM"
FT   gene            442525..443127
FT                   /locus_tag="Spro_0394"
FT   CDS_pept        442525..443127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stt:t4289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39502"
FT                   /db_xref="InterPro:IPR021436"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R2"
FT                   /protein_id="ABV39502.1"
FT                   /translation="MLHFDPAELRAVVAEIRANQCALVLAKDDGVYLMPAVGERDATGR
FT                   IKHLAYADGCHPQKDDAWYETSRQLVGGDDFGEELALTDSCIERILSQGHELWIHLLPE
FT                   TVYMHVAAVNWVGVADFRCMTARMLQLAEVHYSVCVSQDEFKSWRERAINLLATACHTD
FT                   CKRAKPADREDYLAMFERLKQRVDTVNPKGALRYPAF"
FT   gene            443174..444208
FT                   /locus_tag="Spro_0395"
FT   CDS_pept        443174..444208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0395"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   yen:YE3460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39503"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R3"
FT                   /protein_id="ABV39503.1"
FT                   /translation="MRLFYEDHSMKKTSSRQPAKARRERPDLYQQVTDKIIAAIEMGTL
FT                   PWRKPWRTDKARGASTAIMPQNGTTGYHYSGVNVLLLWMAADERGFHSNRWLTYKQAEA
FT                   VGGHVRAGETATLAVVFKPWDKQVEDADGRQLFDEDGNPLKTRIPMLKPLYLFNVAQCD
FT                   NLPETVVGITPAEELDEDSALVDAKTQAQVNTLVDACGVRFEQVYQDRAFYSPIRDQIV
FT                   LPQVRQFRTEADYWSTLLHELVHSTGHATRLNREGITSSSRAFGDPVYAFEELVAELGS
FT                   AFMCAQLGVFGDVQHDSYLEHWLKVLREDKRALFRAAKQAREASEFLLKPLVVPVITDP
FT                   AVAA"
FT   gene            444220..444483
FT                   /locus_tag="Spro_0396"
FT   CDS_pept        444220..444483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yen:YE3459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39504"
FT                   /db_xref="InterPro:IPR009610"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R4"
FT                   /protein_id="ABV39504.1"
FT                   /translation="MTIEQCYWQTIAGRLLAKYFGLTLNDTDLCEAACVMALQEVGVRP
FT                   FEAINNLVDKYHLVRLGSHPFTSSSPYLRQEEELGVIGEHEL"
FT   gene            444600..445523
FT                   /locus_tag="Spro_0397"
FT   CDS_pept        444600..445523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0397"
FT                   /product="protein of unknown function DUF1281"
FT                   /note="PFAM: protein of unknown function DUF1281; KEGG:
FT                   ypi:YpsIP31758_3689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39505"
FT                   /db_xref="InterPro:IPR009694"
FT                   /db_xref="InterPro:IPR023136"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R5"
FT                   /protein_id="ABV39505.1"
FT                   /translation="MSNWCKNRLVVTGQSVFVDELQQWVNGHVVPDYRHAIQQSCRMFL
FT                   AGCAGILKPATVKPGVYVPYPGLLAHPGVTSAQNLAFEQWFGLLKADVPLTGENIRLVE
FT                   RLYRQSGIDAVKWENIPVVAKERIADVLVRQYADWFGLVGLGPDIDVGNCWERLGTMPE
FT                   YTAPCDMLILIPTRLATELNGAGSLLRDIPTTAELYGRQYGVEWPSGHSVGCVRDGINT
FT                   LTVHFDSPWYPPAGEVIGILSEQFSCQVEHSWNMADAQRSGYDRYDRGEHVDGGRIAAR
FT                   VEVGEVIHLAYADKDAVPLSPNSAVG"
FT   gene            complement(445792..446544)
FT                   /locus_tag="Spro_0398"
FT   CDS_pept        complement(445792..446544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0398"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ypi:YpsIP31758_2523 oxidoreductase,
FT                   short chain dehydrogenase/reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39506"
FT                   /db_xref="GOA:A8G8R6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R6"
FT                   /protein_id="ABV39506.1"
FT                   /translation="MSKKQTVIITGALSGIGEECARTFSQVGYNVVISGRNEQRGRELE
FT                   AELRQINPEIHFFLADIVFENQVSELIKYTQQVFGTIDVLLNVAGTEGQPISHDKTTVE
FT                   DFRHVFDTNVLGTQLVMKHVLPVMSKQGSGSLINFSSQAGQVGIPGGSVYSASKHAVNG
FT                   LTRSAALEVAADGVRVNAIAPGPVATAMFDRFVGNDPIAKENFLSKMPTGRIVTTEEIA
FT                   ATALFLASDNARSIIGQIITVDGGYSVG"
FT   gene            446810..447493
FT                   /locus_tag="Spro_0399"
FT   CDS_pept        446810..447493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0399"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: asa:ASA_P5G023
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39507"
FT                   /db_xref="GOA:A8G8R7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R7"
FT                   /protein_id="ABV39507.1"
FT                   /translation="MTKIDSRQFSPLDEKNAPTIEYYLDNPVIPACAGITLVKDLNHRF
FT                   VASNLLFSRFSGVDPYRLPTLDDSDMPWAERGDIYRDHEKAILAGEVYNVLEPLPGVVH
FT                   AFLHTSKQVIYDKNGFPAGTTATAIIMNGHIDFHNVTGASKVLKISSYKDVKLSANEAK
FT                   LLFFLLKGLKRKQISELLNINLANYDYCMRNLKVKFNVSSSVQLIDECIKLGYQDTFPF
FT                   QIFFK"
FT   gene            448292..450004
FT                   /locus_tag="Spro_0400"
FT   CDS_pept        448292..450004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0400"
FT                   /product="Relaxase"
FT                   /note="PFAM: protein of unknown function DUF1528; Relaxase;
FT                   KEGG: eca:ECA0613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39508"
FT                   /db_xref="GOA:A8G8R8"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R8"
FT                   /protein_id="ABV39508.1"
FT                   /translation="MLKAIKELLVGTRDMPAKPTASTSGSRGPAGYYMPASAEQLLSTA
FT                   SRKQCLQQLWENCALPKDLYEQFYLQPLKQLMTLMQVLPATPLGEYAREGGLVDVTLQT
FT                   TTYAVRLAKGHMLPPGAVPEEQSAQNVQWNVVVFYAALWHYLPLLSQLQGEFQSGRAWL
FT                   PGLTVPGEPYRFRFSAILPVPALTASQSAMIAARLLPAEVIDWLSTLPAAAHSLMTIAS
FT                   RQPSALLPVIDDIIQEAAKLARGDSLSIASSPASISDTLTVVLPSVALTTENITSSVPA
FT                   IDLQSAVSSTNPPRVEEQLPAETLNQTEENAASAPEALLSSALDVSVNGKVLAEMVPAP
FT                   ETVVGIEEDMQTLLSLMAVEVSAPVNQTEQEFGDAPHVDEGPMPADNPVLSAEVTQGAE
FT                   AAEINRESDAIDDIAPEVAFSTTEFCPPQTTDLAPSQSQKLGIEGDGGITPGEVFWRWL
FT                   AEGLNSNEIPINSVGTRVHLVSGFVFITVPGIFYLYLKQAGLDGSQREALQEDFERLEK
FT                   HRRVKGKRFYFAHLYETSERTGAFKRTKGYLVKASLLYRGKNLPDDSPVLVIP"
FT   gene            450072..451085
FT                   /locus_tag="Spro_0401"
FT   CDS_pept        450072..451085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0401"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: plu:plu1166
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39509"
FT                   /db_xref="GOA:A8G8R9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8R9"
FT                   /protein_id="ABV39509.1"
FT                   /translation="MHKSRVMDWDTLLEEYFFSKALRPETEKSYRRVVAVFRKFIGYDR
FT                   LPDEVTNRDLILWRRDMLGRGLTTSTWNNKARHLRAIYNQGIKKKWLNVVENPLNETQV
FT                   PSGNKRKKTLNRDQLVKVNLVLEQFEEREKLRVGKCRPCALFPVWYWRTVIDVLRSTGM
FT                   RQNQLLHIRLMDVDLEANSMLLCKEGSKTHREWLVPIVSFIRERMRILVDRAIAQGAEP
FT                   ADYLFDVARFLNPLGEVDSEPAIQPVRSFFTRLTKECGFKVSPHRFRHTLATEMMKSPD
FT                   RNLAMVKGLLGHRSVSTTMEYVELDLKITGQALENELSLYMDVIPAREGEGRLVLT"
FT   gene            complement(451284..451359)
FT                   /locus_tag="Spro_R0021"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(451284..451359)
FT                   /locus_tag="Spro_R0021"
FT                   /product="tRNA-Phe"
FT   gene            complement(451519..452109)
FT                   /locus_tag="Spro_0402"
FT   CDS_pept        complement(451519..452109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0402"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ypk:y0598
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39510"
FT                   /db_xref="GOA:A8G8S0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S0"
FT                   /protein_id="ABV39510.1"
FT                   /translation="MEEAQVQREHVLDTALGLLEQQGLATTTLEMLADKLDVQPGDLKR
FT                   FWPDREALLYDCLRYHGQQIDTWRRQLLLDETLSPQQKLLARYDVLAEYVKHDRYPGCL
FT                   FIAACSFFPEVDHPIHQLAEQQKLTSLDLTRDLLREMDADDADMVAQQMELIQEGCLSK
FT                   LLIKRQLQDVSVAKRLAEDILQVAQCRRNGALS"
FT   gene            complement(452135..453820)
FT                   /locus_tag="Spro_0403"
FT   CDS_pept        complement(452135..453820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0403"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; Thioredoxin domain; KEGG: ypi:YpsIP31758_3681
FT                   thiol:disulfide interchange protein DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39511"
FT                   /db_xref="GOA:A8G8S1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S1"
FT                   /protein_id="ABV39511.1"
FT                   /translation="MIFLLCSLFFLPQAAQASLFAPNGGTQFVPVDQAFAFDFKQQDHQ
FT                   LTLNWQIRPGYYLYRQQIKLVPQQARLGSFELPAGLSHKDEFFGEVSIFKQQLNLPIPL
FT                   QQATSGASLSVTYQGCAEAGFCYPPETRVIPLDAVSATTALPVSAPEEPVPASLPFSPL
FT                   WALLIGIGIAFTPCVLPMYPLISGIILGREKPHSSGRILALAVVYVQGMALTYTLLGLV
FT                   VAAAGLQFQAALQHPYVLIGLSVLFIALALSMFGLYSLQLPSSLQTRLAGWSNSQQGGS
FT                   LPGVFLMGALAGLICSPCTTAPLSAILLYIAQSGNMWAGGGTLYLYALGMGIPLVLVTL
FT                   FGNRLLPRSGPWMQYVKEAFGFVILALPVFLLERVIGDVWGLRLWSLLGLAFFGWAFAL
FT                   SLKTSRGWVRALQLLLLAAAVIAARPLQDWAFGISSAQQAAVQHLNFTRISNVDQLNAA
FT                   LQQAQGKPVMLDLYADWCVACKEFEKYTFSDTRVQAALANTVLLQADVTANNAEQVALL
FT                   KHLKVLGLPTILFFNGTGQESTSQRVTGFMDAAAFNAHLQKTVQ"
FT   sig_peptide     complement(453767..453820)
FT                   /locus_tag="Spro_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.956 at
FT                   residue 18"
FT   gene            complement(453817..454140)
FT                   /locus_tag="Spro_0404"
FT   CDS_pept        complement(453817..454140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0404"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   ypi:YpsIP31758_3680 divalent-cation tolerance protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39512"
FT                   /db_xref="GOA:A8G8S2"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S2"
FT                   /protein_id="ABV39512.1"
FT                   /translation="MSDCEAVVILCTAPDEATAQDLAARVLGEKLAACVTLLPGASSLY
FT                   YWEGKLEQEYEVQMLFKSQRSHQDALLNYLKQHHPYQTPELLVLPVMAGDKDYLLWINA
FT                   SLN"
FT   gene            complement(454263..455564)
FT                   /locus_tag="Spro_0405"
FT   CDS_pept        complement(454263..455564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0405"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: yen:YE0350 anaerobic C4-dicarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39513"
FT                   /db_xref="GOA:A8G8S3"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S3"
FT                   /protein_id="ABV39513.1"
FT                   /translation="MLAVELVIVLLAIFLGARLGGIGIGFAGGLGVLVLALIGVKPGSI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPIVTYFLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGVS
FT                   YLHLLMVVMPSTFCAVVLMSLLVSWLFDSKLSDDPVYLKRLEEGLVTLRGNKVMEIKPR
FT                   AKVSVLLFLLGVLCVVAYAIINSPGLGLVAKPLMNTTNAILIIMLSVATLTTLLCKVDT
FT                   DMVLNSSTFKAGMSACICILGVAWLGDTFVQANIDWIKDTAGSVIQSHPWLLAVIFFFC
FT                   SALLYSQAATAKALMPMALALNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGRFVFNHPFFIPGTIGVILAVLFGFLLGSVML"
FT   gene            complement(455690..457126)
FT                   /locus_tag="Spro_0406"
FT   CDS_pept        complement(455690..457126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0406"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: yen:YE0351 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39514"
FT                   /db_xref="GOA:A8G8S4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S4"
FT                   /protein_id="ABV39514.1"
FT                   /translation="MSNNIRIEEDLLGTREVPAEAYYGVHTLRAIENFYISNSKISDVP
FT                   EFVRGMVMVKKAAALANKELKTIPRKIADVIIQACDEVLDKGKCMDQFPVDVFQGGAGT
FT                   SLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASNQKL
FT                   IDAINQLREGFDHKAKEFETILKMGRTQLQDAVPMTLGQEFHAFSVLLKEETRNLHRTA
FT                   ELLLEVNLGATAIGTALNTPEGYSHLAVQKLAEVSNLPVVPAEDLIEATSDCGAYVMVH
FT                   SALKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVIPEVVNQVC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCINGITANKE
FT                   VCEHYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFS
FT                   VENLMHPAYKAKRYTDENEQ"
FT   gene            457427..457963
FT                   /locus_tag="Spro_0407"
FT   CDS_pept        457427..457963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0407"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   yen:YE0352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39515"
FT                   /db_xref="GOA:A8G8S5"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S5"
FT                   /protein_id="ABV39515.1"
FT                   /translation="MSPLCGNVDLPEENQVRWLPLLLIFLLAYIEISLFIKVAAVMGVA
FT                   ITLLLVVFTSCVGISLVRNQGMKTFMQMQQKLAAGESPAAEMVKSVSLVLAGFLLLVPG
FT                   FFTDFLGLLLLLPPVQKSLTLKLMPHLSVYRPGGWGTGGDAANGNTFDGEFQRKSDDRY
FT                   TLGSQPEDRDKPNDR"
FT   gene            458149..458442
FT                   /locus_tag="Spro_0408"
FT   CDS_pept        458149..458442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0408"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: stm:STM4329 chaperone
FT                   Hsp10, affects cell division"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39516"
FT                   /db_xref="GOA:A8G8S6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8S6"
FT                   /protein_id="ABV39516.1"
FT                   /translation="MSIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVVAVGK
FT                   GRVLENGNVQPLDVKVGDIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            458487..460133
FT                   /locus_tag="Spro_0409"
FT   CDS_pept        458487..460133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0409"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: stm:STM4330 chaperone Hsp60 with
FT                   peptide-dependent ATPase activity, affects cell division"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39517"
FT                   /db_xref="GOA:A8G8S7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8S7"
FT                   /protein_id="ABV39517.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGKLIA
FT                   EAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTGGTVISEEIGLELEKTTLEDLGTAKRIVINKDTTIIIDGNGEEP
FT                   AIQGRVSQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAASKLSELRGVNEDQNVGIKVALRAMESPLRQIVLNC
FT                   GEEPSVVANTVKAGEGNYGYNAATEEYGDMIAMGILDPTKVTRSALQYAASVAGLMITT
FT                   ECMVTDLPKGDAPDLGGAGGMGGMGGMGGMM"
FT   gene            460376..460720
FT                   /locus_tag="Spro_0410"
FT   CDS_pept        460376..460720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39518"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S8"
FT                   /protein_id="ABV39518.1"
FT                   /translation="MRIKALLGLSAAVLLAGCSSTNELSAAGQQVKFTDTKPAAECQLV
FT                   GEVTGTQSNWLSGNGGEGSSMRGAANDLRNKAAAMGGNVIYGATSPSQNLLSSFAPLDS
FT                   KMAGQVYKCP"
FT   sig_peptide     460376..460456
FT                   /locus_tag="Spro_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.456 at
FT                   residue 27"
FT   gene            complement(460800..461828)
FT                   /locus_tag="Spro_0411"
FT   CDS_pept        complement(460800..461828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0411"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: yen:YE0356 hypothetical protein; TIGRFAM:
FT                   lysine 2,3-aminomutase YodO family protein; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39519"
FT                   /db_xref="GOA:A8G8S9"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8S9"
FT                   /protein_id="ABV39519.1"
FT                   /translation="MAHIITQNTAYREDWLHQLADVITDPDELLQLLSLNTHPELPQGR
FT                   EARRLFALRVPRSFVARMQPGDANDPLLRQVLTASEEFINAPGFTTDPLDEQRSVVPGL
FT                   LHKYRNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWRQALDYIRQHPELDEIIFS
FT                   GGDPLMAKDHELDWLIGELEAIEHLKRLRIHTRLPVVIPARITPELCRRLSASRLQVLM
FT                   VTHINHANEIDRELQASMAQLRLAGVTLLNQSVLLRGINDDADTLAALSNALFDAGILP
FT                   YYIHVLDKVQGAAHFMVSDDEARTIMQALLGKISGYMVPRLTREVGGKPSKTPLDLHLM
FT                   QD"
FT   gene            461871..462437
FT                   /locus_tag="Spro_0412"
FT   CDS_pept        461871..462437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0412"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor KOW
FT                   domain protein; Elongation factor P; KEGG: eca:ECA3976
FT                   elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39520"
FT                   /db_xref="GOA:A8G8T0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8T0"
FT                   /protein_id="ABV39520.1"
FT                   /translation="MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRR
FT                   LLTGSRVEKTFKSTDSCEGADVVDTNMNYLYNDGEFYHFMHPETFEQHGVEEKTVSDAA
FT                   KWLQDNAECIVTLWDGRPIAVQPPNFIEAEITDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVVRVDTRSGEYVSRVK"
FT   gene            462508..462636
FT                   /locus_tag="Spro_0413"
FT   CDS_pept        462508..462636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0413"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: sec:SC4214 putative
FT                   entericidin A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39521"
FT                   /db_xref="GOA:A8G8T1"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8T1"
FT                   /protein_id="ABV39521.1"
FT                   /translation="MKKTLLAVISLLLLMSLSGCNTFRGFGEDVQHLGGAISRTAS"
FT   sig_peptide     462508..462591
FT                   /locus_tag="Spro_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.710 at
FT                   residue 28"
FT   gene            462759..462890
FT                   /locus_tag="Spro_0414"
FT   CDS_pept        462759..462890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0414"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: eca:ECA3975
FT                   entericidin B"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39522"
FT                   /db_xref="GOA:A8G8T2"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8T2"
FT                   /protein_id="ABV39522.1"
FT                   /translation="MLKKSIIAIFSLMFLASLTACNTTQGVGEDIQAGGKAIQRSAE"
FT   sig_peptide     462759..462821
FT                   /locus_tag="Spro_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.471 at
FT                   residue 21"
FT   gene            463108..463434
FT                   /locus_tag="Spro_0415"
FT   CDS_pept        463108..463434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0415"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   stm:STM4338 putative DMT superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39523"
FT                   /db_xref="GOA:A8G8T3"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8T3"
FT                   /protein_id="ABV39523.1"
FT                   /translation="MAWIILLIAGLLEVVWAIGLKYTHGFTRLTPSLITIAAMVVSMLL
FT                   LAHAMKTLPAGTAGTAYAVWTGIGAVGAAIMGMVLLGESTNIARILSLCLIVVGILGLK
FT                   FSSH"
FT   gene            complement(463478..463837)
FT                   /locus_tag="Spro_0416"
FT   CDS_pept        complement(463478..463837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0416"
FT                   /product="fumarate reductase D subunit"
FT                   /note="PFAM: fumarate reductase D subunit; KEGG:
FT                   ypi:YpsIP31758_3670 fumarate reductase, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39524"
FT                   /db_xref="GOA:A8G8T4"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8T4"
FT                   /protein_id="ABV39524.1"
FT                   /translation="MINQAPKRSDEPVFWGLFGAGGMWGAIIAPAIVLLVGILLPLGLF
FT                   PGDALGYDRILAFCQSLIGRLFLLLMIILPLWCGLHRIHHAMHDLKIHVPAGKWVFYGL
FT                   AAILSVVTVIGVVTL"
FT   gene            complement(463850..464242)
FT                   /locus_tag="Spro_0417"
FT   CDS_pept        complement(463850..464242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0417"
FT                   /product="fumarate reductase subunit C"
FT                   /note="PFAM: fumarate reductase subunit C; KEGG: yen:YE0362
FT                   fumarate reductase hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39525"
FT                   /db_xref="GOA:A8G8T5"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8T5"
FT                   /protein_id="ABV39525.1"
FT                   /translation="MTTQRKPYVRTMTPTWWQKLGFYRFYMLREGTSVPAVWFSIVLIY
FT                   GVFALKGGVDSWAGFVGFLQNPLVLLINFVALLAALLHTKTWFDLAPKAANIVVNSEKM
FT                   GPGPIVKTLWAVTVVASVVILAVALV"
FT   gene            complement(464258..464992)
FT                   /locus_tag="Spro_0418"
FT   CDS_pept        complement(464258..464992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0418"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: yen:YE0363 fumarate reductase iron-sulfur
FT                   protein; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39526"
FT                   /db_xref="GOA:A8G8T6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8T6"
FT                   /protein_id="ABV39526.1"
FT                   /translation="MAEMNTLKIEVMRYNPERDSEPHFETFAVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNRVPKLACKTFLREYTGGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNNRKPEDGPNVQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGQKQRMAQLNGDNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   gene            complement(464985..466781)
FT                   /locus_tag="Spro_0419"
FT   CDS_pept        complement(464985..466781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0419"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="KEGG: ypi:YpsIP31758_3667 fumarate reductase,
FT                   flavoprotein subunit; TIGRFAM: fumarate reductase,
FT                   flavoprotein subunit; succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39527"
FT                   /db_xref="GOA:A8G8T7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8T7"
FT                   /protein_id="ABV39527.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDSFDYHFNDTVAGGDWLCEQDVVDHFVHNCPREMTQLEQWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DDGQARGLVAMNMMEGTRVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETDQNCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEQAARRALETGPANGSALDAQGRDVETRLSNLMKQEGNENWAKIRDEMGM
FT                   SMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDSSSVFNTDLLYTIELGYGLDVAE
FT                   CMAHSAFNRKESRGAHQRLDEGCTERDDVNFLKHTLAFHNPNGAPRLEYSDVKITKLPP
FT                   AKRVYGAEAEAQDKKDKEQANG"
FT   sig_peptide     complement(466710..466781)
FT                   /locus_tag="Spro_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.362 at
FT                   residue 24"
FT   gene            467167..468144
FT                   /locus_tag="Spro_0420"
FT   CDS_pept        467167..468144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0420"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase-related protein GenX;
FT                   PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   yen:YE0365 putative lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39528"
FT                   /db_xref="GOA:A8G8T8"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8T8"
FT                   /protein_id="ABV39528.1"
FT                   /translation="MSETASWQPSAPIANLLKRAAILTEIRRFFADRGVLEVETPTMSQ
FT                   ATVTDIHLFPFQTRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGPIYQMGRSFRNEEA
FT                   GRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCDSAETLSYQQAFLRHLDIDPLS
FT                   AEKAQLREAAAKLDLSNIADTEEDRDTLLQLLFTVGVEPHIGRDKPAFVYHFPASQASL
FT                   AEISTEDHRVAERFEVYFKGIELANGFRELTDSREQGQRFAQDNRKRAERGLPQHPIDN
FT                   NLLDALQHGMPECSGVALGVDRLVMLALGAESLSEVLAFPVDRA"
FT   gene            complement(468327..471674)
FT                   /locus_tag="Spro_0421"
FT   CDS_pept        complement(468327..471674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0421"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   ypi:YpsIP31758_3664 mechanosensitive ion channel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39529"
FT                   /db_xref="GOA:A8G8T9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8T9"
FT                   /protein_id="ABV39529.1"
FT                   /translation="MRLIITLLLGCLLSQPVLAAAVPTETQLKQELKQAEGNKNAPNQA
FT                   ETTEALQSALNWLSERKESLTRVEQYQRVIDDFPKMTQELRRQLVIEESKILPNGDNLP
FT                   ASDLEQQILQTSSLLLEQARLLQQEQERTREISDSLGQLPQQQTDARRALTEVQRRLQA
FT                   QPANPTTPHAQAALALLQTEAAARKAKVDELELAQLSANNRQELARMRAEVYKKRHEKI
FT                   DIQLQALRNNLNAQRQREAELALEKTEQLAEQNGDLPKSISRQLQINRELSAALNNQAQ
FT                   RMDLISSQQRQAAAQTLQVRQALSTIIEQAQWLGSSSALGETLRAQVATLPEMPKPQQL
FT                   DGDMAQLRVQRLQFESQLEKLSQREFKRDDGSELTSAERRIVDAQLRTQRELLNSLLSG
FT                   CDTQILELTKLKVANTQLIEALNEIRDATHRYLFWVPDINPINLSYPINVAHDLTVLLS
FT                   LDTLSQLGGAFMMMVTSKETLIPIFGALLLVIFSISSRKHYHAFLTRASSRVGKVTQDE
FT                   FFLTVRTVFWSILVALPLPVLWAALGFGLQSAWNYPVAEAIGKGVTATLPILWVCMICA
FT                   AFAHPQGLFIVHFRWPVKQVSRAMRYYKMSIWLIVPLIMALITFDSLKEREFASTLGRL
FT                   CFILLCLALALVTNSLKRAGIPLYLDKKGSGENMVNTALWGLLLSAPVLAALASAVGYL
FT                   TTAQALLARLETSVAIWFFLLVIYHIIRRWMLIQRRRIAFDRAKQRRADILAQRARGEE
FT                   ETPHTPNSTEGSMDMDDSEIDLDTISAQSLRLVRSILTMIALVSVIVLWSEIHSAFAFL
FT                   ENITLWNVSSTVNGVDTPHPITLGAVLIAILVLIVTMQLVRNLPALLELAVLQHLDLTP
FT                   GTGYAITTITKYLLLLFGAVLSFSWIGIEWSKLQWVVTALSVGLGFGMQEIFSNFISGL
FT                   IILFEKPIRIGDTVTIRNLTGSVTKINTRATTISDWDRKEIIVPNKAFITEQFINWSLS
FT                   DNLTRVVLTVPAPGDANSEEVTKILTNAAERCSLVLDTPAPEVYLVDLQQGIQIFELRI
FT                   YAAEMGHRMPLRHEIHQLILDGYREHGITLPYPPFQVRSETLSRLTSNGRTPPSTPPPN
FT                   TKRESGSL"
FT   sig_peptide     complement(471615..471674)
FT                   /locus_tag="Spro_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 20"
FT   gene            complement(471688..472638)
FT                   /locus_tag="Spro_0422"
FT   CDS_pept        complement(471688..472638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0422"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: yen:YE0367 phosphatidylserine decarboxylase
FT                   proenzyme; TIGRFAM: phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39530"
FT                   /db_xref="GOA:A8G8U0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8U0"
FT                   /protein_id="ABV39530.1"
FT                   /translation="MAEPRLQCAPFTPIHEVNVLDSIKIKLQYWLPKLALTRLAGWGAD
FT                   KQAGWLTQLVVKGFARYYRVDMQEAQNPDLTSYATFNDFFVRPLRDGARPIVDGTHWLA
FT                   LPADGAISQLGPINDDQIFQAKGHYYSLEALLAGNYMLAEPFRNGLFATTYLAPRDYHR
FT                   VHMPCDGVLREMIYVPGDLFSVNPLTAANVPNLFARNERVICVFDTAIGPMVQILVGAT
FT                   IVGSIETVWAGTVTPPREGIIKRWTYPAEGTEGAIALEKGAEMGRFKLGSTVINLFTPG
FT                   SVQFAPQLNNGTVTRMGEAFAEIPAASVAAETTQI"
FT   gene            complement(472660..473709)
FT                   /locus_tag="Spro_0423"
FT   CDS_pept        complement(472660..473709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0423"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: yen:YE0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39531"
FT                   /db_xref="GOA:A8G8U1"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8U1"
FT                   /protein_id="ABV39531.1"
FT                   /translation="MSKNKLSKGQERRVQANHQRRLKRTDNKPELDDSQLGEPQDGIVI
FT                   SRFGMHADVEAADGTQHRCNIRRTLRSLVTGDRVVWRPGVGTHAGVKGIVEAVHERTSV
FT                   LNRPDIYDGVKPIAANIDQIVIVSAILPELSLNMIDRYLVACETLEVEPLIVLNKIDLL
FT                   DAEARKTVDGMMDIYRHIGYRVLEVSSQTREGMEAFEQALADRISIFAGQSGVGKSSLL
FT                   NALLPPSDKQILVNQVSDVSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLEPEQ
FT                   VTQAYVEFRDYLGGCKFRDCRHDTDPGCAIRGAMEKGDIAKERFENYHRILESMASVKV
FT                   RKNFTDAAG"
FT   gene            473893..474438
FT                   /locus_tag="Spro_0424"
FT   CDS_pept        473893..474438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0424"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: yen:YE0369 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39532"
FT                   /db_xref="GOA:A8G8U2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8U2"
FT                   /protein_id="ABV39532.1"
FT                   /translation="MTGNENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPV
FT                   IAVHQSDEQLGLMDDWNVRTHTGSGLVERVKASQYDDHAAELATIAFLQQWVPAGKSPI
FT                   CGNSVGQDRRFLFRYMPELEAYFHYRYLDVSTLKELARRWKPEILSGFKKQGTHQAMDD
FT                   IRESVGELAYYREHFIQL"
FT   gene            474644..474719
FT                   /locus_tag="Spro_R0022"
FT                   /note="tRNA-Gly2"
FT   tRNA            474644..474719
FT                   /locus_tag="Spro_R0022"
FT                   /product="tRNA-Gly"
FT   gene            474784..474859
FT                   /locus_tag="Spro_R0023"
FT                   /note="tRNA-Gly3"
FT   tRNA            474784..474859
FT                   /locus_tag="Spro_R0023"
FT                   /product="tRNA-Gly"
FT   gene            474915..474990
FT                   /locus_tag="Spro_R0024"
FT                   /note="tRNA-Gly4"
FT   tRNA            474915..474990
FT                   /locus_tag="Spro_R0024"
FT                   /product="tRNA-Gly"
FT   gene            complement(475289..476428)
FT                   /locus_tag="Spro_0425"
FT   CDS_pept        complement(475289..476428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0425"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: putative iron-sulfur cluster binding
FT                   protein; PFAM: domain of unknown function DUF1730; KEGG:
FT                   eca:ECA3940 putative 4Fe-4S binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39533"
FT                   /db_xref="GOA:A8G8U3"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8U3"
FT                   /protein_id="ABV39533.1"
FT                   /translation="MTHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLSAEEPKLQAWLD
FT                   KQYHGEMEWMARHGMLRARPHELLPGTLRVISVRMNYLPAKAAFASTLQNPELGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDQIQAYCGELNFRPFVDSAPVMERALASKAGIGWVGKHSLI
FT                   LNREAGSWFFLGELLIDLPLPVDEPQQEQCGRCVACITTCPTGAIVAPYTVDARRCISY
FT                   LTIELEGAIPEEFRPLLGNRIYGCDDCQLICPWNRFSQLTDEDDFSPRAALHAPQLIEL
FT                   FAWTEEKFLRITEGSAIRRIGHLRWLRNIAVALGNAPYQDAIVIALRSRLEQDAMLDEH
FT                   IHWALKQQLGRREEQGIEVQTMQKKRLIRAVEKGLPRDA"
FT   gene            476550..477938
FT                   /locus_tag="Spro_0426"
FT   CDS_pept        476550..477938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0426"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: yen:YE0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39534"
FT                   /db_xref="GOA:A8G8U4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8U4"
FT                   /protein_id="ABV39534.1"
FT                   /translation="MQRAGEAAYILARDQYPAAHHWLVLCGHGNNGGDGYVVARLAAAA
FT                   GVKVSLIACEGTRPLPPEAAEARRAWLAAGGEIHPADSRWPEDSDLIIDGLLGTGLSRA
FT                   PRAPYDALIEAANRSCAPVIALDIPSGLLAESGAVPGVVIRASHTMTFIALKPGLLTGQ
FT                   ARDWVGQLHQSTLGLSGWLAKQPTQIQRLTAESLPLWLKPRRPCSHKGEQGRLLVVGGD
FT                   HGFGGAIRMAAEAALRSGAGLVRVLTHIEHVGPLLTARPELMVQPLSDETLQQALDWAD
FT                   VLVVGPGLGQGEWGRNALKVLQASDKPALWDADALNLLALNPEKRQNRVITPHPGEAAR
FT                   LLGCRTAEIESDRLLAVRKLVAQYGGIAVLKGAGTLIADQYGQMAIADVGNAGMASGGM
FT                   GDVLSGIIGGLLGQKLSLYDAACAGCVAHGAAADRVAARQGIRGMLASDLLPEIPYYVN
FT                   PELA"
FT   gene            477953..478423
FT                   /locus_tag="Spro_0427"
FT   CDS_pept        477953..478423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0427"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   eca:ECA3938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39535"
FT                   /db_xref="GOA:A8G8U5"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8U5"
FT                   /protein_id="ABV39535.1"
FT                   /translation="MKELVLPLPDEAATVALGAVLAKACDRASVIYLYGDLGAGKTTFS
FT                   RGFLQALGHQGNVKSPTYTLVEPYALQPLAVYHFDLYRLADPEELEFMGIRDYFAQDAI
FT                   CLVEWPQQGTGVLPEPDLELHLSYQDQGREAKIQAVSAYGSQLLDRIHGPQE"
FT   gene            478431..480224
FT                   /locus_tag="Spro_0428"
FT   CDS_pept        478431..480224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0428"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: Peptidoglycan-binding LysM; cell wall
FT                   hydrolase/autolysin; KEGG: yen:YE0374 putative
FT                   N-acetylmuramoyl-L-alanine amidase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39536"
FT                   /db_xref="GOA:A8G8U6"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8U6"
FT                   /protein_id="ABV39536.1"
FT                   /translation="MTYALRKLFVIALIAVLGPLGAASALAASSLSDIKVTNAQREATV
FT                   SVSFNGPPDYAFFPLHGPDRVVLDVNQKGKVGGLPLNFSGQNLVKSIRSSTPKDAQSVR
FT                   LVFDLTQRSKTRVATRQSGSIYTVVFTIAAEGSANTNIVRKAPVPAPVVSQPTRKAPVV
FT                   VSEPDEPAPVRKAPSGSNPFSNKTTVVAGTASEITPRSSRVSAGSGDRVVVAIDAGHGG
FT                   QDPGAIGPNGLKEKNVTIAIARRLQALLDADPQFKPVLTRNGDYFISVMGRSDVARKQG
FT                   ANVLISIHADAAPNRSANGASVWVLSNRRANSEMAGWLEQHEKQSELLGGAGDLLANSQ
FT                   ADPYLSQAVLDLQFGHSQRVGYDVAVKVLQQLQSVGSLHKRRPEHASLGVLRSPDIPSL
FT                   LVETGFISNSTEERLLGSSAYQEKIARAIHNGLRSYFLAHPLQADPKVENRPLDVAAAV
FT                   NSSTPDVSQPAPIVSSAGSSRISGKTQIHVVKRAETLSGIADSYGTTMAALRDLNKLKK
FT                   DGVWVGQRLKVPAGKSAAAASTVAKAKPSVKKPSKHKVARGDTLTSIASRYGVSVSDLK
FT                   RVNKLKSDVAPLDRTLTIPQA"
FT   sig_peptide     478431..478514
FT                   /locus_tag="Spro_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 28"
FT   gene            480246..482120
FT                   /locus_tag="Spro_0429"
FT   CDS_pept        480246..482120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0429"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region ATPase domain protein; DNA mismatch
FT                   repair protein domain protein; MutL dimerisation; KEGG:
FT                   yen:YE0375 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39537"
FT                   /db_xref="GOA:A8G8U7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8U7"
FT                   /protein_id="ABV39537.1"
FT                   /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGSGIGKDDLALALARHATSKISTLDDLEAIVSLGFRGEALASISS
FT                   VSRLTLTSRTAEQNEAWQAYAEGRDQAVTVKPAAHPIGSTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEVVRRIALARFDVAINLSHNGKLMRQYRAAKDESQYERRLGSICGPAFLQ
FT                   HALNISWQHGDLTIRGWVADPAGARQLGEMQYCYVNSRMMRDRLINHAIRQAYQDQLKD
FT                   DQQPAYVLYLEVDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTTVLQQVGNAPLPLT
FT                   DETEQQPTPVWQPENRVAAGGNHFSQPAPRRETASTEPAVARERAPQPAYHSGSGYQKR
FT                   EGELYGKLLQATPVAEPRQEAPKQPLFPPVKTEQETPLAGSQHSFGRVLMIYPPCYALI
FT                   ENGQQLMLLNLPVAERWLRQAQLNPSQEGLRPQPLLIPIKLTLNKQEAAACIHHQPLLV
FT                   TMGLDLQVDHGRVTLRAVPLPLRQQNLQKLIPELLGYLAEHQEMSPAVLATWFARHLGS
FT                   EHEQWNTSQAIQLLTDVERLCPQLVKSPPSGLLQPVDLQAALTALRHD"
FT   gene            482113..483054
FT                   /locus_tag="Spro_0430"
FT   CDS_pept        482113..483054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0430"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: yen:YE0376 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39538"
FT                   /db_xref="GOA:A8G8U8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8U8"
FT                   /protein_id="ABV39538.1"
FT                   /translation="MIETEMTPRPPAIFIMGPTASGKTALAIALRERLPVELISVDSAL
FT                   IYRGMDIGTAKPSAEELAQAPHRLIDIRDPAEAYSAADFRADALKEMAAITAAGRIPLL
FT                   VGGTMLYFKALLEGLSPLPPADPAVRERIEQQAAEQGWDVLHRQLQEIDPVAALRIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGESLPYHVHQFAIAPTSRELIHQRIELRYHQML
FT                   AAGFETEARALFARGDLHTDLPSIRCVGYRQMWSYLSGEISYDEMVYRGICATRQLAKR
FT                   QMTWLRGWDSVHWLDSEKPGEALDSVIQVVSA"
FT   gene            483169..483477
FT                   /locus_tag="Spro_0431"
FT   CDS_pept        483169..483477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0431"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: ypi:YpsIP31758_3653 RNA
FT                   chaperone Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39539"
FT                   /db_xref="GOA:A8G8U9"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8U9"
FT                   /protein_id="ABV39539.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNTPSGGTSNYHHGNNPSAPQQPQQESDDAE"
FT   gene            483573..484853
FT                   /locus_tag="Spro_0432"
FT   CDS_pept        483573..484853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0432"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   yps:YPTB0426 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39540"
FT                   /db_xref="GOA:A8G8V0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V0"
FT                   /protein_id="ABV39540.1"
FT                   /translation="MFDRYEAGEQAVLVHIYFSQDKDTEDLSEFESLVSSAGVEALQVV
FT                   TGSRKAPHPKYFVGEGKAEEIADAVKASGASVVLFDHSLSAAQERNLERLCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRISLILRRLERVAKQREQGRRARTRAEVPTVSLVGYTNAGKSTLFNRITSADV
FT                   YAADQLFATLDPTLRRIDVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HVIDAADTRVDENIEAVNTVLAEIESDEIPTLLVMNKIDMLDDFVPRIDRNDENLPIRV
FT                   WLSAASGEGIPLLYQALTERLSGEIAHYELRLPPEAGRLRSRFYQLQAIEKEWNEEDGS
FT                   IGVVVRMPIVEWRRLCKQELDLINFIV"
FT   gene            484922..486181
FT                   /locus_tag="Spro_0433"
FT   CDS_pept        484922..486181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0433"
FT                   /product="HflK protein"
FT                   /note="TIGRFAM: HflK protein; PFAM: band 7 protein; KEGG:
FT                   ypp:YPDSF_3599 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39541"
FT                   /db_xref="GOA:A8G8V1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V1"
FT                   /protein_id="ABV39541.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNGGNSGGNNKGGRDQGPPDLDDIF
FT                   RKLSKKLSGLGGGKGSNNNNDGGTGTSGPGFSGRIIGIAAVAVVVIWAASGFYTIKEAE
FT                   RGVVTRFGKFSHLVQPGLNWKPTFIDEVRPVNVESVRELAASGVMLTSDENVVRVEMNV
FT                   QYRVTNPEAYLFSVTNADDSLSQATDSALRGVIGKYTMDKILTEGRTIVRSDTQRVLEE
FT                   TIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANG
FT                   QAQRLLEDAKAYKDRTVLEAQGEVAGFAKLLPEYKSAPQITRERLYIETMEKVLSHTRK
FT                   VLVNDKGNNLMVLPLDQMLRGQTGAAAEGSKDTSLIRLNPAPSANSGASSSSQRTSNGT
FT                   VMDQRRANAQRDDTTRVGRE"
FT   gene            486185..487192
FT                   /locus_tag="Spro_0434"
FT   CDS_pept        486185..487192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0434"
FT                   /product="HflC protein"
FT                   /note="TIGRFAM: HflC protein; PFAM: band 7 protein; KEGG:
FT                   yen:YE0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39542"
FT                   /db_xref="GOA:A8G8V2"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V2"
FT                   /protein_id="ABV39542.1"
FT                   /translation="MRKSFIVIILAVLVALYASLFVVQEGQRGIVLRFGKVLRDSDNKP
FT                   LVYAPGLHFKIPFIETVKTLDARIQTMDNQADRFVTSEKKDLIVDSYLKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGKLMSDVRDALNTGTVGDD
FT                   QEVATTEADDAIASAAARVEKETTGKLPKVNPNSMAALGIEVIDVRIKQINLPAEVSDA
FT                   IYQRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERTARITRGEGNAEAAK
FT                   LFANAFSQDPDFYAFIRSLRAYETSFSSNNQDVMVLSPDSDFFRYMKSPDSVRK"
FT   sig_peptide     486185..486259
FT                   /locus_tag="Spro_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.485 at
FT                   residue 25"
FT   gene            487253..487456
FT                   /locus_tag="Spro_0435"
FT   CDS_pept        487253..487456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39543"
FT                   /db_xref="GOA:A8G8V3"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V3"
FT                   /protein_id="ABV39543.1"
FT                   /translation="MMNSTIWLALGLVLVLEGLGPMLFPQAWRKMILAMTQFPDATLRR
FT                   FGGGIVVAGCVIYYMLRTHAGV"
FT   gene            487554..488852
FT                   /locus_tag="Spro_0436"
FT   CDS_pept        487554..488852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0436"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG: yen:YE0382
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39544"
FT                   /db_xref="GOA:A8G8V4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8V4"
FT                   /protein_id="ABV39544.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAQYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVTSIIGNGVVLAPDALMKEMGELEARGIPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAVKLK
FT                   EIVDYHNFQLVNYYKVEAVDYQATLDYVLSIADILTAMVVDVSELLDGARKRGDLIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGIGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDETGEFLCKQGNEFGATTGRRRRTGWLDAVAVRRSVQINSLSGFCLTKLDVLDGLK
FT                   EVKICVGYRMPDGREMTTTPLAAEGWEGIEPIYESMPGWSDTTFGVKEHSKLPQAALNY
FT                   IKRIEELTGVPVDIISTGPDRSETMILRDPFDA"
FT   gene            489086..489511
FT                   /locus_tag="Spro_0437"
FT   CDS_pept        489086..489511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0437"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   eca:ECA3623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39545"
FT                   /db_xref="GOA:A8G8V5"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8V5"
FT                   /protein_id="ABV39545.1"
FT                   /translation="MQLTSFTDYGLRALIYMASLPPDKMTSISEVTEVYGVSRNHMVKI
FT                   INQLSRVGFVTAVRGKNGGIRLGKPAETIRLGDVVRALEPLSLVNCNSTFCHITPACRL
FT                   KQVLQQGVQNFLEELDSHTLADMVEDNPSLYKLLLVE"
FT   gene            489571..492057
FT                   /locus_tag="Spro_0438"
FT   CDS_pept        489571..492057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0438"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: ypi:YpsIP31758_3646 ribonuclease R; TIGRFAM:
FT                   VacB and RNase II family 3'-5' exoribonuclease;
FT                   ribonuclease R; PFAM: ribonuclease II; RNA binding S1
FT                   domain protein; Ribonuclease B OB region domain;
FT                   Ribonuclease R winged-helix domain protein; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39546"
FT                   /db_xref="GOA:A8G8V6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V6"
FT                   /protein_id="ABV39546.1"
FT                   /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELAKELN
FT                   LTGEEPLEALRRRLRAMERDGQLIFTRRQCYALPERLDLLRGTVIGHRDGFGFLRIEGS
FT                   KDDLYLSAEQMKMAIHGDVVLAQAMAADRKGRREARIVRVLVPKTSQIVGRFFMDAGTG
FT                   FVVPDDSRLSFDILIPAEAASGARMGFMVVVELTQRPTSRTKAVGKIVEILGDKMGTSM
FT                   AVDIALRTHEIPHVWPPQVEKQVADLSEQVPEAAKKGRVDLRQLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPRTALDDEARNRATSVYFPSEVIPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISAQGRLSTAKFYEAVMSSHARLTYNKVWHILQGDQELREH
FT                   YHPLVKHLEELHTMYKVLDQARAERGGIAFETEEAKFIFNAERRIERVEPTVRNDAHKL
FT                   IEECMIMANVAAARFVEKNNEPALFRVHDRPSDDHITALRSVLGELGLTLGGGNKPQPK
FT                   DYATLMDEVSERPDHEMLQTMLLRSMKQAVYDPENRGHFGLALASYGHFTSPIRRYPDL
FT                   AMHRAIKYQLAKEHGEPKERWTPTGGWHSEFEEMLQLGEHCSMAERRADEATRNVADWL
FT                   KCDFMQDHVGEVFSGIIASVTGFGFFVRLNDLFIDGLVHVSSLDNDYYRYDNIGQRLIG
FT                   ESSGVVYRLGDTVEIRVEAVHMDERKIDFALVSSTRKPRGEGKTERDRAKNGGQRTLRG
FT                   GAGAGRTSAPRKRRGGKPPANFEPDSAFRKDEAKPADKVKKDKKAKAKKVSDKTRKIAS
FT                   ATKAKRAGKKKGAEQA"
FT   gene            492117..492848
FT                   /locus_tag="Spro_0439"
FT   CDS_pept        492117..492848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0439"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: yen:YE0385
FT                   putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39547"
FT                   /db_xref="GOA:A8G8V7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V7"
FT                   /protein_id="ABV39547.1"
FT                   /translation="MSEIIYGIHAVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEA
FT                   TGIVIQVANRQWLDEKVEGAVHQGIIARVREGRQYQENDLPALLESVDTPFLLVLDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPRDRSAQLNATAKKVACGAAENVPLIRVTNLARTLRL
FT                   LQEMNVWVVGTAGEADHTLFQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGTV
FT                   SSLNVSVATGICLFEAVRQRS"
FT   gene            492978..494612
FT                   /locus_tag="Spro_0440"
FT   CDS_pept        492978..494612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0440"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: yps:YPTB0434
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39548"
FT                   /db_xref="GOA:A8G8V8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V8"
FT                   /protein_id="ABV39548.1"
FT                   /translation="MVWNTHTVFNQPKPLGNSNLFLSDTALHEAVQREQAGWDVEVLAS
FT                   LGQQLGTQESLELGRLANANPPELLRYDATGQRLDDVRFHPAWHILMQGLIANRVHNLP
FT                   WQEDARIGSFVARAARFVLHAQVEAGTLCPVTMTFGAIPLLQRSLPTEFQSWLTPLLSD
FT                   RYDAHVLPGGQKRGLLIGMGMTEKQGGSDVLSNTTTASPLAARGPGEAYRLVGHKWFFS
FT                   VPQSDAHLVLAQADGGLSCFFLPRILPDGTRNAIRLERLKDKLGNRSNASGEVEFQDAS
FT                   AWLVGEEGDGVRHILKMGGLTRFDCALGSQGLMRRGLSVALYHALQRQAFGKPLIEQPM
FT                   MRQVLARMALRLEGQTAALMRLARAYDSIGVGAPLEQALCRVMTPAAKFEVCRQGIPFI
FT                   GEAMEALGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVMRAWGKLPVVQEALELE
FT                   FGEVRGQNRHFDRQWRQLLQLMRKPQEEQGRAVTGALFNLFAAAQLLRYSSPPLAEAWC
FT                   QMMLDIRGERTLPDRLCETLFARAMGG"
FT   gene            494700..495098
FT                   /locus_tag="Spro_0441"
FT   CDS_pept        494700..495098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0441"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   eca:ECA3620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39549"
FT                   /db_xref="GOA:A8G8V9"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8V9"
FT                   /protein_id="ABV39549.1"
FT                   /translation="MDILSALAAFASYFFSGFAMVLVFLFVYTRITPHDEWALIKADNQ
FT                   SAAFGFVGACLGYVIPLASAAINSVSLLDYLLWGVVALVVQLLLFAAVKIYMPRISDKI
FT                   ESNHVAAGIFLGGVSISGGILNAACMTY"
FT   sig_peptide     494700..494759
FT                   /locus_tag="Spro_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.458 at
FT                   residue 20"
FT   gene            complement(495095..495370)
FT                   /locus_tag="Spro_0442"
FT   CDS_pept        complement(495095..495370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0442"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   ent:Ent638_0367 protein of unknown function DUF1471"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39550"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8W0"
FT                   /protein_id="ABV39550.1"
FT                   /translation="MTRSAALTALLLSMGLLSASAQSAELAPADRVTPLSEIAQITLNN
FT                   LPGSPQDVEQLIARKADEHGASYYRILRMEEQAHQPGWRAFAILYL"
FT   sig_peptide     complement(495299..495370)
FT                   /locus_tag="Spro_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 24"
FT   gene            complement(495493..495801)
FT                   /locus_tag="Spro_0443"
FT   CDS_pept        complement(495493..495801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0443"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   yen:YE0387 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39551"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8W1"
FT                   /protein_id="ABV39551.1"
FT                   /translation="MKLSHLLLPLALVTLLSACGMMTTTPKAPPAPNGQAQEVTRAQTG
FT                   SLVKMGTTSALVRGSPMDVEAEIQKKANASGARYYMIMMNSETVVPGQWYSQAILYR"
FT   sig_peptide     complement(495739..495801)
FT                   /locus_tag="Spro_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.474 at
FT                   residue 21"
FT   gene            495928..496680
FT                   /locus_tag="Spro_0444"
FT   CDS_pept        495928..496680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0444"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   ypi:YpsIP31758_3640 phospholipase/carboxylesterase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39552"
FT                   /db_xref="GOA:A8G8W2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8W2"
FT                   /protein_id="ABV39552.1"
FT                   /translation="MIEIYDERVGDTAVIHAVPAGQYHQPLPTVFFYHGYTSSKEVYAY
FT                   FAYALARAGFRVVLPDADLHGERFDGNEAKRLASFWEILRRNIDELPALKAHFEQLGLI
FT                   AEGRIGVGGASMGGMTTLGSFARYPWVKAAASLMGAGYYTSLAQTLFPPLDEQGNPLSS
FT                   EDFDARIAMLADYGLEQQLEKVADRPLLLWHGEADDLVPAAESLRLATELRQSGWDRQL
FT                   TLLTEPGVKHRITPQALSAIADFFVQSL"
FT   gene            complement(496774..497040)
FT                   /locus_tag="Spro_0445"
FT   CDS_pept        complement(496774..497040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0445"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   yen:YE0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39553"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8W3"
FT                   /protein_id="ABV39553.1"
FT                   /translation="MKHITIATAIALLFSANVMAATEITSHQADQRQSVGFVTLNQNVV
FT                   SPDDATSQVSKIADQRGATAYRIIALHEPENNSTIHVSAELYR"
FT   sig_peptide     complement(496978..497040)
FT                   /locus_tag="Spro_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            497498..497896
FT                   /locus_tag="Spro_0446"
FT   CDS_pept        497498..497896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0446"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: kpn:KPN_04594 30S
FT                   ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39554"
FT                   /db_xref="GOA:A8G8W4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8W4"
FT                   /protein_id="ABV39554.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGQIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRGDRREDFANETADDADAGDSEE"
FT   gene            497903..498220
FT                   /locus_tag="Spro_0447"
FT   CDS_pept        497903..498220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0447"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="PFAM: single-strand binding protein/Primosomal
FT                   replication protein n; KEGG: yen:YE0393 primosomal
FT                   replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39555"
FT                   /db_xref="GOA:A8G8W5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8W5"
FT                   /protein_id="ABV39555.1"
FT                   /translation="MTANRLTLSGTVCKTPTRKVSPSGIPHCQFVLEHRSVQVEAGFTR
FT                   QAWCRMPVIISGKAHQAITQSITVGTPLTVSGFISSHQGRNGLNKMVLHAEQIELIDSG
FT                   D"
FT   gene            498225..498452
FT                   /locus_tag="Spro_0448"
FT   CDS_pept        498225..498452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0448"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: yen:YE0394 30S
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39556"
FT                   /db_xref="GOA:A8G8W6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8W6"
FT                   /protein_id="ABV39556.1"
FT                   /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
FT   gene            498492..498944
FT                   /locus_tag="Spro_0449"
FT   CDS_pept        498492..498944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0449"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: eca:ECA3610 50S
FT                   ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39557"
FT                   /db_xref="GOA:A8G8W7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8W7"
FT                   /protein_id="ABV39557.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEVRRAELEAKLAEILTAAEARATKINELGSVTIASKSGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTTGEHEVQFQVHSDVFAQLNVVVVAEA"
FT   gene            499055..499414
FT                   /locus_tag="Spro_0450"
FT   CDS_pept        499055..499414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0450"
FT                   /product="protein of unknown function DUF488"
FT                   /note="PFAM: protein of unknown function DUF488; KEGG:
FT                   yen:YE2509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39558"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8W8"
FT                   /protein_id="ABV39558.1"
FT                   /translation="MAEINLQRVYDFTGPAPVNCYLIDRLWPRGVSKERLQGVQWLKQV
FT                   APDNALRQWFHQHLEQWEEFESHYRRQLAENDAWQPLVALLRQGQPMTLLYGSKDTQHN
FT                   HGVVLRDFLLAQLAD"
FT   gene            complement(499411..500085)
FT                   /locus_tag="Spro_0451"
FT   CDS_pept        complement(499411..500085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0451"
FT                   /product="Opacity-associated protein A"
FT                   /note="PFAM: Opacity-associated protein A;
FT                   Opacity-associated protein A domain protein; KEGG:
FT                   yen:YE0397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39559"
FT                   /db_xref="GOA:A8G8W9"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8W9"
FT                   /protein_id="ABV39559.1"
FT                   /translation="MGRISPRRRKTTRVYQPLLRTWLNFSQRLKPGSAPEAVEDPDSEQ
FT                   PPGNGKGQSIKALLLKIWHLPDGFGWMEPLPYFHRRWTLIFGIILLLALLWPYSSQNSG
FT                   QPFPVTQQDNSVPLRADLQNNAQQQHAAEPEPAGNWQRFQIQPGQTLAQLFRDNSLPVN
FT                   EVFAMAQVEGNDKPLSNMKAGQEVRIERDTNGVITALSVTAADNTQVLFRRQADGSYRR
FT                   ER"
FT   gene            500372..500992
FT                   /locus_tag="Spro_0452"
FT   CDS_pept        500372..500992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0452"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   eca:ECA3607 FkbP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39560"
FT                   /db_xref="GOA:A8G8X0"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X0"
FT                   /protein_id="ABV39560.1"
FT                   /translation="MTTPSFDSVEAQASYGIGLQVGQQLQESGLEGLQPEALLAGLRDA
FT                   LEGNAPAVPVDVVHRALREIHERADAVRRDRQQAMAVEGQKFLEDNAKRDEVTLTESGL
FT                   QFSVLEQGDGPIPSRQDRVRVHYTGRLINGDVFDSSVERGQPAEFPVSGVIPGWIEALT
FT                   LMPVGSKWQLYIPHDLAYGERGAGASIPPFSALVFDVELLEIL"
FT   gene            complement(501039..502991)
FT                   /locus_tag="Spro_0453"
FT   CDS_pept        complement(501039..502991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0453"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /note="TIGRFAM: 2',3'-cyclic-nucleotide
FT                   2'-phosphodiesterase; PFAM: metallophosphoesterase;
FT                   5'-Nucleotidase domain protein; KEGG: yen:YE0399
FT                   2',3'-cyclic-nucleotide 2'-phosphodiesterase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39561"
FT                   /db_xref="GOA:A8G8X1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X1"
FT                   /protein_id="ABV39561.1"
FT                   /translation="MMKRPLTLSALAMLVCASAQAATVDLRVLETTDLHSNMMDFDYYK
FT                   DKPTDKFGLVRTASLIEQARQQAANTVLVDNGDIIQGSPLGDYMAAKGLKPGDVHPVYK
FT                   AMNTLNYVVGNIGNHEFNYGLDYLKNAIAGAKFPYINANVIDAKTQKPLFTPYIIVDTP
FT                   VKDRDGKEHSLRIGYIGFVPPQILVWDKANLQGKVTVNDITETAKRYVPEMRKQGADLV
FT                   VAIPHSGLSSEPYKAMAENSVYYLSQVPGIDAIMFGHAHAVFPSKDFANIKGADIAQGT
FT                   LNGIPAVMPGQWGDHLGVVDLQLNNDSGTWKVTAAKAQARPIYDKENKKSLAAEDANLL
FT                   KVLAEDHKGTRDFVSKPVGKADDNMYSYLALVQDDPTVQIVNNAQKAYVEHYIQGDPDL
FT                   ADLPVLSAAAPFKVGGRKNDPASFVEVEKGQLTFRNASDLYLYPNTLVVVKASGKEVKE
FT                   WLECSAGQFNQIDVNSSKPQGLINWDGFRTYNFDVIDGVNYQVDVSQPARYDGECQLIN
FT                   DKAQRIKELTFKGKPIDPNATFLVATNNYRAYGGKFAGTGDQHIAFASPDENRSVLAAY
FT                   ISAETRQHGAVKPQVDNNWRLATFSSPQPLDIRFETSPSDKANAFIKTHAQYPMKAEGT
FT                   DSIGFAVYQIDLQKK"
FT   sig_peptide     complement(502926..502991)
FT                   /locus_tag="Spro_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            503245..503988
FT                   /locus_tag="Spro_0454"
FT   CDS_pept        503245..503988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0454"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase; KEGG: eca:ECA3601 inositol
FT                   monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39562"
FT                   /db_xref="GOA:A8G8X2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X2"
FT                   /protein_id="ABV39562.1"
FT                   /translation="MMLEQICQLSREAGAAIMAVYDGKQPLDVAQKKDDSPVTAADLAA
FT                   HHIIQRGLAALTPEIPLLSEEDPPGWEVRQNWTRYWLVDPLDGTKEFLNRNGEFTVNIA
FT                   LIEDGQAVMGVVYAPAIDVLYLAERGKAWKEEKGQRQAIGVSNANPPLVVVSRSHSDEE
FT                   LKDYLNQLGEHQTVSVGSSLKFCLVAEGKAQLYPRFGPTNIWDTAAGHAVAVAAGAQIH
FT                   DWQGRPLLYTPRESFLNPGFRVSLF"
FT   gene            complement(503990..504547)
FT                   /locus_tag="Spro_0455"
FT   CDS_pept        complement(503990..504547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   yen:YE0401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39563"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X3"
FT                   /protein_id="ABV39563.1"
FT                   /translation="MKKSHMLIASLLFAPLFASAHNFQLQQRVAPIGVSDKGELNYAND
FT                   KFSYQNWNSAQLSGKVRVIQHIAGRSSAKDMNDPLIEAIKKAKLPHDRYQTTTIVNTDD
FT                   ALLGTAMFVRSSIEDSKKEFPWSQFVVDSNGNVRKAWDLQPKGSAIVVLDKQGRIQFAK
FT                   DGALTPEEVQQVMTQLHQLLAN"
FT   sig_peptide     complement(504485..504547)
FT                   /locus_tag="Spro_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            504874..505080
FT                   /locus_tag="Spro_0456"
FT   CDS_pept        504874..505080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0456"
FT                   /product="protein of unknown function DUF1107"
FT                   /note="PFAM: protein of unknown function DUF1107; KEGG:
FT                   ent:Ent638_0395 protein of unknown function DUF1107"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39564"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X4"
FT                   /protein_id="ABV39564.1"
FT                   /translation="MRIFQRYNPLKVAKYVKTLFRGRLYIKDVGAFEFDEGKILLPKIR
FT                   DRRHFSVMSEVNRQVLLLQTEMG"
FT   gene            complement(505347..506690)
FT                   /locus_tag="Spro_0457"
FT   CDS_pept        complement(505347..506690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0457"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: ypi:YpsIP31758_3627 CBS/transporter associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39565"
FT                   /db_xref="GOA:A8G8X5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X5"
FT                   /protein_id="ABV39565.1"
FT                   /translation="MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKMMADEGNVNAA
FT                   KVLKLQETPGLYFTVVQIGLNAVAILGGIVGDAAFSPTFQPLFDRFLSPELAEQASFVC
FT                   SFVLVTSLFILFADLTPKRIGMIAPETFAVRIINPMRFSIMIFRPLVWFFNGMANLIFR
FT                   LFKLPMVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRESV
FT                   VYFDLRETEESIIEKVSTHPHSKFLVCDGNIDQVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRSALIVPDTLTLSEALESFKTAGEDFAVILNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   QEEQIVARDESSWLIEGGTPIDDVMRVLHIDEFPQAGNYETIGGFMMYMLRKIPKRTDF
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRLSDKPASVLPKAPEENPAPDLHR"
FT   sig_peptide     complement(506610..506690)
FT                   /locus_tag="Spro_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 27"
FT   gene            complement(506868..507509)
FT                   /locus_tag="Spro_0458"
FT   CDS_pept        complement(506868..507509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0458"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: yen:YE0404
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39566"
FT                   /db_xref="GOA:A8G8X6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8X6"
FT                   /protein_id="ABV39566.1"
FT                   /translation="MVPFFDKTQTVDQANALPGRTTPMPVATLNVVTDHSMTQVPDGLE
FT                   VAIFAMGCFWGVERLFWQQQGVYSTAAGYSGGYTPNPTYREVCSGQTGHTEVVRVVFDP
FT                   KIISYKQLLQVFWENHDPAQGMRQGGDVGTQYRSAIYTLTPEQQTEAESSLQRFQQAME
FT                   QAGDKRAITTEVAPALPFYYAEDDHQQYLYKNPEGYCGLGGIGVCLPPQG"
FT   gene            507797..509533
FT                   /locus_tag="Spro_0459"
FT   CDS_pept        507797..509533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0459"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: ypi:YpsIP31758_3625
FT                   surface antigen/outer membrane protein, OMP85 family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39567"
FT                   /db_xref="GOA:A8G8X7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X7"
FT                   /protein_id="ABV39567.1"
FT                   /translation="MPRYRALCFVCALLATPAAYSANVRLQVEGLSGELEKNVRVRLSS
FT                   ITPEEVSTDGRFRARVDEAVRQGLRALGYYQPTIDFTLDDRPGLARPVLHAKVNPGEPV
FT                   RIAGANIVLEGGAKTDDDYLALVKKGKPTIGEILNHGKYDSFKGSLTGLALRKGYFDAD
FT                   LTKSQLGVAEELHKAYWDIDFNSGQRYRFGQVKFTGSQIREDYLQNLVPFHQGDYYSSE
FT                   DLAELNRRLSATNWFNSVVVSPDFKDAKENKILPLDALVSPRTRNTIETGVGYSTDVGP
FT                   RIKGTWKKPWLNDRGHSLETSASVSAPEQQLDLTYKIPLLKNPLEQYYLLQGGFKNVDL
FT                   NDTKSVTSKAVVSRNWDLSSGWQRALNLTWRLDHFTQGNVTNTTMLLYPGVSVNRTRSR
FT                   GGLMPTWGDSQRYSIDVSDSTWGSDVDFALMQAQNVWIRTLADKHRFVARGQVGWIETN
FT                   DFERVPPDLRFFAGGDRSIRGYKYKGISPRDDDGKLTGASKMLTGSLEYQYNVTGKWWG
FT                   AVFVDSGEAVNDIKQSDFKTGAGFGVRWQSPVGPVKLDIAAPVGDKDTHGVQFYIGLGP
FT                   EL"
FT   sig_peptide     507797..507862
FT                   /locus_tag="Spro_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 22"
FT   gene            509578..513348
FT                   /locus_tag="Spro_0460"
FT   CDS_pept        509578..513348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0460"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   yen:YE0406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39568"
FT                   /db_xref="GOA:A8G8X8"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X8"
FT                   /protein_id="ABV39568.1"
FT                   /translation="MLIGGVAYLLGTTSGLHLVINSAARWVPGLDIASVTGGWRDLTLK
FT                   GVKYQMPGVTVNAGQFHLSLDLACFKNSSLCVNALTAQDVDVVVKTKEMTPSAPVAETS
FT                   EPTTNLSTPYPITLRMLALNNVKVSVDDTAISLGEFRTGAQWQERALTLLPTKISGLLI
FT                   ALPKTPQNPLPEAVQPVVEVAKKVEEKANQGAKPAPQPEEKPLGETLKELFAKPLLPDL
FT                   PDIRLPLDITVKEISGEQLRLTGDTDVLITSLLLQASTLDQHIQLDNFDVKSPQGTLSA
FT                   QGQATLTGSWPVEMVANSTLNIDPLKGEKVKLNIGGGLREELKVALNLSGPVGAQLDLQ
FT                   TQLAEAGLPLALTLQSKQLKWPLSGESQYQINDFRLRFNGKATDYALSTRANIKGQDLP
FT                   PAVLTLDGKGNVEQFKLDRLRLAALQGNTDLTALVDWSKAISWNSQLTLSGINTAKQWP
FT                   EWPAKLDGKITTRGSLHGGSWQLQVPVLQLDGNVKQNKVTARGTLSGNAAGQWKIPGID
FT                   LTLGRNQLNVKGQLDEKSWNLDADIDAPRLDGALPGLGGTAKGLLKLRGNLQAPQLLAD
FT                   LTASGLQWQALRINRVKIDGDVRSSDQIQGQLAVRVEQLKQDALDINLLTLDAKGSEKQ
FT                   HQLQLKIDGKPVSGQLALQGSFDREQQRWRGNLNNTRFDTPVGEWRLSRAIALDYLNTA
FT                   QKISIGPHCWQNPNAELCVPKTIEAGQSGQASVVLNRFDLAMIKPFLGPETSLSGVFSG
FT                   RADVSWKPGGALPEAKVSLVGNGVKVVQQVQGNALPIAFDRLNLNAGLSNGRAQADWLI
FT                   KLTNNGQFDGNVQVVDPQVRRNISGNVNITNISLAMINPALMQGEKAAGMLNANLRLGG
FT                   NAQKPLVYGRMALDKVDIDGHWMPFDMTEGRLAMNFDGMTSTLEGLVSTTHGQLNLSGD
FT                   ADWRDINAWRARIAAKGDKLRVTVPPMIRIDVSPDLVFEATPQLFSLNGSVDIPWARIT
FT                   VQELPESAVGVSSDEVMLDEQLKPIQPKTAGIPINSNLMIHVGNDVRLDAFGLKARLKG
FT                   DLKVVQDKNGLGLNGQIDIPSGRFHAYGQDLIVRKGQLMFSGPPDQPLLNLEAIRNPDS
FT                   TEDDVTAGVRVTGLADAPKLEVFSDPAKSQQEALSYLLRGQGLGSSGADGNAMTSMLIG
FT                   MGVAQSGQLVGKIGEAFGVSNLALDTQGVGDSSQVVVSGYVLPGLQVKYGVGIFDSLAT
FT                   LTLRYRLMPKLYLEAVSGLDQALDLLYQFEF"
FT   gene            513405..513698
FT                   /locus_tag="Spro_0461"
FT   CDS_pept        513405..513698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0461"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: yen:YE0407
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39569"
FT                   /db_xref="GOA:A8G8X9"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8X9"
FT                   /protein_id="ABV39569.1"
FT                   /translation="MTNAQWLGEHELEGYQIYNLGHYPAAIPGEGTVHCEVYRINSSIL
FT                   AELDELKSNTKDYKRELIQTPYGSAWIYLYKHSVDGYPRINSGDWLKRLDEK"
FT   gene            complement(513750..514280)
FT                   /locus_tag="Spro_0462"
FT   CDS_pept        complement(513750..514280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0462"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG:
FT                   ent:Ent638_0411 inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39570"
FT                   /db_xref="GOA:A8G8Y0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y0"
FT                   /protein_id="ABV39570.1"
FT                   /translation="MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKDTGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLSKEYDHIKDVNDLPELLKAQISHFFEHYKDLEKGKWVKVEGWADAAAAK
FT                   AEIIASFERAAKK"
FT   gene            514537..516090
FT                   /locus_tag="Spro_0463"
FT   CDS_pept        514537..516090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0463"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: yen:YE0409
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39571"
FT                   /db_xref="GOA:A8G8Y1"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y1"
FT                   /protein_id="ABV39571.1"
FT                   /translation="MLKKITVKAGLIALLSLMTLLLIMVSTIGVNAINEGSRSLHTLNQ
FT                   ILGEELGSLASSSNLTLRARTAASLAVRQREIGQIEVSDATVGRIYDYLAQSKQEMARF
FT                   VSVGTVTERGRELSSRLQNSYRAYLEQGVRPMADAIKAGKVDDYYDIQETKISALSIAF
FT                   EKDLSDFRSFAMKIGQQRVNEAESNASTKITLILIAGLLSVLLAVLAWFALRVIILRPL
FT                   DESIAQLEHIAGGDLTHDITGEGETEMGRLIRAMQRMQQALVSSVSKVRDASSQIDTGS
FT                   RELAAGNLHLAQRTEESAASLEETAASMEQLTSTVKMNAENCEQANQLALSVSDIANQG
FT                   SEVVSQVMDKMQAITDSSRRIADIISVMDGISFQTNILALNAAVEAARAGEQGRGFAVV
FT                   AGEVRSLAQRSAQSAKEIKGLIEASQNRVQEGEQMAESAAKTMNGITGEVGRVTALMRE
FT                   ISAATREQSSGIEQVNLAVAQMDQVAQQNAALVEESAAATRSLEDQAQLLAQSMAAFKL
FT                   "
FT   sig_peptide     514537..514635
FT                   /locus_tag="Spro_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.590 at
FT                   residue 33"
FT   gene            complement(516128..517132)
FT                   /locus_tag="Spro_0464"
FT   CDS_pept        complement(516128..517132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0464"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG:
FT                   ypi:YpsIP31758_3621 fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39572"
FT                   /db_xref="GOA:A8G8Y2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8Y2"
FT                   /protein_id="ABV39572.1"
FT                   /translation="MKTLGEFIVEKQHDFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGTSGVSNVQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDEIVIFDGERAEN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPVGIPVTEEDFLQPGSAQVAAGYVVY
FT                   GSSTMLVYTTGYGVHAFTYDPSLGVFCLSHEKVRFPATGNMYSINEGNYIKFPRGVKKY
FT                   IKYCQEQDEATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   AFLAEQAGGKASDGKNRILDITPVKLHQRAPFFVGTKSMVEDAERFIAENPDE"
FT   gene            517301..518680
FT                   /locus_tag="Spro_0465"
FT   CDS_pept        517301..518680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0465"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; KEGG: yps:YPTB0457
FT                   UDP-N-acetylmuramate:L-Ala-D-Glu-meso- diaminopime late
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39573"
FT                   /db_xref="GOA:A8G8Y3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y3"
FT                   /protein_id="ABV39573.1"
FT                   /translation="MRIHILGICGTFMGGLAVLARSLGHEVTGSDANVYPPMSTLLEKE
FT                   GIALIQGYDPAQLDPAPDLVIIGNAMTRGNPCVEAVLEQGIPYVSGPQWLHDYVLRDRW
FT                   VLAVAGTHGKTTTAGMATWILEACGYQPGFVIGGVPGNFDVSARLGGSPFFVIEADEYD
FT                   CAFFDKRSKFVHYSPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRLVPGKGKIILPDN
FT                   DSHLKQVMAMGCWSEQELVGEEGAWRAQKLTPDASHYAVFLNGEQVGEVKWSLVGEHNM
FT                   HNGLMAIAATRHVGVLPEDACRALGDFINARRRLELRGEANGVTVYDDFAHHPTAILAT
FT                   LAALRSKVGGTARILAVLEPRSNTMKMGISKNDLAPSLGRADEVFLFQPHHIPWQVAEV
FT                   AEACVQPAHWSADLDTLVDMIVKTAQPGDHILVMSNGGFGGIHDRLLEALANKPDPKAT
FT                   Y"
FT   sig_peptide     517301..517363
FT                   /locus_tag="Spro_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.694 at
FT                   residue 21"
FT   gene            complement(519049..519312)
FT                   /locus_tag="Spro_0466"
FT   CDS_pept        complement(519049..519312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0466"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   yen:YE0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39574"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y4"
FT                   /protein_id="ABV39574.1"
FT                   /translation="MSMKTTLVALSLLSVVSFGASAATLITNDQATNLQSVGTITASGI
FT                   TGAPSDIRQALSDKADKQGAKAYRVIEAYENGNWHATAEIYK"
FT   sig_peptide     complement(519244..519312)
FT                   /locus_tag="Spro_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(519436..519699)
FT                   /locus_tag="Spro_0467"
FT   CDS_pept        complement(519436..519699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0467"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   yen:YE0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39575"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y5"
FT                   /protein_id="ABV39575.1"
FT                   /translation="MKIKATIATMSVLSMLSFGAFAAQSVDANQAANMQSAGTITVSGV
FT                   AGAPSDIRQALSEKADAKGATAYRVIEARNEGNFHATAEIYK"
FT   sig_peptide     complement(519631..519699)
FT                   /locus_tag="Spro_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 23"
FT   gene            complement(520105..520575)
FT                   /locus_tag="Spro_0468"
FT   CDS_pept        complement(520105..520575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0468"
FT                   /product="arginine repressor, ArgR"
FT                   /note="PFAM: arginine repressor; KEGG: ypi:YpsIP31758_3617
FT                   arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39576"
FT                   /db_xref="GOA:A8G8Y6"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8Y6"
FT                   /protein_id="ABV39576.1"
FT                   /translation="MRNPAKQEDLIKAFKALLKEEKFSSQGEIVLALQEEGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTTSPLKNLVLDVDHNDAVVVIHTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFVTPASSFTARQLYEAILSLFEQEL"
FT   gene            521042..521980
FT                   /locus_tag="Spro_0469"
FT   CDS_pept        521042..521980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0469"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: sbo:SBO_3153 malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39577"
FT                   /db_xref="GOA:A8G8Y7"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8Y7"
FT                   /protein_id="ABV39577.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVKIKGFSGEDATPALHGADVVLISAGVARKPGMDRSDLFNVNAGIVRNLIQQ
FT                   VATTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTSLDIIRSNTFVAELKG
FT                   KQPEELNVPVIGGHSGVTILPLLSQIPGVSFTDQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGKYARFFAQPLVLGKNGVEERKDI
FT                   GTLSAFEQKALDDMLDVLHKDIELGEKFINN"
FT   gene            complement(522049..522309)
FT                   /locus_tag="Spro_0470"
FT   CDS_pept        complement(522049..522309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0470"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: ypi:YpsIP31758_3615 sugar fermentation
FT                   stimulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39578"
FT                   /db_xref="GOA:A8G8Y8"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y8"
FT                   /protein_id="ABV39578.1"
FT                   /translation="MNSRNKDWHPADIIAALRKKGTTLAAVSRKAGLSSSTLANALSRP
FT                   WPKGEWLIAEALNIHPAEIWPSRYFDPHTHHLLDRKARIRT"
FT   gene            522570..522842
FT                   /locus_tag="Spro_0471"
FT   CDS_pept        522570..522842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39579"
FT                   /db_xref="GOA:A8G8Y9"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Y9"
FT                   /protein_id="ABV39579.1"
FT                   /translation="MARREGWNSRRRKGVQGKALEYHIDSLPAGTRNLLVLKEEPASYQ
FT                   VERKDPLVVWIEYYYHLTECEREKVLAFLIREGIGSLLARISADK"
FT   gene            complement(522892..523863)
FT                   /locus_tag="Spro_0472"
FT   CDS_pept        complement(522892..523863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0472"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: eca:ECA0689
FT                   octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39580"
FT                   /db_xref="GOA:A8G8Z0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z0"
FT                   /protein_id="ABV39580.1"
FT                   /translation="MNLEQITELTAQDMAAVNATILEQLNSDVTLINQLGYYIISGGGK
FT                   RIRPMIAVLAARALHYQGDKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTSLESLRVLALMSEAVNVIAEGEVLQLMNVNDPDITEESY
FT                   MRVIYSKTARLFEAAAQSSAILSDASVAEEKALQDYGRYLGTAFQLIDDLLDYSADGST
FT                   LGKNTGDDLNEGKPTLPLLHAMHNSEGEQKAMIRGAIEQGNGRHLLEPVLQAMQQCGSL
FT                   EYTRQRAEEEADKAIAALQVLPESPHRSALEGLAHLAVQRDF"
FT   gene            524133..524444
FT                   /locus_tag="Spro_0473"
FT   CDS_pept        524133..524444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0473"
FT                   /product="ribosomal protein L21"
FT                   /note="PFAM: ribosomal protein L21; KEGG: eca:ECA0690 50S
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39581"
FT                   /db_xref="GOA:A8G8Z1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8Z1"
FT                   /protein_id="ABV39581.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGEAVEFDQILMIANGE
FT                   DIKIGVPYVDGGKIKAEVVAHGRGEKIKIVKFRRRKHHRKQQGHRQWFTDVKITGISA"
FT   gene            524462..524719
FT                   /locus_tag="Spro_0474"
FT   CDS_pept        524462..524719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0474"
FT                   /product="ribosomal protein L27"
FT                   /note="PFAM: ribosomal protein L27; KEGG: yen:YE0419 50S
FT                   ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39582"
FT                   /db_xref="GOA:A8G8Z2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8Z2"
FT                   /protein_id="ABV39582.1"
FT                   /translation="MAHKKAGGSTRNGRDSEAKRLGVKRFGGEAVLAGSIIVRQRGTKF
FT                   HAGTNVGCGKDHTLFALKDGKVKFEVKGPSNRKFISIEAE"
FT   gene            524792..525796
FT                   /locus_tag="Spro_0475"
FT   CDS_pept        524792..525796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0475"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ypi:YpsIP31758_3610 integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39583"
FT                   /db_xref="GOA:A8G8Z3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z3"
FT                   /protein_id="ABV39583.1"
FT                   /translation="MHRPVSAGKGKMETKQQVGIGISLAVTTAVCWGALPIAMKEVLVV
FT                   MDPFTIVWYRFTMAALGLGLILAVRGKLPPVTLFRQPRWLLILAIATAGLLGNFIFFSS
FT                   SLQYLSPTASQVIGQLSPVGMMFASVLILKERMRITQVIGALMLICGLLLFFNVSLIEI
FT                   FTRLTDYTLGVLLGVCAAMVWVTYGVAQKVLLRRLASPQILVMLYTLCAVALFPLARPE
FT                   GIFQLSGWQLACLLFCGANTLIGYGALAEAMARWQAAQVSALVTLTPLFTLLFSDLLAL
FT                   AWPHVFAAPTLNVVGYVGAFVVVAGAMFSAIGHRWWPRRAEPRLVAPLKQPGE"
FT   gene            525813..526985
FT                   /locus_tag="Spro_0476"
FT   CDS_pept        525813..526985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0476"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="TIGRFAM: GTP-binding protein Obg/CgtA; PFAM:
FT                   GTP-binding protein HSR1-related; GTP1/OBG sub domain
FT                   protein; KEGG: ypi:YpsIP31758_3609 GTP-binding protein
FT                   Obg/CgtA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39584"
FT                   /db_xref="GOA:A8G8Z4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G8Z4"
FT                   /protein_id="ABV39584.1"
FT                   /translation="MKFVDEAAILVVAGDGGNGCVSFRREKYIPNGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRDCTGKRGKDITIKVPVGTRVQDQGTGEI
FT                   LGDMTRHEQRLMVAKGGWHGLGNTRFKSSVNRAPRQKTLGTAGEARDILLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVRMDHEQSFVVADIPGLIEGAS
FT                   DGAGLGIRFLKHLERCRVLLHLVDIAPIDESDPVENAKVIINELNQYSENLSQKPRWLV
FT                   FNKIDVIGEEEAAERAKAIAEGMGWEGKYYMISAVNREGVNALCWDVMKFINTQPKAMA
FT                   IEESAPEKVEFMWDDYHREQIAEVEAEADDDWDDDWDEEDDEGVEIIYQK"
FT   gene            complement(527026..528087)
FT                   /locus_tag="Spro_0477"
FT   CDS_pept        complement(527026..528087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0477"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: yen:YE0422 two-component
FT                   system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39585"
FT                   /db_xref="GOA:A8G8Z5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z5"
FT                   /protein_id="ABV39585.1"
FT                   /translation="MISMRRRLLLMLALILLVTQLISAFWLWHESQEQISFLVDETLSA
FT                   KVRTERVDTEIAEAIASLLAPSLIMMVVTLLASFWAISWIIRPLNQLQQRLEKRSADNL
FT                   TPLPLNSDSLEIMSVTTTLNQLFSRLDNTIQQERLFTADAAHELRTPLAGIRLHLELME
FT                   KQGVPQSGPLIKRIDQLMHTVEQLLMLARAGQDFASGHYQRFDWVSDVIQPLREELEEL
FT                   ATQRGQSLQWQLPTTAPVHGDPVLLRLLLRNLVENAHRYSPEGSRIQVQLSAQERGYRL
FT                   QVIDEGPGVKEKITGELTQAFRRMDQRYGGSGLGLNIVTRIVQLHQGRLTLENRQDTSG
FT                   LNAQCWLPENVLK"
FT   sig_peptide     complement(528013..528087)
FT                   /locus_tag="Spro_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(528084..528746)
FT                   /locus_tag="Spro_0478"
FT   CDS_pept        complement(528084..528746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0478"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: ypi:YpsIP31758_3607
FT                   transcriptional regulatory protein BasR/PmrA"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39586"
FT                   /db_xref="GOA:A8G8Z6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z6"
FT                   /protein_id="ABV39586.1"
FT                   /translation="MKLLIVEDDELLQQGLALALAGEGYACDCAATAAEANALLLTSQY
FT                   SMIILDLGLPDMDGASLLRQWRRQQVELPVLILTARDALEDRVDGLDAGADDYLVKPFA
FT                   LVELQARVRALIRRYQGHSDNLMQLDDLQLNLSSQQVYVQQQPVEVTPKEFAILSRLMM
FT                   RAGQTVNRELLQQDLYTWQDDLGSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLESSS"
FT   gene            complement(528755..530188)
FT                   /locus_tag="Spro_0479"
FT   CDS_pept        complement(528755..530188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0479"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: yen:YE0424 penicillin-binding protein 4
FT                   precursor; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39587"
FT                   /db_xref="GOA:A8G8Z7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z7"
FT                   /protein_id="ABV39587.1"
FT                   /translation="MRFSRIVSALACAFVLNANAAPVEDYTQYLPDGANLALVVQKIGA
FT                   DAPTIDYHSQQMALPASTQKVLTALAALLQLGPDYRFTTTLESQGDISDGVLRGNLIAR
FT                   FSGDPTFKRQSLRNMVAILKKQGVRQITGDVLVDTSVFASHDKAPGWPWNDLTQCFSAP
FT                   PAAAIVDRNCFSVSLYSAPNPGDMAFIRVASYYPVNMFSQVRTLAKGSADAQYCELDVV
FT                   PGELNRFTLTGCLTQRSDPLPLAFAIQDGASYAGAILKDELTQAGIQIDGHLKRQTQPG
FT                   LKGTVIAQAQSAPLHELLKIMLKKSDNMIADTVFRTIGHERFGVPGTWRAGADAVRQVL
FT                   RQKAGVDLGNSIVVDGSGLSRHNLLAPATMMQALQYIAQHDSELNFISMLPLSGYDGTL
FT                   RYRGGLHEAGVDGKVSAKTGALQGVYNLAGFITTASGQRFAFVQYLSGYAVPPEDQKQR
FT                   RAPLVRFESRLYRDIYQNN"
FT   sig_peptide     complement(530126..530188)
FT                   /locus_tag="Spro_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            530445..530921
FT                   /locus_tag="Spro_0480"
FT   CDS_pept        530445..530921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0480"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: yen:YE0425 transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39588"
FT                   /db_xref="GOA:A8G8Z8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z8"
FT                   /protein_id="ABV39588.1"
FT                   /translation="MKQIPMTLFGAEKLREELEYLKGVRRPKIIADIADAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDITKMPNNGRVIFGSTVSVMNLDSEEEVT
FT                   YRIVGDDEADFKKNLISVNSPMARGLIGKEVDDVVVIKTPGGDVDYEILKVDYL"
FT   gene            complement(531036..531329)
FT                   /locus_tag="Spro_0481"
FT   CDS_pept        complement(531036..531329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0481"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   stm:STM3298.S putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39589"
FT                   /db_xref="GOA:A8G8Z9"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A8G8Z9"
FT                   /protein_id="ABV39589.1"
FT                   /translation="MNLNNKQKQHLKGLAHPLKPVVMLGNNGLTEGVLAEIEQALEHHE
FT                   LIKVKIAAEDRETKTLIADAIVRETGACNVQVIGSTLILYRPSKERKISLPR"
FT   gene            531474..532103
FT                   /locus_tag="Spro_0482"
FT   CDS_pept        531474..532103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0482"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /note="TIGRFAM: ribosomal RNA large subunit
FT                   methyltransferase J; PFAM: ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ; KEGG: eca:ECA0697 ribosomal RNA large subunit
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39590"
FT                   /db_xref="GOA:A8G900"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G900"
FT                   /protein_id="ABV39590.1"
FT                   /translation="MANKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQS
FT                   DKLFKPGMTVVDLGAAPGGWSQYVVTQIGGSGRIIACDILPMDPIVGVDFLQGDFRDEL
FT                   VLKALLERVGESKVQVVMSDMAPNMSGTPAVDIPRSMYLVELALGMCRDVLAPGGSFLV
FT                   KVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
FT   gene            532160..534091
FT                   /locus_tag="Spro_0483"
FT   CDS_pept        532160..534091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0483"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: yen:YE0428 cell division protein; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   AAA ATPase central domain protein; peptidase M41 FtsH
FT                   extracellular; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39591"
FT                   /db_xref="GOA:A8G901"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A8G901"
FT                   /protein_id="ABV39591.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFMSELTQDQ
FT                   VREARINGREINVTKKDSNKYTTYIPVNDPKLLDTLLTKNVKVVGEPPEEPSLLASIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEAKEE
FT                   VSELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHSRRVPL
FT                   APDVDASVLARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISAS
FT                   RQKLESQISTLYGGRLAEEIIYGPEKVSTGASNDIKVATSIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEVFLGRSVAKAKHMSDETARIIDQEVKSLIERNYIRARALLMENMDILHSMKD
FT                   ALMKYETIDAPQIDDLMNRKDVRPPAGWDDASKGSNSDNGGTPKAPTPVDEPRTPNPGN
FT                   TMSEQLDK"
FT   sig_peptide     532160..532243
FT                   /locus_tag="Spro_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.661) with cleavage site probability 0.339 at
FT                   residue 28"
FT   gene            534184..535017
FT                   /locus_tag="Spro_0484"
FT   CDS_pept        534184..535017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0484"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: yen:YE0429 dihydropteroate synthase; TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39592"
FT                   /db_xref="GOA:A8G902"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A8G902"
FT                   /protein_id="ABV39592.1"
FT                   /translation="MQLTVRDTTFDLSHPRVMGILNVTPDSFSDGGQHNQLNQALLHAH
FT                   ALISAGATMIDVGGESTRPGAAEVSEDEEIARVVPVVEAIARRFEVFISVDTSKAGVIR
FT                   ESAQAGAHLINDVRSLQEPGALAAAAESGLPVCLMHMQGEPRTMQQAPHYDDLIGDVNA
FT                   FFQRHIERCNAAGIKNQKLLLDPGFGFGKNLAHNYQLLARLSEFHHFGLPLLVGMSRKS
FT                   MIGQLLNVPPDQRVIGSVACAVIAAMQGAQIVRVHDVKETVEAMRVVEATLSAKG"
FT   gene            535025..536362
FT                   /locus_tag="Spro_0485"
FT   CDS_pept        535025..536362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0485"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: yen:YE0430 probable
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39593"
FT                   /db_xref="GOA:A8G903"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G903"
FT                   /protein_id="ABV39593.1"
FT                   /translation="MSERKYFGTDGIRGKVGDTPITPEFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PFYDNGIKFFSIDGAKLPDDVEEAIEAEMEKPLTCVESSELGKASRIIDAAGRYIEFCK
FT                   GTFPSELSLKGLKIVVDCANGATYHIAPSVLRELGATVIAIGVEPDGMNINEKCGATDV
FT                   RQLQERVLQEKAHVGLAFDGDGDRVMMVDHLGNKVDGDQILYIIAREGLRQGQLRGGAV
FT                   GTLMSNMGLELALKQLGIPFARAKVGDRYVLEKLQELGWRIGAENSGHVILLDKTTTGD
FT                   GIVAGLQVLTAIVRNSMSLHDLCSGMKLLPQILVNVRFAGEHNPLESEEVRKITEQVEV
FT                   ELAGRGRVLLRKSGTEPLIRVMVEGEDEQQVTALAHRIADAVKSAG"
FT   gene            536614..536949
FT                   /locus_tag="Spro_0486"
FT   CDS_pept        536614..536949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0486"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: yen:YE0431
FT                   protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39594"
FT                   /db_xref="GOA:A8G904"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A8G904"
FT                   /protein_id="ABV39594.1"
FT                   /translation="MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASGTLFGS
FT                   SGSGNFMTRMTAVLATLFFVISLILGNLSTNQTKKGSEWENLGQPVKSEQTTAPAAPTK
FT                   PSSDIPQ"
FT   gene            537028..537114
FT                   /locus_tag="Spro_R0025"
FT                   /note="tRNA-Leu2"
FT   tRNA            537028..537114
FT                   /locus_tag="Spro_R0025"
FT                   /product="tRNA-Leu"
FT   gene            537175..537251
FT                   /locus_tag="Spro_R0026"
FT                   /note="tRNA-Met1"
FT   tRNA            537175..537251
FT                   /locus_tag="Spro_R0026"
FT                   /product="tRNA-Met"
FT   gene            537499..537921
FT                   /locus_tag="Spro_0487"
FT   CDS_pept        537499..537921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0487"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   kpn:KPN_03578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39595"
FT                   /db_xref="GOA:A8G905"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G905"
FT                   /protein_id="ABV39595.1"
FT                   /translation="MLSAPVEALGFELVGIEFIRARQSTLRIYIDSENGINVDDCADVS
FT                   HQVSAVLDVEEPITVAYNLEVSSPGLDRPMFTAEHYTRFLGDEVSLVLRMAVQNRRKWQ
FT                   GIIKSVDGEMITVAVEGKDEVFALSNIQKANLVPHF"
FT   gene            537943..539451
FT                   /locus_tag="Spro_0488"
FT   CDS_pept        537943..539451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0488"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: RNA binding S1 domain protein; NusA domain protein;
FT                   KEGG: yen:YE0433 N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39596"
FT                   /db_xref="GOA:A8G906"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A8G906"
FT                   /protein_id="ABV39596.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEV
FT                   RVSIDRKTGDFDTFRRWVAVDEVTQPTREITLEAAQYEEPGIELGGYIEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVDAFRQHEGEIVTGVVKKVNRDSIALDLGSNAEAVIG
FT                   REDMLPRENFRPGDRIRGILYAVRPEARGAQLFVSRSSAEMLKELFRIEVPEIGEEVIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIILWDDNPA
FT                   QFVINAMAPADVASIVVDEDNCTMDIAVEASNLAQAIGRNGQNVRLASQLLKQHRDDDR
FT                   WELNVMTADDLQAKHQAEAHAAIDTFTKHLDIDEDFATVLVEEGFSTLEELAYVPIKEL
FT                   LEIDGLDEDMVEALRDRAKAALTTLALAQEESLGDQKPADDLLNLPGLERSMAFKLAAR
FT                   GVCTLEDLAEQGVDDLADIEGLSDEQAGELIMAARNICWFGDNA"
FT   gene            539476..542163
FT                   /locus_tag="Spro_0489"
FT   CDS_pept        539476..542163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0489"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; GTP-binding protein HSR1-related; elongation
FT                   factor Tu domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Initiation factor 2 associated domain
FT                   protein ; Miro domain protein; KEGG: eca:ECA0712
FT                   translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39597"
FT                   /db_xref="GOA:A8G907"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G907"
FT                   /protein_id="ABV39597.1"
FT                   /translation="MTTDVTVKSLAAEIQTPVDRLVQQFADAGINKSETDSVTQHEKEA
FT                   LLAHLNREHGSAPGKLTLQRKTRSTLNIPSTGGKSKSVQIEVRKKRTYVNRDTPEAQQA
FT                   EAAEQAQREAEEQAQRAAEELAKREAEAKRAAEEQAKREAAEIAKRNSAEKEKVTNQHT
FT                   DEMTKPAQAEKARREAEAAELKRKAEEEVRRKVEEDAKRVAEEARRMAEEKGEEWAAAE
FT                   KASAAVETADYHVTTSQHARAAEDENDAKVEGERRTRTRGGKATKQKKGNKLSESKADR
FT                   EEARAVTRGGKGKRKPSTLQQGFNKPAQVVNRDVVIGETITVAELANKMAVKGSQVIKA
FT                   MMKLGAMATINQVIDQETAQLVAEEMGHKVILRRENELEEALMSDRDTGAAAEPRAPVV
FT                   TIMGHVDHGKTSLLDYIRSTKVAAGEAGGITQHIGAYHVETDNGMITFLDTPGHAAFTS
FT                   MRARGAQATDIVVLVVAADDGVMPQTIEAIQHAKAAQVPLVVAVNKIDKPEADPDRVKQ
FT                   ELSQYGVMPEEWGGEAQFVHVSAKAGTGIDELLNAILLQSEVLELKAVRSGMASGVVIE
FT                   SFLDKGRGPVATVLVQEGTLNKGDIVLCGFEYGRVRAMRDELGREVTSAGPSIPVEILG
FT                   LSSVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANMTDGEVSEL
FT                   NIVLKSDVQGSCEAICESLLKLSTDEVKVKIVGSGVGGITETDATLAAASNAIILGFNV
FT                   RADASARRVIEAESLDLRYYSVIYNLIDEVKQAMSGMLAPEYKQQIIGLAAVRDVFKSP
FT                   KFGAIAGCMVTEGNIKRHNPIRVLRDNVVIYEGELESLRRFKDDVNEVRNGMECGIGVK
FT                   NYNDVRVGDMIEVFEIIEIQRTIA"
FT   gene            542232..542642
FT                   /locus_tag="Spro_0490"
FT   CDS_pept        542232..542642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0490"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: yen:YE0435
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39598"
FT                   /db_xref="GOA:A8G908"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G908"
FT                   /protein_id="ABV39598.1"
FT                   /translation="MAKEFSRGQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRD
FT                   LAYAKVYVTFLNVLTENADPNLVPNGIKALEDASGYIRTLLGKAMRLRVVPELTFAYDN
FT                   SLVEGMRMSNLVTNVVKNDAERRSASGDDEEA"
FT   gene            542642..543586
FT                   /locus_tag="Spro_0491"
FT   CDS_pept        542642..543586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0491"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; tRNA
FT                   pseudouridine synthase B; KEGG: ssn:SSON_3312 tRNA
FT                   pseudouridine 5S synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39599"
FT                   /db_xref="GOA:A8G909"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G909"
FT                   /protein_id="ABV39599.1"
FT                   /translation="MSRPRRRGRDIHGVLLLDKPQGLSSNDALQKVKRLYNANRAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDSDKRYRVIARLGQRTDTSDADGQIVQERPVSFT
FT                   QAQLDAALDSFRGDIKQVPSMYSALKYQGKKLYEYARQGIEVPREARSITVYELQFIRW
FT                   EGDELELEIHCSKGTYIRTITDDLGELLGCGAHVIYLRRLQVATYPTERMVTLEQLNEL
FT                   LEQAHRQEIAPAELLDPLLMPMDSPVENYPEVNLLPVVAGYVKQGQPVQVAGAPASGMV
FT                   RITEGEERKFIGVGDIADDGRVAPRRLVVEYFD"
FT   gene            543710..543979
FT                   /locus_tag="Spro_0492"
FT   CDS_pept        543710..543979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0492"
FT                   /product="ribosomal protein S15"
FT                   /note="PFAM: ribosomal protein S15; KEGG: eca:ECA0715 30S
FT                   ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39600"
FT                   /db_xref="GOA:A8G910"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G910"
FT                   /protein_id="ABV39600.1"
FT                   /translation="MSLSVEAKAKIVADFGRGTNDSGSSEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVSQRRKLLDYLKRKDVARYTSLIERLGLRR"
FT   gene            544235..546352
FT                   /locus_tag="Spro_0493"
FT   CDS_pept        544235..546352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0493"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: yen:YE0438 polyribonucleotide
FT                   nucleotidyltransferase; PFAM: 3' exoribonuclease; RNA
FT                   binding S1 domain protein; KH type 1 domain protein;
FT                   Exoribonuclease, phosphorolytic domain 2; Polynucleotide
FT                   phosphorylase, phosphorolytic RNA-binding,
FT                   bacterial/organelle-type; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39601"
FT                   /db_xref="GOA:A8G911"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G911"
FT                   /protein_id="ABV39601.1"
FT                   /translation="MLTPIIRKFQYGQHTLTIETGMMARQATAAVMVSMDDTAVFVTVV
FT                   GQKKAKPGQSFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLTSRLIDRPIRPLFP
FT                   DSFLNEVQVIATVVSLNPQVNPDIVAMIGASAALSLSGIPFNGPIGSARVGYINNQYVL
FT                   NPTSDELKESSLDLVVAGTAGAVLMVESEADVLSEDQMLGAVVFGHEQQQIVIENINSL
FT                   VAEAGKAKWDWQAPAVNEALHARVAELAEGRLGDAYHITEKQERYAQVDAIKSSVVETL
FT                   LAQDETLDVSEIQDILGSVEKNVVRSRVLRGEPRIDGREKDMIRGLDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTARDAQNLDELMGEKTDSFLFHYNFPPYSVGETGMVGSPKRR
FT                   EIGHGRLAKRGVLAMMPKPEDFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEQDNFVVLSDILGDEDHLGDMDFKVAGSRDGITALQMDIKIEGITRE
FT                   IMQVALNQAKGARLHILGVMEQAISTPRGDISQFAPRIHTIRINPDKIKDVIGKGGSVI
FT                   RALTEETGTTIEIEDDGTVKIAATDGEKAKFAIRRIEEITAEIEVGRIYQGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRVRLSIKEATA
FT                   PEAGSPAPEAE"
FT   gene            546481..547365
FT                   /locus_tag="Spro_0494"
FT   CDS_pept        546481..547365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0494"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: yen:YE0439
FT                   lipoprotein NlpI"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39602"
FT                   /db_xref="GOA:A8G912"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:A8G912"
FT                   /protein_id="ABV39602.1"
FT                   /translation="MKPFLRWCYVATALMLAGCSNHDWRKDEVLAIPLQPTLQQEVILA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRFPLAQDDLQAFYQDDPND
FT                   PFRSLWLYLVEREIDPKKADVALQQRYDKANRGQWGWNIVEFYLGNISEKTLMERLKAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGDKDTASALFKLTVANNVHNFVEHRYALLELALL
FT                   GQEQDDLSESDQQ"
FT   gene            547552..549513
FT                   /locus_tag="Spro_0495"
FT   CDS_pept        547552..549513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0495"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: yen:YE0440 cold-shock
FT                   DEAD-box protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39603"
FT                   /db_xref="GOA:A8G913"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR021046"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:A8G913"
FT                   /protein_id="ABV39603.1"
FT                   /translation="MTTELETSFADLGLSAPIISALTDLGYEKPSPIQAECIPHLLNGR
FT                   DVLGMAQTGSGKTAAFSLPLLHNLDASLKAPQILVLAPTRELAVQVAEAMTDFSKHMHG
FT                   VNVVALYGGQRYDVQLRALRQGPQIVVGTPGRLLDHLKRGTLNLSNLSGLVLDEADEML
FT                   RMGFIEDVETIMAEIPAEHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSVTTRPDIS
FT                   QSYWTVQGMRKNEALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYSSAALNGDMN
FT                   QALREQTLERLKDGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRA
FT                   GRAGRALLFVENRERRLLRNIERTMKLTIPEVELPNVELLGERRLAKFAAKVQQQLESS
FT                   DLDMYRGLLAKLQPGEEELEMETLAAALLKMAQGERPLILPPDPVFKPRQRREFNDRDD
FT                   RGSDRRRDARPDSRDGGAERPRRERRDVGEMQLYRIEVGRDDGVEVRHIVGAIANEGDI
FT                   SSRYIGNIKLFAGHSTIELPKGMPGEILSHFTRTRILNKPMNMQLLGDAQPHERRERPA
FT                   PAGNGERRGGARPFNGERREGANPGRRSFGDRREGGAAAPAGNGGERRGGNFNRDGQRA
FT                   PRRDDAAPAAPRRRFGDA"
FT   gene            549660..550874
FT                   /locus_tag="Spro_0496"
FT   CDS_pept        549660..550874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0496"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: ypi:YpsIP31758_3810 YeeE/YedE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39604"
FT                   /db_xref="GOA:A8G914"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A8G914"
FT                   /protein_id="ABV39604.1"
FT                   /translation="MSWQQFKSQYLVRFWAPLPAVIAAGILSTYYFGLTGAFWAVTGEF
FT                   TRWGGHILQLFGLHPEQWGYFKVIGLEGTPLQRIDGRMIIGMFAGCIAAALWANNIKLR
FT                   QPQNRIRIVQALLGGIIAGFGARLAMGCNLAAFFTGIPQFSLHAWFFALATAAGSYFGA
FT                   KFTLLPMFRIPIKLQKVKAAAPLTQKPEQARRRFRLGMVVFCLAIAWSLWTLFDAPKLG
FT                   IAMLFGIGFGLLIERAQICFTSAFRDLWISGRTHMAKAIILGMAASAIGIFSYVQLGVA
FT                   PKIMWAGPNAVLGGLLFGFGIVLAGGCETGWMYRAVEGQVHYWWVGLGNIIGATLLAYY
FT                   WDDLAPTLATDYDKVNLLETFGPIGGLLVTYLLLALAFGAMLWWEKRFFRARPDAQVVN
FT                   LRSVS"
FT   gene            550871..551110
FT                   /locus_tag="Spro_0497"
FT   CDS_pept        550871..551110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0497"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: net:Neut_1003 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39605"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A8G915"
FT                   /protein_id="ABV39605.1"
FT                   /translation="MKQTAIVPDYRLDMLGEPCPYPAVATLEAMPQLKPGEILEVISDC
FT                   PQSINNIPLDARNHGYKVLDIQQDGPTIRYLIQR"
FT   gene            complement(551145..552170)
FT                   /locus_tag="Spro_0498"
FT   CDS_pept        complement(551145..552170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0498"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: yen:YE0442
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39606"
FT                   /db_xref="GOA:A8G916"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A8G916"
FT                   /protein_id="ABV39606.1"
FT                   /translation="MDDIMTEKTTVPVSVLDLSPIPQGAKPRDAFHASLDLAQHAEKWG
FT                   YQRYWLAEHHNMTGIGSAATSVLLGYLAAGTQSIRLGSGGVMLPNHAPLVIAEQFGTLE
FT                   SLYPGRIDLGLGRAPGTDQRTMMALRRHLSGEVDNFPRDVQELQHYFGEVQAGQPVQAV
FT                   PGQGLHVPIWLLGSSLYSAQLAAQLGLPFAFASHFAPEMLFQAFNLYRDNFKPSEQCQR
FT                   PHAMVCVNVVAADSDADARFLFTSMQQQFINLRRGSPGPLPAPVDNIHALWTAGEQYGV
FT                   DQALRMSVIGNETTVRNGLQTLLSETGADEIMVNGQIFDHQARLHSFEIVAGVKGDLVK
FT                   G"
FT   gene            552383..553354
FT                   /locus_tag="Spro_0499"
FT   CDS_pept        552383..553354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0499"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   plu:plu4516 unnamed protein product; highly similar to
FT                   membrane fusion protein (MFP) of ABC transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39607"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A8G917"
FT                   /protein_id="ABV39607.1"
FT                   /translation="MKKKTLFTLLLMVVAIAMAILFRAHNQDLLLQGEVDAPEVIVASK
FT                   AKGRVVERLVERGDDVKAQQVMIQLDSPELMAQLRSAQASRDEAKAQLDQSLHGTREES
FT                   IRNLRANLAQAEAQYRNAQNDYNRNLSVSGKGYISKSELDSSRRARDTTFQQVQAAKAN
FT                   LDEGTNGDRIELRQQYAAALRAAEENLLQVKAQTDDLRVLAPVAGEVGPIPAEVGELLN
FT                   AGSPLLTLIRVPDAYFVFNLREDILAHVRKGDKVQMRVPALKDKMIEAEVRYIAPLGDY
FT                   ATKRATRATGDFDLKTFEVRLYPSQPVEGLRPGMSSLWLWKE"
FT   sig_peptide     552383..552463
FT                   /locus_tag="Spro_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.781 at
FT                   residue 27"
FT   gene            553336..554490
FT                   /locus_tag="Spro_0500"
FT   CDS_pept        553336..554490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0500"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: plu:plu4515
FT                   unnamed protein product; similar to permease protein of ABC
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39608"
FT                   /db_xref="GOA:A8G918"
FT                   /db_xref="UniProtKB/TrEMBL:A8G918"
FT                   /protein_id="ABV39608.1"
FT                   /translation="MVMERVRAGWRCFSHAFDNECRVAFRSPVIHWLSWIFPLMLFGLV
FT                   SSNFSEGTLLDLPVSVVDNDHSSLSKSLTRRLDAGSHAHVELYDGGLNESLYRLRSAQD
FT                   YALLYVPPDFEANALAGKQPSVVMYYNALFYGAGLYSTQDFSGLMTEINANYRSIIAAE
FT                   MGKTLPPLADVTLSYGSLFNASGSYIYYQQFAATIHLLQLFVVTCMIYVLARSKSLLKA
FT                   RPFSLALLGKLAPYTLCFTSLLMVEIAALVGIFDARVSGNPLFMLMIAFFYVMAAQSIG
FT                   LLLFTFTSSIITAYSLIAILVSIALTFSGMAVPELSMPLPARIISNIEPLTHALYAMFD
FT                   VFLRQVPASAIFSVCALLSVYPLVTAFLVRNRLLPRLLKEGGAG"
FT   gene            554487..555626
FT                   /locus_tag="Spro_0501"
FT   CDS_pept        554487..555626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0501"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: plu:plu4514
FT                   unnamed protein product; similar to permease protein of ABC
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39609"
FT                   /db_xref="GOA:A8G919"
FT                   /db_xref="UniProtKB/TrEMBL:A8G919"
FT                   /protein_id="ABV39609.1"
FT                   /translation="MKIYWQTFVRVLLGMLERPMWLMLILSLCVMSMVYANRTVWDLPV
FT                   GVIDQDHSTASRQLIRQLDATSKIAIVTYDSLEQAKSDLGWRKLFAVIIMPVDLEKKIL
FT                   SGQNIVVPVYGDATNRLANGQIQQDVVAAYQQLLNQYNNGLLLRSGFSERQAQVILTPI
FT                   RGQTLDVFNPGISFAAIIFPGLLVMLLQHSLLIACVRVSIAMKSIPGGKPPLAAHLGGL
FT                   TALLPIWLFLSIVLFVLWPWVLGYRQTASIAEILLLTFPFLLAVLGLGKLVTECLRSVE
FT                   MIYLTLAFITTPIFYLSGTIWPLQAMPAWVRAISYCIPSTWATKAIAGVNQMGLSLNEV
FT                   WGDVVMLLVLGIIYTLLGVGVGFMRNSVALRSLLRKRAS"
FT   sig_peptide     554487..554597
FT                   /locus_tag="Spro_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.899 at
FT                   residue 37"
FT   gene            555728..556849
FT                   /locus_tag="Spro_0502"
FT   CDS_pept        555728..556849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0502"
FT                   /product="Cupin 4 family protein"
FT                   /note="PFAM: Cupin 4 family protein; SMART: transcription
FT                   factor jumonji jmjC domain protein; KEGG: ent:Ent638_0491
FT                   cupin 4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39610"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:A8G920"
FT                   /protein_id="ABV39610.1"
FT                   /translation="MAYQLNLNWPEFLEKYWQKKPVVLKNAFPNFVDPITPDELAGLAM
FT                   EPEVDSRLVSQTGGQWQASHGPFEHFDNLGETGWSLLAQAVNHWHVPSAELVRPFRVLP
FT                   DWRLDDLMISFSVPGGGVGPHIDNYDVFIIQGMGSRRWRVGDALPMRQFCPHPALLHVD
FT                   PFEPIIDEDLEPGDILYIPPGFPHDGFTHETALNYSVGFRGPNDRDLISSFADYALEND
FT                   LGGVHYSDPDLTLREHPGRVEEYELERLRTMMVEMISKPEDFKQWFGRFATTPRHELDI
FT                   AMAEPPYEAQEVLSALMDGETLTRLSGLRVLHIGDSFFINSERLDTVDARAADALCRYT
FT                   ELGRQELGDALQNPAFVAELTELMNQGYWFFKE"
FT   gene            complement(556936..557814)
FT                   /locus_tag="Spro_0503"
FT   CDS_pept        complement(556936..557814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0503"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: yen:YE0449 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39611"
FT                   /db_xref="GOA:A8G921"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A8G921"
FT                   /protein_id="ABV39611.1"
FT                   /translation="MKYALGPVQYYWPKTELEEFYRQAVSSSAEIIYLGESVCTKRREM
FT                   KVGDWLALAQEIARSGKQVALSTLALLQAPSELNELKRYVENGEFLIEANDLGTVNMAA
FT                   ERSLPFVAGHALNCYNAYTLRLLHRQGMMRWCMPVELSRDWLTKLLEQCDELGFRRQFE
FT                   VEVLSYGHLPLAYSARCFTARSEDRAKDECETCCIKYPQGRVMRSQEQQQVFVLNGIQT
FT                   MSGYCYNLGNELTSMQGLVDIVRLSPQGTETLALVERFRANEQGTQPLTLTDRADCNGY
FT                   WRRVAGLELVP"
FT   gene            complement(557826..558821)
FT                   /locus_tag="Spro_0504"
FT   CDS_pept        complement(557826..558821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0504"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: ent:Ent638_3595 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39612"
FT                   /db_xref="GOA:A8G922"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A8G922"
FT                   /protein_id="ABV39612.1"
FT                   /translation="MELLCPAGNLPALKAAVDNGADAVYIGLKDDTNARHFAGLNFTEK
FT                   KLQEAVEYVHRHNRKLHIAINTFAHPDGYVRWQRAVDMAAQLGADVLILADLAMLEYAA
FT                   ERYPQLERHVSVQASATNEEAIRFYQRHFDVSRVVLPRVLSMHQVKQLARTSPVPLEVF
FT                   AFGSLCIMAEGRCYLSSYLTGESPNTVGACSPARYVRWQQTAQGMESRLNGVLIDRYRD
FT                   DENAGYPTLCKGRYLVDDVRYHALEEPTSLNTLELLPELLAANIASVKIEGRQRSPAYV
FT                   SQVARVWRQAIDRCQADPAAYQADAGWMEALGAMSEGTQTTLGAYHRKWQ"
FT   gene            559043..559564
FT                   /locus_tag="Spro_0505"
FT   CDS_pept        559043..559564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0505"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   yen:YE0451 putative lipid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39613"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:A8G923"
FT                   /protein_id="ABV39613.1"
FT                   /translation="MLEQLRARIVRQGPSLLRVPLKFTPFALQRQLLEQVLGWQFRQAL
FT                   ADGDLEFLESRWLKIEIRDLALHWFMTVENDKLVVSQHAEADVSFSGDANDLILIAARK
FT                   QDPDTLFFQRRLQIEGDTELGLYVKNLMDAIELEAMPAPLRIGLLQLAEFVEAGLQEGT
FT                   VQTSRVPATC"
FT   gene            559558..560061
FT                   /locus_tag="Spro_0506"
FT   CDS_pept        559558..560061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0506"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yen:YE0452 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39614"
FT                   /db_xref="GOA:A8G924"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8G924"
FT                   /protein_id="ABV39614.1"
FT                   /translation="MLIRVEIPVDAAGIDALLRRAFGRDDEADLVQQLREDGLLTLGIV
FT                   ATDDEGGVVGYAAFSPVDVAGEDRQWVGLAPLAVDESLRRQGLGEKLIYEGLDALNEFS
FT                   YAAVVVLGEPAYYGRFGFKPAAAYGLQCRWPDTEAAFQVYPLAEDALVDVGGAVEYSEP
FT                   FNRL"
FT   gene            complement(560048..560401)
FT                   /locus_tag="Spro_0507"
FT   CDS_pept        complement(560048..560401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0507"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: yen:YE0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39615"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G925"
FT                   /protein_id="ABV39615.1"
FT                   /translation="MPSYSIPGHQRCCLFMTEILPTWHLYMLRMPSGMLYTGITTDVTR
FT                   RLAQHQAGKGAKALRGKGQLVLAFHCQAGDRSKALRLEYRVKQLSKTQKERLVSHPPLS
FT                   LDYLLPDVAVKAG"
FT   gene            complement(560448..561770)
FT                   /locus_tag="Spro_0508"
FT   CDS_pept        complement(560448..561770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0508"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   yen:YE0454 putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39616"
FT                   /db_xref="GOA:A8G926"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:A8G926"
FT                   /protein_id="ABV39616.1"
FT                   /translation="MIMSKSNNKMGVVQLTILTAVNMMGSGIIMLPTKLAEVGTISIVS
FT                   WLVTAVGSMALAYAFAKCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANIAI
FT                   AISAVGYGTELFGANLSPLGICIATIGVLWLATVANFGGARLTGKISGITVWGVIIPVV
FT                   GISIIGWHWFSGSAYIAAWNPHSVPTFEAIGASISMTLWAFLGLESACANTDVVENPER
FT                   NVPIAVLGGTLSAAVIYIVSTNVIAGIVPNMDLANSTAPFGLAFSHMFNPTVGKIIMAL
FT                   MIMSCVGSLLGWQFTIAQVFKSSADSGFFPKIFSKLSKADAPVKGMLTIVMIQSVLSLM
FT                   TISPSLNKQFNVLVNLAVVTNIIPYILSMAALIIIQKVAKVPEKKARIANIIAGISALY
FT                   SFYALYSSGEEAMMWGAIATFLGWTLYGMVSPRFEMAGKKG"
FT   gene            complement(561828..563999)
FT                   /locus_tag="Spro_0509"
FT   CDS_pept        complement(561828..563999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0509"
FT                   /product="Ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG: yen:YE0455
FT                   ornithine decarboxylase, inducible"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39617"
FT                   /db_xref="GOA:A8G927"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR027568"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A8G927"
FT                   /protein_id="ABV39617.1"
FT                   /translation="MIKMNKLKIAANSKTLSCFETTREVVDVHQSDFNDIAAIVLSVED
FT                   VTQGMVAHLEEIGLNIPLFVAVCCEEELDNAILPALHGVFELCGKNTQFYGKQLEAAAV
FT                   KYESELLPPFFNTLTQYVEMGNATFACPGHQGGEFFRKHPAGRQFFDFFGETLFRSDMC
FT                   NADVKLGDLLIHEGAPCAAQQHAAKVFNADKTYFVLNGTSASNKVATNALLTRGDLVLF
FT                   DRNNHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFEERYLRQQIREVAPERAN
FT                   EARPFRLAIIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMKDCSPLL
FT                   LELNENDPGIIVTQSVHKQQAGFSQTSQIHKKDKHIKGQDRYCNHKRFNNAFMLHASTS
FT                   PFYPLFAALDVNAKMHEGKSGRRLWKECVRVGIEARKMLLETCSLIKPFVPDQIDGKAW
FT                   QSYDTETMSNDLRFFNFIPGEKWHAFEGYAQSQYFVDPCKLLLTTPGIDTASGNYSDFG
FT                   IPATILANYLRENGIVPEKCDLNSILFLLTPAEDIAKMQHLVALIARFEKHIEQDSLIS
FT                   DVLPAVYKNNQQRYENYTLRQLCQEMHDLYVSYDVKELQKEMFRKSYFPHVAMNPQDAN
FT                   TEFVRGNVELVSLAKAEGRIAAEGALPYPPGVLCVVPGEVWGGAAQRYFLALEEGINLL
FT                   PGFAPELQGVYIQQDEDGWNRAYGYVMKN"
FT   gene            564804..565238
FT                   /locus_tag="Spro_0510"
FT   CDS_pept        564804..565238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypp:YPDSF_3277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39618"
FT                   /db_xref="GOA:A8G928"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G928"
FT                   /protein_id="ABV39618.1"
FT                   /translation="MNTTEEQQQIAHFLSKQHVLTLCAGNGMDMWCANCFYVFDAGQMA
FT                   LWLMTETHTRHGELMLQNSRVVGTIAPKPKTIALIRGVQYRAEAVMLSGDEERLARARY
FT                   CKRFPIAKVMKAPVWQLSLQEVKMTDNTLGFGTKLHWTRT"
FT   gene            565484..566122
FT                   /locus_tag="Spro_0511"
FT   CDS_pept        565484..566122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_3569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39619"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A8G929"
FT                   /protein_id="ABV39619.1"
FT                   /translation="MARVFMVGATGLVGRELLHLLQADPQVTAIVAPTRKPLPAHEKLV
FT                   NPVGDDLFALLTKQEQPVDIVFCCLGTTRREAGSDANFHYVDYTLVVESALTGRRLGAQ
FT                   HCLAVSALGASPRSTFLYNRTKGEMEQALREQNWPRLTLVRPSMLLGERSSPRLLERLS
FT                   APLFKLLPGKWRGVAAKDVAQTLLEQAFSPGQGVKVLESDRLHCYHSAR"
FT   gene            complement(566073..566855)
FT                   /locus_tag="Spro_0512"
FT   CDS_pept        complement(566073..566855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0512"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   yps:YPTB0508 PhnP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39620"
FT                   /db_xref="GOA:A8G930"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017693"
FT                   /db_xref="InterPro:IPR035682"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A8G930"
FT                   /protein_id="ABV39620.1"
FT                   /translation="MQLTFLGTGGAQQIPVFGCDCLVCHRARREPAFRRRACSAMLKFQ
FT                   GETTLLDAGLPSLERRFSAGEIQRFLLTHYHMDHVQGLFPLRWGCGNFIPVYGPADEQG
FT                   CDDLFKHPGILAFQPPFTPFETVELGGLHITPLPLQHSKLTLGYLIQAAGKSLAYLTDT
FT                   VGLPPDTEAFLRAVTLDLMVLDCSLPPQPQAPRNHNDLTRARETQQRLQPGRTLLTHIS
FT                   HHLDLWLMDNELPPGLELAFDNLSVHCGSNAADRIPAP"
FT   gene            complement(566870..567472)
FT                   /locus_tag="Spro_0513"
FT   CDS_pept        complement(566870..567472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0513"
FT                   /product="putative acetyltransferase (virginiamycin,
FT                   streptogramin A, chloramphenicol)"
FT                   /note="KEGG: rpe:RPE_3116 putative acetyltransferase
FT                   (virginiamycin, streptogramin A, chloramphenicol)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39621"
FT                   /db_xref="GOA:A8G931"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A8G931"
FT                   /protein_id="ABV39621.1"
FT                   /translation="MNDLAQPKIGDNVTLNRSRLGQYVHLADDAILEEVEMGDYSYTAG
FT                   HNQIFYATIGKFVSIASYARINPGNHPTYQRIAQHHFTYRASEYDLGEDDEAFFDWRRE
FT                   HHVTIGHDVWIGHNAIVMPGVSIGNGAVIGSAAVVTKDVAPYEIVAGVAAKKIGMRFDD
FT                   ALIERIERSQWWHWDHQTLQQRLADFRDIHAFAEKYL"
FT   gene            complement(567469..568038)
FT                   /locus_tag="Spro_0514"
FT   CDS_pept        complement(567469..568038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0514"
FT                   /product="phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN"
FT                   /note="TIGRFAM: phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN; SMART:
FT                   guanylate kinase/L-type calcium channel region; KEGG:
FT                   ypi:YpsIP31758_3567 putative phosphonate metabolism ribose
FT                   1,5-bisphosphokinase PhnN"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39622"
FT                   /db_xref="GOA:A8G932"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G932"
FT                   /protein_id="ABV39622.1"
FT                   /translation="MAQLIYLMGPSGSGKDSLLAALRADVDSAPLVAHRYITRPADAGC
FT                   ENHIALSEPEFLRRRAKGLFALDWQAHQHHYAFGIEVDLWLLQGIDVVVNGSRAHLAQA
FT                   QQRYGAQLLPVCLQVSTGILRQRLQNRGRENADQIEQRLARAAEYQQKLPAICCRLDND
FT                   GNLDDTLAALLALLPASAKQPQDAMP"
FT   gene            complement(568038..569174)
FT                   /locus_tag="Spro_0515"
FT   CDS_pept        complement(568038..569174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0515"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /note="TIGRFAM: phosphonate metabolism protein PhnM; PFAM:
FT                   amidohydrolase; Amidohydrolase 3; KEGG: ypn:YPN_0624 PhnM
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39623"
FT                   /db_xref="GOA:A8G933"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8G933"
FT                   /protein_id="ABV39623.1"
FT                   /translation="MIINNVKLVLEDQTVEGSLEVSDGMIRSFADTPSQLPQALNGEGG
FT                   WLLPGLIELHTDNLDKFFTPRPNVDWPAHSAMSSHDALMVANGITTVLDAVAIGDVRDG
FT                   GHRLENLQKMIDAVIHSQRAGVNRAEHRLHLRCELPNESTLPLFEQLMDKPGVSLVSLM
FT                   DHSPGQRQFASREKYREYYQGKYHLNDQQMSEYEEQQIKLSARWATPNREAIAAHCRAR
FT                   KISLASHDDATAAHVSESCALGSVIAEFPTTEDAALASHQQGLQVLMGAPNIVRGGSHS
FT                   GNVAAHHLAALGVLDILSSDYYPASLLDAAFRIAADERNGYSLPQAVQMITRNPARALD
FT                   LQDRGTIAEGLRADLVLVRPHGEHVYVQNVWRQGKQVF"
FT   gene            complement(569174..569878)
FT                   /locus_tag="Spro_0516"
FT   CDS_pept        complement(569174..569878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0516"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="KEGG: ypp:YPDSF_3272 phosphonates transport
FT                   ATP-binding protein; TIGRFAM: phosphonate C-P lyase system
FT                   protein PhnL; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39624"
FT                   /db_xref="GOA:A8G934"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G934"
FT                   /protein_id="ABV39624.1"
FT                   /translation="MTIQIRVEHLSKTFVLHQQHGTQLPVLHDANMTVSSGECVVLHGH
FT                   SGSGKSTLLRSLYANYLPDSGHIWVNHQGEWLDMVQAEARQILAVRRHTLGWVSQFLRV
FT                   IPRISALDVVMQPLLEQGVNRAECRERAETLLNQLNVPQRLWQLAPSTFSGGEQQRVNI
FT                   ARGFIVDYPILLLDEPTASLDSRNSAAVVALIEQAKQRGAAIVGIFHDEGVRQQVADRL
FT                   YDMQAPQALEIL"
FT   gene            complement(569895..570683)
FT                   /locus_tag="Spro_0517"
FT   CDS_pept        complement(569895..570683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0517"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="KEGG: yen:YE0473 phosphonates transport ATP-binding
FT                   protein; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnK; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39625"
FT                   /db_xref="GOA:A8G935"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G935"
FT                   /protein_id="ABV39625.1"
FT                   /translation="MTSTPLSTTPLLSVTNLTHLYAPGKGFSDVSFDIYPGEVLGIVGE
FT                   SGSGKTTLLKSISARLAPQHGQILYRPQAGQQHDLYAMAESDRRRLLRTDWGVVHQHPL
FT                   DGLRPQVSAGGNIGERLMAIGQRHYGDIRRQAGQWLEDVEIPVSRLDDLPTTFSGGMQQ
FT                   RLQIARNLVTHPKLVFMDEPTGGLDVSVQARLLDLLRTLVVEMQLAAVIVTHDLGVARL
FT                   LAHRLLVMKQGEVVESGLTDRVLDDPHHPYTQLLVSSVLS"
FT   gene            complement(570683..571543)
FT                   /locus_tag="Spro_0518"
FT   CDS_pept        complement(570683..571543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0518"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /note="PFAM: phosphonate metabolism PhnJ; KEGG:
FT                   ypi:YpsIP31758_3563 phosphonate metabolism protein PhnJ"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39626"
FT                   /db_xref="GOA:A8G936"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A8G936"
FT                   /protein_id="ABV39626.1"
FT                   /translation="MSEVLTGYNLGYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPM
FT                   PYGWGTGGIQLTASVIGRADVLKVIDQGADDTTNAVSIRRFFQRVAGVATTERTPEATL
FT                   IQTRHRIPETALREDQILIYQVPIPEPLRFIEPRETETRKMHALEEYGVMQVKLYEDIA
FT                   RYGHIATTYAYPVKVNDRYVMDPSPIPKFDNPKMHMMPALQLFGAGREKRIYALPPFTK
FT                   VESLDFDDHPFTVQQWEEPCALCGSRHSYLDEVVLDDQGSRMFVCSDTDYCQQQLAQPS
FT                   QEAQH"
FT   gene            complement(571536..572621)
FT                   /locus_tag="Spro_0519"
FT   CDS_pept        complement(571536..572621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0519"
FT                   /product="phosphonate metabolism"
FT                   /note="PFAM: phosphonate metabolism; KEGG:
FT                   ypi:YpsIP31758_3562 phosphonate metabolism protein PhnI"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39627"
FT                   /db_xref="GOA:A8G937"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A8G937"
FT                   /protein_id="ABV39627.1"
FT                   /translation="MYVAVKGGEKAIEAAHQLQEQLRRGDDSVPALGTQQIEQQLGLAV
FT                   DRVMTEGGIYDPQLAALAIKQASGDLVEAIFLLRAYRTTLPRLAVSEPLATENMRLERR
FT                   ISAVYKDLPGGQVLGPTYDYTHRLLDFALLAEGEAPRAPQADEPLPENCAHVFDLLSQQ
FT                   QLALAEQDDGSAPDDITRNPPVYPCSRSARLQQLVRGDEGFLLALSYSTQRGYGRTHPF
FT                   AGEIRTGYVSAEIVPEELGFAVDIGEILLTECEMVNGFIDPVDQPPHFTRGYGLVFGRA
FT                   ERKAMAMALVDRALQSPEYQEGIASPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQA
FT                   ELELLKRLRQEFSERQEARDE"
FT   gene            complement(572621..573202)
FT                   /locus_tag="Spro_0520"
FT   CDS_pept        complement(572621..573202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0520"
FT                   /product="phosphonate metabolism"
FT                   /note="PFAM: phosphonate metabolism; KEGG: yen:YE0476 PhnH
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39628"
FT                   /db_xref="GOA:A8G938"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:A8G938"
FT                   /protein_id="ABV39628.1"
FT                   /translation="MSLLTGFAQPIEQSQQAFRLILKALSEPGYIVTLPASPAWGALNA
FT                   ASTAALLTLADQETPIQLCLALESEQVLTNIRFHSGAPLANNSEEVCFALFDAQLQATD
FT                   LQALPHGSEISPEFSATVVVQIDSLEQGTPLRLTGPGIEHQRVISPSLPQAVLDYLINR
FT                   PQRFPLGLDFLLTCGERLLALPRTTHVEVC"
FT   gene            complement(573206..573649)
FT                   /locus_tag="Spro_0521"
FT   CDS_pept        complement(573206..573649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0521"
FT                   /product="phosphonate metabolism PhnG"
FT                   /note="PFAM: phosphonate metabolism PhnG; KEGG: yen:YE0477
FT                   PhnG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39629"
FT                   /db_xref="GOA:A8G939"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A8G939"
FT                   /protein_id="ABV39629.1"
FT                   /translation="MQALQPRQRWMSVLAHSQPDQLRSHWQALNLSPRYQTIRAPEIGL
FT                   AQLQGRMGATGRRFVLGDMTVTRAVVQLENGGYGYSYIAGRDKAHAELCALADALLQLP
FT                   EQAELLQQQLIEPLAALQHEQRQLRARAVASSRVDFFTLVRGD"
FT   gene            complement(573650..574378)
FT                   /locus_tag="Spro_0522"
FT   CDS_pept        complement(573650..574378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0522"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="TIGRFAM: phosphonates metabolism transcriptional
FT                   regulator PhnF; PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   yen:YE0478 probable GntR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39630"
FT                   /db_xref="GOA:A8G940"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G940"
FT                   /protein_id="ABV39630.1"
FT                   /translation="MMDLSRHPTSFPTRYQQIAAQLEQELRTQYRCGDYLPSEQQLAER
FT                   YQVNRHTLRRAVDQLVDRGWLQRRHGIGILVLMRPYDYPLHANTRFSQNLFEQGSHPTS
FT                   ERLLAVLRPCNGHVASALSREEGETVIHLRTLRRVNGVPMSLIDHYLPDLDWWPALQQF
FT                   HSGSLHEFIELNIHQPLTRKQTRISARRAQAKESRLLEIATHAPLLCVRTLNVCTGSDS
FT                   VAEYSVSLARADMIELTMEH"
FT   gene            574538..575659
FT                   /locus_tag="Spro_0523"
FT   CDS_pept        574538..575659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0523"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: ssn:SSON_3297 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39631"
FT                   /db_xref="GOA:A8G941"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A8G941"
FT                   /protein_id="ABV39631.1"
FT                   /translation="MMRSGRRRAKLTSLFTEPSQPMPQPLTATEHRSRPWPLWKPILFL
FT                   LVVAVGLYYVKWQPYYGKAFLAADTHSIGKSILANGDSSPWLAAWHYALVYFTAVWKAA
FT                   VLGVVLGSLVQVLIPRDWLMRTLGHPRFSGTLLGAAIALPGMMCTCCAAPVAAGLRRQS
FT                   VSSGAAMAFWLSNPVLNPATLIFMGFVLGWQFAAIRLVAGVIMVLGIAWLVQRATANDP
FT                   QPAALQMPVIPLEKTEAQPFFGRWLKALWALFWSTIPIYILAVLALGAARVWLFPHADG
FT                   AIDNSLLWIIGLAIAGCLFVIPTAAEIPIVQTMMLAGMGTGPALALLMTLPAVSLPSLL
FT                   MLNKAFSAKALCLTAALVALCGIVTGVVGMGMV"
FT   gene            complement(575731..576195)
FT                   /locus_tag="Spro_0524"
FT   CDS_pept        complement(575731..576195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0524"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: stm:STM4451 anaerobic
FT                   ribonucleotide reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39632"
FT                   /db_xref="GOA:A8G942"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A8G942"
FT                   /protein_id="ABV39632.1"
FT                   /translation="MNYHQYYPIDVVNGPGTRCTLFVAGCVHQCPGCYNKSTWRLNSGQ
FT                   LFTQAMEDQLIADLNDTRIPRQGLSLSGGDPLHPANVAAVLQLVKRVHAECPGKDIWLW
FT                   TGYRLAELDAQQMQVVDRINVLIDGKFVQDLKDPALIWRGSANQVVHKLR"
FT   gene            complement(576256..578394)
FT                   /locus_tag="Spro_0525"
FT   CDS_pept        complement(576256..578394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0525"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: yen:YE0482 anaerobic
FT                   ribonucleoside-triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: formate
FT                   C-acetyltransferase glycine radical; ATP-cone domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39633"
FT                   /db_xref="GOA:A8G943"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A8G943"
FT                   /protein_id="ABV39633.1"
FT                   /translation="MKPVVIKRDGCQVPFDEARIGQAIERAALAVGIVNADYCATVARV
FT                   VAQRMSQQQRVDIHEIQQAVENQLMAGEYKQLARAYIEYRHDRDVARELRGRLNQEIRG
FT                   LVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHILPRDVVLAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTNGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEILAPFVSESFNKHRQVAEQWQIPDAQGYAMARTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTCWESRMIQRSILQNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   QYGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGTYEENGELVH
FT                   DGRNNIGVISLNLPRIALEAVGDENRFWQLLDQRLLLAKKALMTRIARLEGIKARVAPI
FT                   LYMEGACGVRLKADDNIADIFKNGRASISLGYIGLHETINALFGDQRHVYDDEALRAKA
FT                   VAIVARLRAATDSWKEETGYGFSLYSTPSENLCDRFCRLDTADFGVVPGVTDKGYYTNS
FT                   FHLDVEKKVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGFTGEFACTSKGFTCPKCGNHEPSKVSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRVKHLGNGQIG"
FT   gene            complement(578667..579575)
FT                   /locus_tag="Spro_0526"
FT   CDS_pept        complement(578667..579575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0526"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: yen:YE0483 putative LysR-family
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39634"
FT                   /db_xref="GOA:A8G944"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A8G944"
FT                   /protein_id="ABV39634.1"
FT                   /translation="MSLPFDVHRLLPAFLAAAQAQNFSAAARQLGVTPAAISKNIRVLE
FT                   EKLALRLFQRNTHNVVLTDEGKALLQQVAPLWQALSATLETAGSAQQAPSGTVRVSMIP
FT                   GFGRQMLMPLIPQFLERYPQIDLDLSLDARVVNLVGEGFDVGIGSRVDPDSRLVARSLY
FT                   PMQMVLAASPGYLAQHGIPQDPQDLLQHNCLLHRNPATGRSVKWPLQQQGEAKALELQG
FT                   RLVASRPEMLLDAALAGLGIVCLARWYAEHHFAQGTLQPVLADCWPRPTQLWLYYASAD
FT                   LPPRVRVWVEFLLEHFRHRPA"
FT   gene            579680..580204
FT                   /locus_tag="Spro_0527"
FT   CDS_pept        579680..580204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0527"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   yen:YE0484 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39635"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A8G945"
FT                   /protein_id="ABV39635.1"
FT                   /translation="MSRILVLTAHRFPDDSRINKALIEALRPLPNVTIHELMRTYPDYQ
FT                   IDVAREQELLQGHDAVVMLFPFYWYSSPAILSEWQDAVLTHGFAYGSEGTQLQGKPLQL
FT                   VVTTGGNQQAYTPEGYNRYPVADLLRPFHAVANLTGMDYLPPHLVQGVFDMSDERLAQE
FT                   AAGVVELLKKL"
FT   gene            complement(580232..581896)
FT                   /locus_tag="Spro_0528"
FT   CDS_pept        complement(580232..581896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0528"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="KEGG: yen:YE3773 putative trehalose-6-phosphate
FT                   hydrolase; TIGRFAM: alpha,alpha-phosphotrehalase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39636"
FT                   /db_xref="GOA:A8G946"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A8G946"
FT                   /protein_id="ABV39636.1"
FT                   /translation="MSNPIPWWQNGVIYQIYPKSFQDSTGNGYGDLAGVTERLDYLQEL
FT                   GIDAIWLTPVYVSPQVDNGYDVADYCAIDPAYGTMEDFDRLIAAAHQRSIRIVMDMVFN
FT                   HTSTEHPWFKASQDPESPFRQFYVWRDGEGDALPNNWRSKFGGNAWQWHADSGQYYLHL
FT                   FATEQADLNWEHPPVREELKKVCQFWADKGVDGLRLDVINLVSKQQDFPSDNLGDGRRF
FT                   YTDGPRIHEFLQEMSRDVFQPRGLMTVGEMSSTTLEHCRQYAAQSGEELSMTFNFHHLK
FT                   VDYAGGEKWTLAAPNYVELKQIFSHWQQGMHNQAWNALFWCNHDQPRIVSRFGDEGELR
FT                   VPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPGFNSIEQYRDVESLNMYAELSAQGKSDA
FT                   ELLAILASKSRDNGRTPMQWSSAPNAGFTQGTPWISCAENYPQINAEAALADLDSVFYA
FT                   YRQLITLRKQYPLLTHGDYRDLAPAHPALWCYQRSWNGQRLLVVANLSREPLAWQAEGV
FT                   EPSALWRPLMGNYADAPAQPQATSLRPFEAVWWLLED"
FT   gene            complement(581942..583357)
FT                   /locus_tag="Spro_0529"
FT   CDS_pept        complement(581942..583357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0529"
FT                   /product="PTS system, trehalose-specific IIBC subunit"
FT                   /note="TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: yen:YE3774 PTS
FT                   system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39637"
FT                   /db_xref="GOA:A8G947"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8G947"
FT                   /protein_id="ABV39637.1"
FT                   /translation="MSKVKQQDIDRLIVLVGGRENIATVSHCITRLRFVLNDPALAKPK
FT                   EIEELPMVKGCFTNAGQFQVVIGPEVGDYYQALIATTGVNEADKEQAKVAARQNMTWSE
FT                   RAISHFAEIFFPLLPALISGGLILGFRNVIGDIPMSGGQTLAQMHPAWKTIYDFLWLLG
FT                   EAIFMFLPVAICWSTVKKMGGTPVLGIVLGITLVSPQLMNSYQLGQQIPEVWNFGWFTI
FT                   QKVGYQAQVIPSMLAGMALGWIETRLKKIVPDYLYLVVVPVVSLLLAVFLAHAFIGPFG
FT                   RMIGDGVAWAVKAVMTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDMQMIQSMGGTPV
FT                   WPLIALSNIAQASAVLGIIIVSRKANEREISVPAAISAYLGVTEPAMYGINLKYRFPML
FT                   CAMIGSAFAGLICGLDGVMANGIGVGGLPGILSIKPQFWMIYTVAILVAVVIPLVLTIM
FT                   VYKRKASRGELPV"
FT   gene            583679..584092
FT                   /locus_tag="Spro_0530"
FT   CDS_pept        583679..584092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0530"
FT                   /product="entry exclusion protein 2"
FT                   /note="KEGG: ssn:SSON_PB07 entry exclusion protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39638"
FT                   /db_xref="UniProtKB/TrEMBL:A8G948"
FT                   /protein_id="ABV39638.1"
FT                   /translation="MTLTLPRILIVFTALFLSACAGQKSSPERHAKHAIYQLAREDFSP
FT                   EMRTQIPDSIKAAIPFFDQFYQMGKADRAKGLTRQQAEQQEAYFRSPEFLSEMGQKGKF
FT                   INQEYSVDNPQKQRQILLDSAVATYWDGYDGRP"
FT   sig_peptide     583679..583744
FT                   /locus_tag="Spro_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.763 at
FT                   residue 22"
FT   gene            complement(584203..584460)
FT                   /locus_tag="Spro_0531"
FT   CDS_pept        complement(584203..584460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0531"
FT                   /product="Colicin D"
FT                   /note="PFAM: Colicin D; KEGG: ypm:YP_3568 putative colicin
FT                   immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39639"
FT                   /db_xref="GOA:A8G949"
FT                   /db_xref="InterPro:IPR015287"
FT                   /db_xref="InterPro:IPR036471"
FT                   /db_xref="UniProtKB/TrEMBL:A8G949"
FT                   /protein_id="ABV39639.1"
FT                   /translation="MKLVELGKSFIEKKISAEQFAEDIVIERRKLYGIEEPNKSVDKCG
FT                   GELFILADCYNPEPDRDDYELDETGLRKEVKAILEKFNLL"
FT   gene            complement(584466..586424)
FT                   /locus_tag="Spro_0532"
FT   CDS_pept        complement(584466..586424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0532"
FT                   /product="S-type Pyocin domain protein"
FT                   /note="PFAM: S-type Pyocin domain protein; KEGG:
FT                   pap:PSPA7_3037 killer protein of pyocin S3"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39640"
FT                   /db_xref="GOA:A8G950"
FT                   /db_xref="InterPro:IPR016128"
FT                   /db_xref="InterPro:IPR024440"
FT                   /db_xref="InterPro:IPR036302"
FT                   /db_xref="InterPro:IPR037178"
FT                   /db_xref="InterPro:IPR038233"
FT                   /db_xref="UniProtKB/TrEMBL:A8G950"
FT                   /protein_id="ABV39640.1"
FT                   /translation="MTSMGYVWRGEGWQRGFSDNEDNILVEAWVGGPPKKPEPLTNVFE
FT                   KISDINKPISIHPENDDVIPFGDEAKKIYRDDANKAIDLASGITSDIERKMQETDKDIA
FT                   NVSSQLTQPQRTELEKASLNLVLSKLKVKQERLNVLRHNANKSRAHEEYTKYYNEEMFM
FT                   AYDATSWRDNYRKENSKKAQEKRQEEQQHKIDAETARQRVSVLENEQREKENEVHRLRE
FT                   LEFAAEEARKAEEARKAEEARKAEEARRAEEARRAEEARRAEEARRAEEARKVEAARKA
FT                   LFAKAGILDAPAYTPEKAKAATAALATAGAMVLNRAPGMLQLSTAAEGVLTTTSELAGS
FT                   IAGAVWRGAIALAEAATVSTAGATVSALVMGFWPTEAGKGSDKLYGRDIVMFGFQANLI
FT                   AAGKVSISPEMHSVDLPVRGSLVMENGQQQVRLVKTGIGGVPASVPILKAVRDEKTGLD
FT                   RITLPSVGGAPSRTILINPAPVGPTAPPHTGNSSPAPVTPVHTGTTVKQADSIVTTSFP
FT                   ADDLKELQDFIYWQPDATGSGVEPIYVMQSDPLDSGRFTRKQLDKKFKHAIDFGISDTK
FT                   KNRETLTKFRDEVNAHLADKETVERGTYRREKGSKVYFNPKSMRVVILKANGDFLSGWK
FT                   IDPKEENGKIYLETGVL"
FT   gene            complement(586523..587659)
FT                   /locus_tag="Spro_0533"
FT   CDS_pept        complement(586523..587659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0533"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgl:SG1235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39641"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:A8G951"
FT                   /protein_id="ABV39641.1"
FT                   /translation="MAEEKKNAQVANGVNDDVTELKSLTTLRKRVVSDGEIVSKAANGF
FT                   RLANGNTGVMLRNDGKDFYALTTPSGQAQDGQWNTLRPFSFNLSTGRVSLRNGVDISGG
FT                   AMVSHNAGISTATTGPAQLINGQIYNSAPVHSDFTSGNVTTTMVMGTRVIADKDNFGLI
FT                   SYRDWQGNWNELQVRTNAELSVGQLIKRNADGWIWAAGNKNVNNNADRITNGLHIQGAG
FT                   DLSADLYHYERIGKHHLLALHVANGGGDGWYEFRDKGNAYTNGTWNSSSDIRMKTDIEK
FT                   IDGALEKLGKIGGYTYLKQGVPEAGVIAQEVENVLPQSVTTTELKLNDGSVLKDARGIN
FT                   INGVVALLVEALKEEREARLALELRLVALEEATSGKQD"
FT   gene            complement(587957..588904)
FT                   /locus_tag="Spro_0534"
FT   CDS_pept        complement(587957..588904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0534"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="TIGRFAM: trehalose operon repressor; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ypi:YpsIP31758_0432
FT                   trehalose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39642"
FT                   /db_xref="GOA:A8G952"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G952"
FT                   /protein_id="ABV39642.1"
FT                   /translation="MQNRLTIKDIARLSGVGKSTVSRVLNNEGSVSPQTRERVEAVIRQ
FT                   QGFTPSKSARAMRGQSDKVVGIIVSRLDSPSENQAVRTMLPLLYQHGFDPIVMESQFET
FT                   RLVEEHLHVLQQRNVDGVILFGFTGLTAAMLSPWQDKMVVLAREYEGFSSVCYDDDGAV
FT                   RLLMERLQQQGHRHIGYLGVQLSDATTGMRRHQAYLDACRQQQITPSVALGELSYQSGF
FT                   QLAASVIDAQTTALVCASDTIALGAIKYLQQQHIAPLQVCGIGNTPLLNFLFPETFSVD
FT                   LGYGTAGLQAAQQLLGQLSGEQGIRQIIVPSQLA"
FT   gene            589380..592088
FT                   /locus_tag="Spro_0535"
FT   CDS_pept        589380..592088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0535"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="KEGG: yen:YE3776 Mg2+ transporter ATPase; TIGRFAM:
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; magnesium-translocating P-type ATPase; PFAM: cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; E1-E2 ATPase-associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39643"
FT                   /db_xref="GOA:A8G953"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A8G953"
FT                   /protein_id="ABV39643.1"
FT                   /translation="MKLKNIPRQLLGLLSRNLPRRLVHRDSLLDGLGGKAQGLPAGLAQ
FT                   QRLECAAANTTELYLRFQSHPEGITAHEAERVRERCGENVIDDQQQEAWWQHLWHCYRN
FT                   PFNLLLTALGMISYATEDLTGALVIALMVVISTLLNFIQEARSNKAADALKAMVSNTAT
FT                   VIRSDALTGKSEHLELPISQLVPGDIIKLAAGDMIPADLRVLSAKDLFISQAALTGESL
FT                   PVEKVADLRGQAEDPLECQNLCFMGTNVVSGTALAMVIGTGGDTYFGQLAQRVIGQDQQ
FT                   PNAFQSGISKVSWLLIRFMLVMTPIVLLINGYTKGDWWEAALFALSVAVGLTPEMLPMI
FT                   VTSTLARGAVKLSKQKVIVKRLDAIQNFGAMDILCTDKTGTLTQDKIVLERHTDVFGVA
FT                   SDRVLHYAWLNSFYQTGLKNLLDVAVLSCAEQNQQPDALQHYHKVDEIPFDFERRRMSV
FT                   VVAKDAQYHELICKGALEEMLAICSHVRQEDQVIPLTEALLARIRRVTDDLNQQGLRVV
FT                   AVANKILPAQAYEYGVADESDLILEGYVAFLDPPKESTAPALAALKNSGVTVKILTGDN
FT                   ELVAAKVCKDVGLAADHVLRGSEIEQMDDQQLAQAAARTTVFAKLTPLHKERIVKLLRQ
FT                   QGHVVGFMGDGINDAPALRAADIGISVDSAVDIAKEAADIILLEKSLMVLEQGVIEGRR
FT                   TFANMLKYIKMTASSNFGNVFSVLIASAFLPFLPMLPLHLLIQNLMYDISQVAIPFDNV
FT                   DDDQITQPQRWNSGDIGRFMVFFGPISSIFDVLTFSLMWWVFKANTPEMQTLFQSGWFV
FT                   EGLLSQTLIVHMIRTRKIPFIQSRPSWPLCIMTLVVIATGIGLTFSPLASFLQLQALPL
FT                   GYFPWLVLILTGYMVLTQCVKGWFVRRYGWQ"
FT   gene            592234..594627
FT                   /locus_tag="Spro_0536"
FT   CDS_pept        592234..594627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0536"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: Beta-N-acetylhexosaminidase-like; Glycoside
FT                   hydrolase, family 20, catalytic core; KEGG: ent:Ent638_0442
FT                   beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39644"
FT                   /db_xref="GOA:A8G954"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A8G954"
FT                   /protein_id="ABV39644.1"
FT                   /translation="MHRSLRYTLLASSLLLSLGALAQPAGDLPLMPWPQQVELTQPAGR
FT                   LVLDHRLSINLQGDDLGDALPRWRQRIELQTGWTLAPQAAKAAGVVINVNIKDKVAAQP
FT                   LPGSDESYKLLVMQDGVTLTANTRFGALRGMETLLQLVQTDGQNTFLPLVSITDVPRFP
FT                   WRGVLLDSARHFLPLADILRQLDGMAAAKLNVFHWHLTDDQGWRFASEHYPKLQQQASD
FT                   GQFYTREQMQQVVAYATARGIRVVPEIDLPGHASSIAVAYPELMSAPGPYQMERKWGVH
FT                   KPTLDPTREEVYQFVDAIIGELAAIFPDPYLHIGGDEVDASQWKQSKTIQAFMQQHQLA
FT                   DIHALQAYFNQKLEKILEQHQRQMVGWDEIYHPSLPRSIVIQSWQGQDSLGASAQDGYQ
FT                   GILSTGFYLDQPQSSAYHYRNEILPQPLGVATEVQPDEKAQSWQFSMPRLKGSAVEGSF
FT                   TLIEGKQGWRGFIDFNGKSRRALQDIVWRSPQQVSFRVDTWMGETRPVFTLQQDKLSGY
FT                   TLVGNVRYPTSGGKLTAIPAGKMPVVPDAKQQSNILGGEAALWAENIRAPILDLKLWPR
FT                   GFAVAERLWSAQDVTDENNMYRRLAAVDAWSVVSVGLQQHAETAREFTRLANSVQIAPL
FT                   QTLAEAVEPGQYYTRQHLKFKAGNYHQFEPLNRFADALPAESNAVREMGLQVAALVKDR
FT                   NNSAAAQALRERLQRWQLNTAPVKTVIAGNRVMQDLAPVAQDVGALAALGLMLLERYQQ
FT                   NKPLSKAEAGQIQQQLDTAAQIRDEVVIAAVYPLEALLRASAIE"
FT   sig_peptide     592234..592302
FT                   /locus_tag="Spro_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(594688..595416)
FT                   /locus_tag="Spro_0537"
FT   CDS_pept        complement(594688..595416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0537"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   yen:YE3772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39645"
FT                   /db_xref="GOA:A8G955"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A8G955"
FT                   /protein_id="ABV39645.1"
FT                   /translation="MTYCVAMRLSSGLVFASDSRTNAGVDHISTFRKLHVFQQDGERLL
FT                   VLQSAGNLATTQSIISLLQRRCKDAERPNLLNAPSLYEAATLVGETVREVIQRDSEAQQ
FT                   SGSTTDFSCSLLLGGQIHGEEMRLFHIYPQGNFIEATRDTPYFQIGESKYGKPIIDRVL
FT                   NYDTPLEQAMQCALISLDSTLRSNLSVGLPLDVMIYPRDSFSSAQQYRITEDHPHFNAI
FT                   RKGWGEGLVSIFKQLPPLQL"
FT   gene            complement(595492..596286)
FT                   /locus_tag="Spro_0538"
FT   CDS_pept        complement(595492..596286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0538"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; KEGG: yen:YE3771
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39646"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A8G956"
FT                   /protein_id="ABV39646.1"
FT                   /translation="MKLNIEHNTHYTYAQQVQRSTQYLRLTPQNSRHQRVISWQLTLPE
FT                   DAVCTTDAFGNVLHVLTLDHPHQAITIQAHGVVEIEDGVEDQVMGHLSPLVFLRHSPLT
FT                   QPDSAIQAFALRYYQPQAVLAGLENLMGELLLKMPYSPGSTSVTDSAAQAFATGTGVCQ
FT                   DHTHVFLACCRSLNIPARYVSGYLYSEDSTHVATHAWAEAWVDERWHSFDVTNNTRLPN
FT                   QHLKLAVGIDYLDACPVRGMRLGGGCENMQTIAEVQMMPSGQ"
FT   gene            complement(596283..597212)
FT                   /locus_tag="Spro_0539"
FT   CDS_pept        complement(596283..597212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0539"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   yen:YE3770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39647"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:A8G957"
FT                   /protein_id="ABV39647.1"
FT                   /translation="MLSRTASELYWMARYLERAESIARVLDVTNKLSMMPIRDSEDQDL
FT                   QVPLNLTSTGELYAAAYPDLTMANLVSFFALDSRNHSSIYSCLQMGWNNAHAVRGSLSS
FT                   EVWECINSTWIEMKLIRRQGIGSVGADAFFDWVKERSHLFRGAMFGTLLRSDAMCFIRL
FT                   GTLLERADSTARLLGVKNALMDSDGDPVREYYRMDTLLRAVSAREAYHSIYKQQLSRDT
FT                   IAELMILRNEIPRSLLACVGDMVQQLEQIGGNSANQPRRLAHTLHAELRFSSMKDLNRV
FT                   GLNDWLDAFLGQIGGIAESIHHTYLEAQ"
FT   gene            complement(597206..598684)
FT                   /locus_tag="Spro_0540"
FT   CDS_pept        complement(597206..598684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0540"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: yen:YE3769 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39648"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:A8G958"
FT                   /protein_id="ABV39648.1"
FT                   /translation="MLDPSTACNVDEVTMLNIDLSASPFFDEMLLAEGKHRGHYEAYCH
FT                   WLQQADHKAIQRKREEAALLFHRVGITFNVYGEDDGAERLIPFDSVPRIIPAGEWAMLD
FT                   RGIRQRVQALNAFLHDIYHQQHILKAGIIPAEQVLANDQYQPCMQGVDLHRNIYAHIVG
FT                   VDMVRGGDGQYYVLEDNLRTPSGVSYMLENRKMMMRLYPELFAQQRIAPVERYPSHLLQ
FT                   TLRESSPINDPTVVVLTPGRFNSAYFEHSFLAQQMGVELVESADLFVKDGAVFMRTTAG
FT                   PCKVDVIYRRVDDAFLDPLAFRPDSMLGVPGLLSVYRTGNVVLANAIGTGVADDKSIYP
FT                   YVPEMVRFYLQEEPILNNVPTWQCRHKNELSYVLANLEQMVVKEVHGAGGYGMLIGPAA
FT                   TKDEIAHFRTLLLAKPHNYIAQNTLALSTCPTFVNDGLAPRHIDLRPFALSGAEIRLVP
FT                   GGLTRVALAQGSLVVNSSQGGGTKDTWVLEDDAC"
FT   gene            complement(598899..601880)
FT                   /pseudo
FT                   /locus_tag="Spro_0541"
FT                   /note="thioester reductase domain; amino acid adenylation
FT                   domain"
FT   gene            complement(602093..602479)
FT                   /locus_tag="Spro_0543"
FT   CDS_pept        complement(602093..602479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0543"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: yen:YE3768 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39649"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8G959"
FT                   /protein_id="ABV39649.1"
FT                   /translation="MSRNISTELAPAAIGPYVQGVDLGSMIITSGQIPVDPKTGAVADD
FT                   VAAQARQSLENVKAIVEAAGLKVADIVKTTVFVKDLNDFATVNAAYESFFTEHNAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(602578..603042)
FT                   /locus_tag="Spro_0544"
FT   CDS_pept        complement(602578..603042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0544"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit; KEGG: yen:YE3767 aspartate carbamoyltransferase
FT                   regulatory chain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39650"
FT                   /db_xref="GOA:A8G960"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G960"
FT                   /protein_id="ABV39650.1"
FT                   /translation="MTHDNKLQVEAIKCGTVIDHIPAQIGFKLLTLFKLTATDQRITIG
FT                   LNLPSGELGRKDLIKIENTFLTEQQANQLAMYAPKATVNRIDNYEVVRKLTLSLPDHID
FT                   GVLTCPNSNCISRSEPVSSSFSVKSRDGDVHLKCRYCEKEFEHQVVLQAD"
FT   gene            complement(603055..603990)
FT                   /locus_tag="Spro_0545"
FT   CDS_pept        complement(603055..603990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0545"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: yen:YE3766 aspartate carbamoyltransferase
FT                   catalytic subunit; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39651"
FT                   /db_xref="GOA:A8G961"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G961"
FT                   /protein_id="ABV39651.1"
FT                   /translation="MANPLYHKHIISINDLSREDLELVLRTAASLKANPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETSMHRLGASVVGFADGSNTSLGKKGETLADTISVIGTYVDAIV
FT                   MRHPQEGAARLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNINIAMVGD
FT                   LKYGRTVHSLAQALAKFEGNRFFFIAPDALAMPAYILQMLEEKGIQYSLHSSIEEVVPE
FT                   LDILYMTRVQKERLDPSEYANVKAQFVLRAADLAGARDNLKVLHPLPRIDEITTDVDKT
FT                   PYAYYFQQAGNGIFARQALLALVLNADLAL"
FT   gene            complement(604294..605298)
FT                   /locus_tag="Spro_0546"
FT   CDS_pept        complement(604294..605298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0546"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   eca:ECA4256 putative iron(III) ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39652"
FT                   /db_xref="GOA:A8G962"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A8G962"
FT                   /protein_id="ABV39652.1"
FT                   /translation="MSEKMRFRLAWTVAPLLLAGLMFANVAQGSVSLSFSQVVTALGIT
FT                   PGEVPPMIKSIVLDLRLPRTLLGLLAGAGLALVGALLQTTTRNDLADPFLFGLSSGASA
FT                   GVVMVITRLGNSLGAWALPVSSFVGGILSAAVVMIIFMTQSQKGTDKLIICGLAVSFLF
FT                   GAFTNYLVFSGDQRTASSVLFWTLGGLGLARWDNLIFALLALLILVVLIALRWRSLDGL
FT                   LAGEQTAGTLGINTSRLRTEVFLCCSLATALLVALTGVIGFVGLMVPHLARPFTGVRHR
FT                   RLLPLVGVLGAVLLSAGDLLSRVITAPQELPIGIITAGLGGIFVLAILLRRTQ"
FT   sig_peptide     complement(605209..605298)
FT                   /locus_tag="Spro_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.715 at
FT                   residue 30"
FT   gene            complement(605298..606254)
FT                   /locus_tag="Spro_0547"
FT   CDS_pept        complement(605298..606254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0547"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: eca:ECA4255
FT                   putative iron(III) ABC transporter, periplasmic-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39653"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A8G963"
FT                   /protein_id="ABV39653.1"
FT                   /translation="MKKLILAALLALASESVAASGFPVTVDNCGQPLTFVQAPQRAVIQ
FT                   DINMSQMAFALQLQPAMVGVTGISGWYKNIPEFTQQRGTIPELAPKYPTVENLLAVNPD
FT                   LFFAGWNYGLRGDVTPQALAKFNIKTLILSESCIHIDSHRPRASLDLLYGDMIRLGKVF
FT                   GKQEQAETLVSVWKQQVTDIHRKIATQKPIKVFLYDSGEDKPYTSGAYAMPTAIIEAAG
FT                   AKNVMDSLNTSWATTNWESVAAAEPEFIILVDYQAETTDDTDQRQLFLEQHPLMKHTRA
FT                   VLHHRYLKLKYQELTPGPVNIDAIQKLAHALYPAAFT"
FT   sig_peptide     complement(606195..606254)
FT                   /locus_tag="Spro_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.870 at
FT                   residue 20"
FT   gene            complement(606376..607173)
FT                   /locus_tag="Spro_0548"
FT   CDS_pept        complement(606376..607173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0548"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4254 putative iron(III) ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39654"
FT                   /db_xref="GOA:A8G964"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A8G964"
FT                   /protein_id="ABV39654.1"
FT                   /translation="MNNLPTDRLLSVQNLSLASSGKVPRINRVTFTLQQDESVTIIGPN
FT                   GSGKSTLLRLITGELKPSEGEILFQGTPLSAIKPQQRARSIALLSQHDNADLRLKVNEY
FT                   VALGRLPWQADRVPSEHQRIIATAMDDVGIRHLQHLPLARLSGGERQRAGFARVLAQQP
FT                   VLLLLDEPTNHLDPLARHQLLSLIHQKKIASLKVLHDLELVQPFSDQVIMMHQGKILCY
FT                   GPPDVVLESAHLQQVFGMKSLQARHPLTGEALRFFEALPTSPC"
FT   gene            complement(607193..608434)
FT                   /locus_tag="Spro_0549"
FT   CDS_pept        complement(607193..608434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_04792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39655"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:A8G965"
FT                   /protein_id="ABV39655.1"
FT                   /translation="MKYQKNFSVTHKAAVMHSAPNGPANLLNEDVCLPAAAIKRSSLEN
FT                   NIAWMQNYADARGVSLAPHGKTTMTPWIFQRQVAQGAWAIGVGSAWQAKVAMEAGVPRV
FT                   LMANQLVGKANMQLIAELKAQHPASGFFCCIDSLSNAQTLAAFFSQRGQTLDVLLELGV
FT                   PGGRCGCRSVAQAERLAQEIAALPGLRLQGIELYEGVMHGDDAQSKIEQFLREAAGLLR
FT                   RLHQQGLLNAEQAILTGAGSSWYDVVCNIWSEEALPANCRVVIRPGCYITHDQGIYQDA
FT                   QNAVLARDSYACDLAGELTSALELVALVQSVPEPGRVIVNFGKRDAAFDAGLPQPVAHY
FT                   RNGVRQQSDTQHLITHGIMDQHAMLSCPAEFPVQVGDILVFATSHPCLTFDKWKTLFLI
FT                   DDNYNVIETIETFF"
FT   gene            608628..609491
FT                   /locus_tag="Spro_0550"
FT   CDS_pept        608628..609491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0550"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: kpn:KPN_04798 putative transcriptional
FT                   regulator (N-terminal); putative sugar-binding domain of
FT                   regulator protein (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39656"
FT                   /db_xref="GOA:A8G966"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A8G966"
FT                   /protein_id="ABV39656.1"
FT                   /translation="MGVEIDIISRITERFIELSSAEKRIAQFILDDAEAVTALPIAELA
FT                   RQANVSQASITRFAKALGCRDVRDLKVKLVQSLAVGQRFIHEEPDLEGIQGIYESIINV
FT                   LNINRRSLDDAALAKAVELLSGARQIVAMGMGGGSTLCAAEIQHRLFRLGLPVTAQSDG
FT                   LLVRMMAAVVSRQDVVVALSLGGYTQEVVESAAIARQYGAKVVVIAPAGTPLAAQADVL
FT                   LALVVQENDYIYKPSSSRYAMLAMVDVLATALAMANKRQSRDRLRRIKLALDSHRGGAD
FT                   RQPLGD"
FT   gene            609529..610968
FT                   /locus_tag="Spro_0551"
FT   CDS_pept        609529..610968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0551"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3; KEGG: kpn:KPN_04793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39657"
FT                   /db_xref="GOA:A8G967"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A8G967"
FT                   /protein_id="ABV39657.1"
FT                   /translation="MRYQYLFKNVTVIDGSGGPQYRADVAVKNDRIAAIAPAIEADAEV
FT                   VIEGHERVLSPGFIDVHTHDDTNVIRMPEMLPKISQGVTTVIVGNCGISAAGATIRTQV
FT                   PDPMNLLGEKEHFVYPTIAAYRQQVETVMPAVNVATLIGHTTLRNNQMDDLFRPANSEE
FT                   IVAMREQLRSALQQGALGLSTGLAYASAFSAPTEEVMALAEELADEQGIYTTHLRSEFE
FT                   PILEAMDEAFRIGRHGRVPVVISHHKCAGAKNWGRTQETLKLFDKVRQTQDVSCDCYPY
FT                   SASSSTLDLKQITDDFDIVITWSATHPEMAGQSLRDIAGGWSMSLHEAGKRLMPAGAIY
FT                   YNMDEQDVRRVLSYPLTMVGSDGLPNDPMPHPRLWGAFPRVLGHYSRDEGLFPLTVAVH
FT                   KMSGMSAARYQLPQRGLIKTGYYADLVLFDALKVKDSATFSQPQQPAAGIDAVWVNGVL
FT                   SYEHQAVTGLRAGRFLCRQGK"
FT   gene            610986..611384
FT                   /locus_tag="Spro_0552"
FT   CDS_pept        610986..611384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0552"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: kpn:KPN_04794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39658"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A8G968"
FT                   /protein_id="ABV39658.1"
FT                   /translation="MTIKRYGIDGGTGTGGQHLPFSRAVEAGGWLYISGQTPMKDGEVV
FT                   EGGIIEQSRLAIQNCLDIMVEAGYGLEDVVHVKVILTDARYFQSFNKVFREFFAAHPPA
FT                   RICAVADLVVDCKVEVDITCYNAARMTR"
FT   gene            complement(611437..613005)
FT                   /locus_tag="Spro_0553"
FT   CDS_pept        complement(611437..613005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0553"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: yen:YE0491 ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39659"
FT                   /db_xref="GOA:A8G969"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A8G969"
FT                   /protein_id="ABV39659.1"
FT                   /translation="MKAKVLPLLMLAALSTATLAATPPNTLVVVQSLDDIVSLDPAEAN
FT                   ELSSIQTVPSLYQRLVQADRDDPAKVVPVLAESWQGDAVAKTLTIKLRPQAVFASGNPL
FT                   TADDVIFSYSRAVKMNKSPAFILNVLGWQPDNIDAQLKKIDDHSLQLSWTADVSPAVAL
FT                   NILSTPIASIVDGKAVQANIKDGDYGNAWLKMHSAGSGPFKMRVYQPHQAIVLDANPTS
FT                   PGSKPLLKSIIIKSVPDSATRRLLIQQGDADVARELGPDQTVALKNQPGVKVLEIPSAE
FT                   QNYLVFNTGNTANPLLKNPAFWEAARYLVDYQGITKDLLKGQYFVHQSFLPVGLPGALK
FT                   DNPFSFDPAKAKAILAKAGITNAALTLDVENKPPFITIAQALQASFAEGGVKLELLPAA
FT                   GSQVYSRVRARQHQAAIRLWIPDYFDAHSNASAFAYNDGKTSTVAGLNGWQIPQLSQQT
FT                   LAAVAEADPAKRTALYTAMQQELQRSSPYVFIDQAKTEVVLRDNVKGYQQGLNADMVYY
FT                   DRVSK"
FT   sig_peptide     complement(612943..613005)
FT                   /locus_tag="Spro_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT   gene            complement(613267..614286)
FT                   /locus_tag="Spro_0554"
FT   CDS_pept        complement(613267..614286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0554"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: yen:YE0494 ornithine
FT                   carbamoyltransferase chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39660"
FT                   /db_xref="GOA:A8G970"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A8G970"
FT                   /protein_id="ABV39660.1"
FT                   /translation="MSSINPFYKRHFLRLMDFTPAQLHALLKLSADLKQAKKQGKEVRH
FT                   LQGKNIALIFEKDSTRTRCSFEVAAFDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMY
FT                   DGIQYRGYGQHLVETLAQHAGVPVWNGLTNEFHPTQLLADLLTVQEQLPGKPLSEVKFA
FT                   YLGDTRNNMGNTLLEAAALAGMDLRLVAPKACWPQPELVAECQALAKQTGAKITLTEDI
FT                   AEGVKDADFLYTDVWVSMGEPKETWHERIGLLKPYQVNMAMVKLTGNPNVKFLHCLPAF
FT                   HDDQTTLGKQMAEQYGLHGGMEVTDEVFESAHSVVFDQAENRLHTIKAVMVATLSETL"
FT   gene            614450..614878
FT                   /locus_tag="Spro_0555"
FT   CDS_pept        614450..614878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0555"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   yen:YE0495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39661"
FT                   /db_xref="GOA:A8G971"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:A8G971"
FT                   /protein_id="ABV39661.1"
FT                   /translation="MANSEQLDEQREETRLIIEELLEDGSDPEALYTIEHHLSAEKFEV
FT                   LEKAAVEAFKLGFEVTDAEELEVEDGTLVMCCDVISEVGLNAEVIDAQVEQLVALAARC
FT                   GVNYDGWGTYFEDPNGEEGDDDEEEGDFIDEDDDGKRH"
FT   gene            614934..615698
FT                   /locus_tag="Spro_0556"
FT   CDS_pept        614934..615698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0556"
FT                   /product="tRNA--hydroxylase"
FT                   /note="PFAM: tRNA--hydroxylase; KEGG: ent:Ent638_0461
FT                   tRNA--hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39662"
FT                   /db_xref="GOA:A8G972"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A8G972"
FT                   /protein_id="ABV39662.1"
FT                   /translation="MKYQSLLAPILNFLHCETPDAWIDAARRPENLPLLLTDHMVCELK
FT                   AAQTGMWLIRRYVADKESGDALLALLRPYEAFLHEAQGVPEALFQQNNFTRKILPKNGS
FT                   AYGQDLADRMVLLIKEELHHFSQVLEIMLARQIPYKKITASRYAKGMIREIRTHDPATL
FT                   IDKLICGAYIEARSCERFARLAPHLDDELNRFYVSLLRSEARHYQDYLTLAEQIAGGDI
FT                   SERVAHFGRIEAALIQTPDSEFRFHSGVPAIA"
FT   gene            complement(615720..617327)
FT                   /locus_tag="Spro_0557"
FT   CDS_pept        complement(615720..617327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0557"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: bte:BTH_II0331 GMC oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39663"
FT                   /db_xref="GOA:A8G973"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A8G973"
FT                   /protein_id="ABV39663.1"
FT                   /translation="MSENAFDYIIVGAGSAGCVLAAQLIRRTQARVLLLEAGGDDNNLF
FT                   IKMPAGVAKIIAKKSWPYETEPEPHANNRRMQIAQGKVLGGSSSVNGMIYIRGQRQDYD
FT                   EWAERYGCVGWGYQDVLPYFKRAEANESLSDTYHGGEGLLPVSENRYRHPLSMAFIRAG
FT                   QELDLPYRNDFNGDSQQGVGFYQTTTHNGERASTARTYLKAVRNEQRLVVKLNALVHRV
FT                   VLDNNVATGVVYSQNGGAEVTAHAAQEVILSAGAVGSPKILMLSGIGPREHLQQLGIEP
FT                   LADLPVGKNFHDHLHMSINVSTREPISLYGADRGLQALRHGTEWLAFRSGVLSSNVLEG
FT                   AAFTDSLGDGRPDVQIHFLPMLDSWDDVPGEPLPNIHGFTLKVGYLQPRARGEVLLRSR
FT                   DPKDPVKLHANYLGHPEDLAGSVRAVKFGLRFLQTAALKPLIKDLLMPQPAWLNDEAQL
FT                   EEFVRNFCKTVYHPVGSCRMGQSPQDSVTDLQLRVHGFERLRVIDCSVMPQVTSGNTNA
FT                   PTIMLAEKAVDLLLGTPQ"
FT   gene            617680..618687
FT                   /locus_tag="Spro_0558"
FT   CDS_pept        617680..618687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0558"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: apl:APL_1465
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39664"
FT                   /db_xref="GOA:A8G974"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A8G974"
FT                   /protein_id="ABV39664.1"
FT                   /translation="MEISINKSNYLKGIAIILMLIHHLFAYPSRISPDIPVYHMVNSID
FT                   IEMFVGLFGKICVSMFLFLSGYGFSLKKEVSFKYIWGKLKNLYISYWIVLFIFVPIGII
FT                   FFPGERYSLSPSLFLENLMGIKSTYNSEWWFFKLYVLYVLSLPLLSRLNIGPLLGLLFL
FT                   AALCGKGLQYVGWAPEVLIEYCTWLLPFGFGMVFGRSQKMPPNSWLVKLIATLSRTHPL
FT                   ILLMVTVAVFIVAHNPGLLLVTPLFIIALMNTADGLGSRVNRIVGELGKHSMYMWLTHS
FT                   FYCYYFTQKLIFAPRYTPLILLLLIAVSYLTSLVLSRIELVIKGGMTGKEQKAG"
FT   gene            complement(618845..619378)
FT                   /locus_tag="Spro_0559"
FT   CDS_pept        complement(618845..619378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0559"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ypp:YPDSF_3254 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39665"
FT                   /db_xref="GOA:A8G975"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8G975"
FT                   /protein_id="ABV39665.1"
FT                   /translation="MWFLLMASVNMTTATPVRLLVRPITADDNAAIANVIREVSAEHGL
FT                   TADKGYTVSDPNLDVLYQLYSLPRSAYWVIEVDGQIAGGGGVAPLQGGEVDICELQKMY
FT                   FLPVLRGQGLAKRLALQALEFARQQGFRCCYLETTASLTQAIGLYEHLGFEHIDQAMGT
FT                   TGHVDCEVTMLKTL"
FT   gene            complement(619545..622421)
FT                   /locus_tag="Spro_0560"
FT   CDS_pept        complement(619545..622421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0560"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG:
FT                   ypi:YpsIP31758_3545 valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39666"
FT                   /db_xref="GOA:A8G976"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A8G976"
FT                   /protein_id="ABV39666.1"
FT                   /translation="MEKTNSHLDTAYDPKEIEQKLYDHWENQGYFKPNGDTSQESFCIM
FT                   IPPPNVTGSLHMGHAFQQTIMDTMIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAE
FT                   ENKTRHDYGRDAFIDKIWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVREV
FT                   FVRLHKEDLIYRGKRLVNWDPKLRTAISDLEVENRESKGSMWHLRYPLADGAKTAEGKD
FT                   YLVVATTRPETVLGDTGVAVNPEDPRYKDLIGKEILLPLVGRRIRIVGDEHADMEKGTG
FT                   CVKITPAHDFNDYEVGKRHGLTMINILTFDGDIRQEAEVFNTLGEICTDYCNEIPAQFR
FT                   GLERFAARKAVVAAFEELGLLEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRTAPLAKV
FT                   AVEAVEQGEIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDVNGKVYVGRNE
FT                   AEVRSENNLGPDVVLNQDEDVLDTWFSSGLWTFSTLGWPEQTDALKTFHPTSVMVSGFD
FT                   IIFFWIARMIMLTMHFMKDENGKPQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPLDMV
FT                   DGISLEDLLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDI
FT                   NWDMKRLEGYRNFCNKLWNASRFVLMNAEGQDCGFNGGEKVLSLADRWILAEFNRTVKA
FT                   YREALDTYRFDLAANILYEFTWNQFCDWYLELTKPVVTNGSEAEQRGTRHTLITVLEAL
FT                   LRLAHPVIPFITETIWQRVKTLTGETADTIMLQPFPEYDAALEDTQALNDLEWIKQAIT
FT                   AVRNIRAEMNIAPSKLLEVLLRNCNADAQRRVQENQSFIQRLARLESIALLPAGDKGPL
FT                   SVTKLVDGAELLIPMAGFIDKDAEIARLSKEMGKLDAEIASIEGKLSNEGFVARAPEAV
FT                   VAKERERLTACKEGKVKLQEQQATIAAL"
FT   gene            complement(622435..622884)
FT                   /locus_tag="Spro_0561"
FT   CDS_pept        complement(622435..622884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0561"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: DNA polymerase III chi subunit HolC; KEGG:
FT                   yen:YE0499 DNA polymerase III, chi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39667"
FT                   /db_xref="GOA:A8G977"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:A8G977"
FT                   /protein_id="ABV39667.1"
FT                   /translation="MKQATFYLIEHAEPAGALSAHEAVACAVAAERWRSGKRVLIACES
FT                   QEQAQRLDEALWQRDPHQFVPHNLAGEGPHYGAPVELCWPGKRGNSPRDLLIALLPQFA
FT                   DFATAFHEVVDFVPYEDTLKQLARDRYKAYRSVGFHLTTATPPTH"
FT   gene            complement(622969..624480)
FT                   /locus_tag="Spro_0562"
FT   CDS_pept        complement(622969..624480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0562"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: yen:YE0500 cytosol aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39668"
FT                   /db_xref="GOA:A8G978"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:A8G978"
FT                   /protein_id="ABV39668.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISA
FT                   LLRRGELEGKVGQTLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINTLNDTG
FT                   SMEAVCFLTELHVKGRNTYWKVRQAVETAKETLYTFDQLKSNKVEPRRPLRKMVFNVPT
FT                   RRELTSGERAIQHGLAVSSGIKAAKDLGNMPPNICNAGYLASQARQLADAFSTNITTRV
FT                   IGEQQMKELGMNAYLAVGAGSRNESLMSVMEYKGNPNPDAKPIVLVGKGLTFDAGGISI
FT                   KPAEGMDEMKYDMCGAATVYGVMRVVAELNLPLNVIGVLAGCENMPGGSAYRPGDVLTT
FT                   MSGQTVEVLNTDAEGRLVLCDTLTYVERFDPELVIDVATLTGACVIALGHHITGLMSNH
FT                   NPLAHELIGASEQAGDRAWRLPMSDEYYEQLDSNFADMANIGGRPGGAITAACFLSRFT
FT                   RKYSWAHLDIAGTAWRSGKAKGATGRPVALLSQFLLNRAGLNGDD"
FT   gene            624761..625855
FT                   /locus_tag="Spro_0563"
FT   CDS_pept        624761..625855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0563"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   ypi:YpsIP31758_3542 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39669"
FT                   /db_xref="GOA:A8G979"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:A8G979"
FT                   /protein_id="ABV39669.1"
FT                   /translation="MIIIRYLVRETLKSQIAILFILLLIFFCQNLVRVLGDAVDGDVPT
FT                   NLVLSLLALGVPKMAQLILPLSLFLGLLMTLGRLYTDSEITVMHACGLGKRTLIIAAMV
FT                   LALFTSVIAAANVFWVGPWASRYQDVVVSEAKANPSIAGLAEGQFKTSQDGNAVLFIGN
FT                   VKGSTFNNVFLAQLRPNGNQRPSVVVAEHGQINQMKDGSQVVTLDKGTRFEGTALLRDF
FT                   RITDFNDYKAVVGHRAVTVDGNQAEQMSMKTLLASDDPDARAEFHWRLTLVLSVVIMAL
FT                   LVVPLSVVNPRQGRVLSMLPAILLYLIFFLLQTSLRSNGGKGKLDPMVWLWVVNAAYFA
FT                   IALALNLWDTVPMRKLRARLRGAA"
FT   gene            625855..626925
FT                   /locus_tag="Spro_0564"
FT   CDS_pept        625855..626925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0564"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   yen:YE0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39670"
FT                   /db_xref="GOA:A8G980"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A8G980"
FT                   /protein_id="ABV39670.1"
FT                   /translation="MFGVLDRYIGKTIFNTIIMTLFMLVSLSGIIKFVDQLRKVGQGEY
FT                   TALSAGMFTLLSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRMQIAGSV
FT                   MKTAIPLVLLTMAIGEWVAPQGDQMARNYRAQQMYGGSLLSTKNGLWAKDGTDFIYIER
FT                   VAGEKELSGVNIYHFNDQRRLETVRYAASASFEDGVWKLSQVDTSDLTNEKQVTGTQTL
FT                   TGEWKTNLTPDKLGVVALDPTSLSISGLHNYVKYLKQSGQEANRYQLNMWSKVFSPLSV
FT                   AVMMLMALSFIFGPLRSVPMGVRVVTGISFGFLFYVLDQIFGPLSLVYNMPPVLGALLP
FT                   SMLFLLISVYMLLKRK"
FT   gene            627171..627255
FT                   /locus_tag="Spro_R0027"
FT                   /note="tRNA-Leu3"
FT   tRNA            627171..627255
FT                   /locus_tag="Spro_R0027"
FT                   /product="tRNA-Leu"
FT   gene            627797..628873
FT                   /locus_tag="Spro_0565"
FT   CDS_pept        627797..628873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0565"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: shn:Shewana3_2962 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39671"
FT                   /db_xref="GOA:A8G981"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025758"
FT                   /db_xref="InterPro:IPR026287"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A8G981"
FT                   /protein_id="ABV39671.1"
FT                   /translation="MNWDPETPYNDLPILPPDLERVETRNVLKACISARAAIAELKTAG
FT                   ELIPDQGLLINILPMLEAKDSSRIENIVTTSDQLFQYADRADGADPATKEALRYRTALY
FT                   DGYTHLEAYPLCTNTAITICTKLRAVQTDIRKTPGTVLRDQNKNAVYTPPVGEDVIRNL
FT                   LANWERFIHGDDDLDPLVKMAIAHYQFECIHPFPDGNGRTGRILNILYLIQTGLLSLPI
FT                   LYLSHFILERRDDYYMLLRRVTEEGDWESWILFMLEAIENTSRWTTDKISIVRALMAET
FT                   TEYVREKLPKIYTHELIQALFAQPYCRIDNLVERGVAKRQTASTYLKQLVEIGILEEMR
FT                   VGREKLYINTRLLQELNQ"
FT   gene            629129..629764
FT                   /locus_tag="Spro_0566"
FT   CDS_pept        629129..629764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0566"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: kpn:KPN_02014
FT                   putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39672"
FT                   /db_xref="GOA:A8G982"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A8G982"
FT                   /protein_id="ABV39672.1"
FT                   /translation="MQHIIEGFLSFQKEIFPQRKELFRSLASSQNPKALFISCSDSRLV
FT                   PELVTQQDPGQLFVIRNAGNIVPSFGPEPGGVSATIEYAVVALGVTDIVICGHSNCGAM
FT                   KAIASCQCLDPMPAVAHWLHYADAAKAVVEKKTWDNEIDKVNAMVEENVIAQLNNIKTH
FT                   PSVAVGLRNNGLRLHGWVYDIESGEIRTLDKNTKNFVSLADNPAVHFE"
FT   gene            629991..630239
FT                   /locus_tag="Spro_0567"
FT   CDS_pept        629991..630239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0567"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ent:Ent638_2034 putative transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39673"
FT                   /db_xref="GOA:A8G983"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A8G983"
FT                   /protein_id="ABV39673.1"
FT                   /translation="MKITSAQMLAHTLRNERKKRNQSQSKTADSVGLKQATVSAFENNP
FT                   DGTRLETLFKLLAALDLELQVTPRGKPVDPKTWDQEW"
FT   gene            630242..630592
FT                   /locus_tag="Spro_0568"
FT   CDS_pept        630242..630592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0568"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_04693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39674"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A8G984"
FT                   /protein_id="ABV39674.1"
FT                   /translation="MEKLRVALNGTVVGTLEKHAGGAMSFVYQEEWLAQAGARAISLSL
FT                   PLQPEPFRGDMVYNFFDNLLPDSELIRSRIQARFRTTTKQPFDLLASIGSDCVGAIQLY
FT                   PEHAEEVPVKLK"
FT   gene            complement(630641..631708)
FT                   /locus_tag="Spro_0569"
FT   CDS_pept        complement(630641..631708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0569"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39675"
FT                   /db_xref="GOA:A8G985"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A8G985"
FT                   /protein_id="ABV39675.1"
FT                   /translation="MSKFRLLLVEDNEQDREVCRDTIVRYRAQTHRDIELIECESLEEA
FT                   LEKIDNTFDGAIIDMKLAEQGNEGNQVIQIIEQSQLRIPVAILTGTPDPVNTDFVNIGV
FT                   FKKGDPGAKYEDLLNIFWEIYDTGLTRIMGGRGIIESTLYQVFRGNLLPQKEKWMLYGS
FT                   QSPEKTEKALLRHALSHLLQLLDDDGDRSYPEEMYLYPPLTAQIKTGSIVTERAGQVKY
FT                   VVMNPACDLVMRAPNMCNTDRVLLAEIISQQRLFPDYPEAGYSNSQKGELQKAFKNNKA
FT                   PYFHWLPKTNFFAGGFINFRNISTVPYDGFLEVYSQPEIQISASFIKDIIARFSIYYAR
FT                   QGQPDINFDNFITPA"
FT   gene            complement(631710..633872)
FT                   /locus_tag="Spro_0570"
FT   CDS_pept        complement(631710..633872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0570"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: azo:azo0358 putative two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39676"
FT                   /db_xref="GOA:A8G986"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A8G986"
FT                   /protein_id="ABV39676.1"
FT                   /translation="MDSIISYKIRPAGRHILTIGRDLIQDSYAAVVELVKNAYDADSPD
FT                   IHIEFRANSKLNTTSIVITDRGHGMSRDTVVNKWMVPSTKDKQERRKSPSGRIMQGRKG
FT                   VGRYAASILGTDFLLETVDNHGDKTTAFIEWDAFENAEFLEDVEILIETIPTSEPSGTR
FT                   LTMSGDINVLQEWDQTQFNKLRFELKKLIPPISSINNNDFSEDFSITLSIEGFPNVDDI
FT                   IESIVPYPIFELFDYRITGFIGADGNGTLRYSQQNARNTFADEIIFDSGTDSSCGELVF
FT                   DIRVYDRDKNAIESLIERGLRDDRGNYVGKLQARQLLNEYNGIGVYRNGFRIRPLGDAD
FT                   FDWLKLNEQRIQNPSLRIGNNQVIGYVLIQSDESSGLVEKSARDGLKENKAFSRLKEIT
FT                   RMVISKLEERRFDYRRTAGISRSTTKVERELEGLFSFDALKKDISSRLTKGGVDQQTVR
FT                   EVFEIIDRDAEEKNKVADDIRQTVAIYQGQATLGKIINVILHEGRRPLNYFNNQIPNMN
FT                   FWADRFRQENDIESLEKVIPIAEGIADNAEIFVKLFSRLDPLAAGKRAAKKQFDLKKMI
FT                   QGSFSVFTEEMKSQNVQLRVIGEDGIKFLSWQQDMYAIFTNLADNSLYWMETKKIPDRQ
FT                   IVVDIVTDDGVLLHIDYHDTGPGIEPKFISSEMIFEPEFSTKKSGTGLGLAIAGEAAMR
FT                   NGLELKAFEAKHGAWFRLQPITEDNE"
FT   gene            complement(634208..635422)
FT                   /locus_tag="Spro_0571"
FT   CDS_pept        complement(634208..635422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0571"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="PFAM: Restriction endonuclease EcoRII; KEGG:
FT                   acr:Acry_3581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39677"
FT                   /db_xref="GOA:A8G987"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR015109"
FT                   /db_xref="InterPro:IPR015300"
FT                   /db_xref="InterPro:IPR023372"
FT                   /db_xref="InterPro:IPR038365"
FT                   /db_xref="UniProtKB/TrEMBL:A8G987"
FT                   /protein_id="ABV39677.1"
FT                   /translation="MSDFQNWLTEKSSDNWYIHIKRLSANDTGASGGHQSGVYLPNNSA
FT                   NFLFPSINRIDEENPSVGLTAKIISHEVNDSQVRAVYYNSKLRNLNPKGRNETRITCWG
FT                   GQKSPVQNQNNTGAIAIFAFYTPENLKDCGLVEAWVCCTVEEEDLLEAIIGEVLPGTAR
FT                   SGPSAQILGGFAIDDSDWKSHNYSIPDPWKVTFPSGSDIIEYLPNIFKFKGDTPDKLLL
FT                   ERREKEYSLFRQIEEIHVLDKIKKGFNSVEEFIELANSVSNRRKSRSGKSLEMHLEKIF
FT                   LANGLTTFTTQSITEGKKKPDFLFPSGIEYHNPAYPAENLRMLAVKTTCKDRWRQAINE
FT                   ANRINNIHLFTLQEGVSANQFQEMKDAGVTLVVPEPLHKKYPEKIRSELVSLSDFISET
FT                   LAIYT"
FT   gene            complement(635584..636057)
FT                   /locus_tag="Spro_0572"
FT   CDS_pept        complement(635584..636057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0572"
FT                   /product="DNA mismatch endonuclease vsr"
FT                   /note="PFAM: DNA mismatch endonuclease vsr; KEGG:
FT                   plu:plu0339 very short patch repair protein (DNA mismatch
FT                   endonuclease) (Vsr mismatch endonuclease) (V.EcoKDcm)"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39678"
FT                   /db_xref="GOA:A8G988"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A8G988"
FT                   /protein_id="ABV39678.1"
FT                   /translation="MADVHSPSIRSKNMRAIRNQNTAIEKLLSRVLDEAGITYRTQASD
FT                   LPGKPDFVIDDYKAIIFVHGCFWHHHDCYLFKVPATRTEFWLKKIDSNVRRDNDVTRLL
FT                   TEQGWRELIIWECSLKGRIKLSANALSERIEEWLCASDTHAVIDSKGIHQLNN"
FT   gene            complement(636066..637541)
FT                   /locus_tag="Spro_0573"
FT   CDS_pept        complement(636066..637541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0573"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="KEGG: plu:plu0338 DNA-cytosine methyltransferase;
FT                   TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39679"
FT                   /db_xref="GOA:A8G989"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040743"
FT                   /db_xref="UniProtKB/TrEMBL:A8G989"
FT                   /protein_id="ABV39679.1"
FT                   /translation="MSDRLSLSHSTFGRVIMQEFHERAKNFRAEAQEQQLAQQEEDKAL
FT                   VEKLVGIYDQKAIAELLREASGSEWTRESLNRWLKGKTPQKVLIDAEVKLLRSMLPKPS
FT                   SFHPNYKFRFIDLFAGIGGIRKGFEEIGGQCVFTSEWNKEAVRTYKANWYCDPAHHKFN
FT                   SDIREITLSENDDISDQEAYKNIDKEIPDHDVLLAGFPCQPFSLAGVSKKNSLGRAHGF
FT                   ECETQGTLFFDVARIIAAKKPAIFLLENVKNLKSHDKGKTFKIIMETLDELGYEVADAQ
FT                   ATGPSDPKIIDGKNFLPQHRERIVLVGFRRDLNIHGDFSLKNLSQFFPKKRPSFGELLL
FT                   EDVAPKYILTEHLWKYLYNYAKKHQAKGNGFGFGLVNPKNESSVARTLSARYHKDGSEI
FT                   LIDRGWDMELGEKDFADPENQANRPRRLTPKECARIMGFETPGGADFYIPVSDTQAYRQ
FT                   FGNSVIVPAFAAVAKLLEPYIASAVSKDKSEAA"
FT   gene            complement(637675..638016)
FT                   /locus_tag="Spro_0574"
FT   CDS_pept        complement(637675..638016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0574"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39680"
FT                   /db_xref="UniProtKB/TrEMBL:A8G990"
FT                   /protein_id="ABV39680.1"
FT                   /translation="MEMTDMENISQNIASETATSTLALYRELFNQIDLHDLTPSQLLDL
FT                   AALSAEQTEGLCNGLMLFNELLQTSSQPNAVDWGQLNSYLNATAHLLPALCNLHGRALR
FT                   EMEYHEVMK"
FT   gene            complement(638360..639790)
FT                   /locus_tag="Spro_0575"
FT   CDS_pept        complement(638360..639790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0575"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   sdy:SDY_2912 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39681"
FT                   /db_xref="GOA:A8G991"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A8G991"
FT                   /protein_id="ABV39681.1"
FT                   /translation="MSDSTFPQGFLWGGALAANQSEGGYREGGKGLTTVDMIPHGPNRM
FT                   PVKLGLEKRFALREDEFYPSHDAIDFYHRYRDDIALMAEMGFSVFRTSIAWSRIYPNGD
FT                   ELTPNPEGIAFYRSLFKECRKYGIEPLVTLCHFDVPMHLVTEYGSWRSRKMVEFFTRYA
FT                   RTCFEAFDGLVKYWLTFNEINIVLHSPFSGAGLVFEADENPEQVKYQAVHHELIASALA
FT                   TRIAHEVNPANQVGCMLAGGNFYPWSSKPEDVWAALEKDRENLFFIDVQARGAYPSYSA
FT                   RVFREKGVSIAMEEGDADILKNTVDFVSFSYYASRCASADMNDNNSSAANVVKSLTNPH
FT                   IPRSDWGWGIDPLGLRITMNMMYDRYQKPLFLVENGLGAHDEFNADGEIADDYRISYLR
FT                   EHIRAMADAIADGVPVMGYTTWGCIDLVAASTGEMSKRYGLVYVDRDDHGNGTLTRTRK
FT                   KSFWWYKQVIASNGADLG"
FT   gene            complement(639807..641249)
FT                   /locus_tag="Spro_0576"
FT   CDS_pept        complement(639807..641249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0576"
FT                   /product="phosphotransferase system EIIC"
FT                   /note="PFAM: phosphotransferase system PTS EIIB protein;
FT                   phosphotransferase system EIIC; KEGG: yen:YE1256 PTS
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39682"
FT                   /db_xref="GOA:A8G992"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A8G992"
FT                   /protein_id="ABV39682.1"
FT                   /translation="MPKNYAEISPAIVKALGGLTNIEAVTHCMTRLRFVVKDKALIDTL
FT                   ALKAINGVLGVVHSGEQCQVIIGNEVSKAYQAVLALGMPGNPPTATPAKRKITLKGIGA
FT                   GILDALIGTMSPLIPAIIGGSMVKLLAMILDMFGVFEKGSSTLVILNVIGDGAFFFLPV
FT                   MVAASAALKFKTNMSLAIAIAGVLLHPNFIDLMAKAAQGQAVEFAYIPVTAVKYTYTVI
FT                   PALVMTWILSYIERWVDRITPAVTKNFLKPMLIVLIAAPIAIVFIGPVGIWIGSGISAL
FT                   VYTVHGYLGWLSVAIMGAIWPLLVMTGMHRVFTPTIIQTIAETGKEGMVMPSEIGANLS
FT                   LGGSSLAVAFKTKNRELRQTALAAAASAIVAGISEPALYGVAVRLKRPLIASLISGFIC
FT                   GAVAGLGGLASHSMASPGLFTSVQFFDPTNPMSIVWVGGVMVLAVVLSFVLTLLLGFED
FT                   IPENEEAPTTTAPAANTANATH"
FT   gene            641536..642570
FT                   /locus_tag="Spro_0577"
FT   CDS_pept        641536..642570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0577"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   ent:Ent638_3187 regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39683"
FT                   /db_xref="GOA:A8G993"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A8G993"
FT                   /protein_id="ABV39683.1"
FT                   /translation="MATILEVANRAGVSKATVSRVLSGSGYVSPEKRERVDKAIAETGY
FT                   RPNLLARNLATKTTQTIGLVVTNTLYSGNYFSELMFQSARIMEEHGRQLILADGKHTAA
FT                   EEKAAIEYLLDMRCDGVIIYPRFLSISEMDEIISRHKQPILVINRRLRLNDSYCIFSDQ
FT                   HAASVTAVQQLIERGHRDIAFITGSLDSPTGLERLSGYKSALAEHDIGVKDALIVEGKW
FT                   NAQSGMAAVDKLLAGGHAFSAIVASNDEMAIGAIKRLTECQIPVPSAVSVIGFDDIPLA
FT                   PYTIPSLSSVKMPVSEMIKETIHRLVSMLDGGELSKRPSFPASLMLRDSVAAGPYWLAE
FT                   KARG"
FT   gene            complement(642567..643334)
FT                   /locus_tag="Spro_0578"
FT   CDS_pept        complement(642567..643334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0578"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: mmw:Mmwyl1_0262 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39684"
FT                   /db_xref="GOA:A8G994"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A8G994"
FT                   /protein_id="ABV39684.1"
FT                   /translation="MAWLSAQDEFDPDAINNSVLGIAAELAQHDSGPHWHNMGQLLFSQ
FT                   RGCMRITLNESICLLPPARIAWIPPLVVHRVQVTGVAGYRSVYLDNHRYPGLSPHLEVL
FT                   SASSLLREVLERIALADFTTQWESGPSANILAVCLDEIRHAQRELTLLPLPKDRRLRQL
FT                   AGMEEVPPLNELARYSGASEKTISRIFRKETGLSYQQWRQQWRLIKAIELLAEGYGLSD
FT                   IAGKLEFSSDSAFSTFFKNMTGSSPRAYMLIRR"
FT   gene            643439..644626
FT                   /locus_tag="Spro_0579"
FT   CDS_pept        643439..644626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0579"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmw:Mmwyl1_0263 drug resistance transporter, Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Spro_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABV39685"
FT                   /db_xref="GOA:A8G995"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A8G995"
FT                   /protein_id="ABV39685.1"
FT                   /translation="MQRRLTLTLATLMMMFPQIVETIYSPALTHIADGFHVSAEVAAQT
FT                   LSCYFFAFAFGVVIWGRLCDVIGRRPTILAGLALYLLASIIAIFSTGFTLLLAARVLAA
FT                   FGAAVGSVGTQTAIRDRFDGYELARVFSVMGIAMAVSPAVGVLSGALLTHYWGYQGVFA
FT                   GLAALAALLLAYAAWQLPETRPAQVVKSSFFGTFGRMVKDGDIWRSAWLVALFNVCMFS
FT                   YYQLAPFRFEALGLPPQWFGYTGLVLAAGVGIGAAINKFLIAKQWLFTPLLMLACVLAL
FT                   IGGGLVFLLEDKLWFVLPMMLVVMAYGIAIPNILARALRNYKDCMGTAGAILGLMYYLM
FT                   LAAGLVLAGLAQRPGIVLMTSSACALLLALTVVRGERNIAISTQPGKPLPDRLLR"
FT   sig_peptide     643439..643501
FT                   /locus_tag="Spro_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.861 at
FT                   residue 21"
FT   gene            complement(644582..645544)
FT                   /locus_tag="Spro_0580"
FT   CDS_pept        complement(644582..645544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spro_0580"
FT